loss of intervening sequences in genomic mouse α-globin dna inserted in an infectious retrovirus...

4

Upload: howard-m

Post on 24-Jul-2016

213 views

Category:

Documents

0 download

Report

Download

Embed Size (px):

TRANSCRIPT

Page 1: Loss of intervening sequences in genomic mouse α-globin DNA inserted in an infectious retrovirus vector

Page 2: Loss of intervening sequences in genomic mouse α-globin DNA inserted in an infectious retrovirus vector

© Nature Publishing Group1982

Page 3: Loss of intervening sequences in genomic mouse α-globin DNA inserted in an infectious retrovirus vector

© Nature Publishing Group1982

Page 4: Loss of intervening sequences in genomic mouse α-globin DNA inserted in an infectious retrovirus vector

Anemia Karena Kelainan Sintesis Globin

Molecular Haematology I Globin Disorders

Tutorial Intervening

Expo Retrovirus

Molecular Basis for the Evolution of Species …human -globin baboon -globin chimera, observed in Fig. 3A.Asfor -globin, no single residue substitution improved binding by S. aureus

Retrovirus: HIV 1 parte

c 21 Retrovirus

Valentina benitez bedoya, retrovirus

HTLV-1. Infecciones por retrovirus

Pustaka Unpad Penggolongan Retrovirus

Hemoglobin (Hb) Hb is found in RBCs its main function is to transport O 2 to tissues. Structure: 2 parts : heme + globin Globin: four globin chains (2

Retrovirus Hiv 2006

Beta Globin Gene Cluster

Human Endogenous Retrovirus (power point)

-globin ( 141) and -globin (146) V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS--H---GSAQVKGHGKKVADAL VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAF

Feline Retrovirus Management Guidelines

Molecular Cell, Vol. 10, 1453–1465, December, 2002 ... · Looping in the -globin Locus 1455 genes in vivo in expressing tissue with the intervening -globin locus is flanked by olfactory

Aafp Feline Retrovirus Management Guidelines

Retrovirus (VIH y HTLV)

Limited Number of Globin Genes in HumanDNA10-7, or 0.198 ngof globin DNA.FromEq. [1] wecan calculate the %hybridization, P, expected for anynumberof globin gene copiespresent.Forexample,inExp.1,

Retrovirus Replication by bhuvanesh kalal

a -globin ( 141) and b -globin (146)

Virus, Viroides, Retrovirus y Vacunas

6ta Clase Retrovirus - Usjb

Retrovirus vih mico

PBL Gen Globin Pasca

Beta-Globin gene Activity

Recombinación, transposones y retrovirus