bonnie magazine march 2013
DESCRIPTION
Sacramento's lifestyle magazine for womenTRANSCRIPT
3march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
6
18
10
6 INSPIRE// Jenny Beard’s life continues while battling cancer
10 FASHION HISTORY// Sacramento’s historical hats
18 CAREER// Meea Kang empowers communities
27 TRAVEL// Planning your fall getaway
42 POP CULTURE// Catfish101:onlinelurestoavoid
IN EVERY ISSUE22//Mobilizing Leadership30//916 Events34//Retail Therapy36//I Love...37//Ask Miss Know It All38//Snap Shots41//Fab University46//Life Transformation48//Reviewed50//She-tistics
CoverphotoshotonlocationatExpress Employment Professionals in Roseville.PhotobyEmilieBourd-agesPhotography.MakeupbyChristiReynoldsMakeupArtistry.
bonnie m a g a z i n e
publishedbyBigMonkeyGroupLLC
address 1017 L Street #731 Sacramento, CA 95814
telephone 1.888.289.0521fax 1.866.298.0408
www.readbonnie.com
publisher SHAWN CRARY
editor GAYLE R. ROMASANTA
advertisingdirector NOEL FIELDING
advertisingexecutives LISA ADAMS
KRISTEN CRAIG EMANI THOMPSON MICHELLE HAYES SUSAN HARTLE
art director SHAWN CRARY
web and graphic design LOUIE AMBRIZ
contributing writers STEPHANIE GARCIA
SOMMER HAYES CHERISE HENRY
CHRISTI REYNOLDS ANNE ROSE
MISS KNOW IT ALL
photographers LOUIE AMBRIZ
EMILIE BOURDAGES PHOTOGRAPHY
accountsreceivable/payable ERNESTO GALLARDO advertisinginquiries
[email protected] ideas or comments [email protected]
billingquestions [email protected]
bonnie magazine is published monthly and distributed to over 550 high-traffic loca-tions throughout the Greater Sacramento Re-gion. 19,000 copies are printed each month. All rights reserved. Reproduction or use of thecontents in whole or in part without the written permissionofthepublisherisprohibited.Publisheris not responsible for the accuracy of copy or com-mentssubmittedtoBigMonkeyGroupLLC,and/orbonnie magazine.Contentsmaybeeditedforclarityandlength.©2013BIGMONKEYGROUPLLC
{inside}
27
48
42
ON THEcover
5march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
This month we celebrate the beginning of spring with an inspirational woman who amazed us all at bonnie with her vibrancyandwilltoliveherlifetothefullest.JennyBeard,abeautifulwoman,charmeduswithherhumblenature,
andbright,blueeyes.Herstoryfilledbonniestaffwithawe.ShehasstageIVcancer—andlookedradiantatthephotoshoot.Shewasener-geticatherfamily-ownedbusinessthedayoftheshoot,andwasbusygettingpaychecksreadyforthoseemployedatherstaffingagency, Express Employment Professionals inRoseville.Underneathherdown-to-earth attitude was a woman who could light up any room with herloveandstrength.Allofuswho met her felt her warmth and energy and were inspired byit.Sheisremarkableandwell-loved—byherfamily,bonnie staff,andanyonewhogetsachancetotalkwithher.
bonnie was also able to also spend time with Meea Kang, president of Domus Devel-opment, a visionary in residential develop-ment. The developer behind La valentina in downtown Sacramento also brought her adorable daughter Alana to the photo shoot. Kang wanted her daughter to be able to see how much she loved what she does for a living, just like her mother showed her when she was younger. It was a beautiful thing to see—mother and daughter showcasing what’s important when it comes to life and building better spaces and communities—love and connection.
Celebrate Women’s History Month this March. In our reviewed section bonnie puts together some of the most famous must-reads by or about women pioneers in pop culture, history, literature, politics, and beyond. We felt it important to be reminded that less than 100 years ago women were not allowed to vote (check out She-tistics on page 50 for amazing women’s history facts)! Here we are today, celebrating that we’ve come a long way, still have some work to do, but we’re not looking back! We also worked with curator of History veronica Kandl of the center for Sacramento History. The center and Kandl curated our historical hat fashion spread for this month’s issue. Believe it or not, this shoot took twice as long as a regular fashion shoot with live models. The lighting and background had to be precise to showcase the headware perfectly.
We also invite you, our dear reader, on a fun and interactive Hawaiian getaway from April 2-9! We partnered up with local travel expert Anne rose, bonnie publisher Shawn crary along with bonnie office manager ernesto Gallardo to give you an inside look into an affordable, amazing Hawaiian vacation. You can see all of their videos, photos, and live blogs about what it takes to have a seamless and fun vacation in Hawaii. You’re invited to interact by asking questions, suggesting sites to see, or restaurants to try. Shawn and ernesto will take your recommendations and post their experiences live during the week of April 2-9. To join the conversation visit www.readbonnie.com/publisher or www.facebook.com/readbonnie.
Here’s to starting off the spring with hope, love, and community!
Gayle r. romasanta // editor
from the ed
itor’s desk
Bonnie’s Boo-Boo Last month we had a big oopsie and didn’t credti our makeup maven and hairstylist for our 24 Hour Luxury fashion spread. Christi Reynolds was responsible for the heavenly makeup and Amanda Lee created the sexy hair. Christi also did hair and makeup for the Cheryl Anderson and Allison Brennan photo shoots. We love these ladies!
sHoW & TeLLAfterdiscoveringderma-
tologistDr.CynthiaBailey’swebsite (www.drbaileysk-incare.com),IfinallyfoundmyHolyGraildryskintreatment! She mentioned Vermont’sOriginalBagBalmfordryskinonherblogasher go to product for dry skin.ThetinIhaveislarge,butitfitsintomytotewithmybooks,makeup,andtheoccasionalspilledgoldfish.IalsokeepitonmybedsidetableandputitontoworkitsmagicwhileIsleep.Forunder$10andeasytofindatalocaldrugstore,it’sawe-some for chapped and dry lips,hands,cheeks,andfeet(some use it for baby diaper rashtoo!).I’llbetryingouther other fabulous recom-mendations next month in myTransformationarticle.Let’shopethey’rejustasgoodastheBagBalm.
PHO
TO BY // G
ENA
ROM
A PH
OTO
GRA
PHY
6 march >> 2013
bonnie magazine {sacramento’s lifestyle magazine for women}
insp
ire
Fighting Stage IV Cancer and Living Against the Odds
BY // STEPHANIE GARCIA
The offices at Express Employment Professionals are unlike any others in the Roseville business complex. The walls are painted in bright, clean green, and blue hues. Each area has a trinket of relaxation—a Zen garden,
a Buddha statue, and a meditation frog. There are inspirational quotes in beautiful letters scribed on the walls, and the light shines throughout the open floor plan. That’s how the owners, Eric and Jenny Beard, wanted it—happy, welcoming, a peaceful and productive environment. After all, they are in the business of getting people jobs in an economy that hasn’t been so kind.
I walk over to a wall of thank-you cards, photos and letters. It’s a cheerful area, just as the rest of the office seems. I can’t help but smile. The energy in the office is lively, carefree, and a place that I would like to visit again.
From the colorful ambiance to the kudos on the poster board to the happy employees, everything is full of positivity. It’s hard to believe that the reason I am there is to interview one of the owners who is battling stage IV breast cancer.
I sit down and rethink my approach to this interview. Initially, I as-sumed that with stage IV cancer, Jenny Beard is battling for her life, and she might not have much time. She’s a mother, a wife, a busi-
ness owner, and she has a heart of gold. She’s inspired many with her dedication to her work and her devotion to her family. I had prepared to interview a dying woman. But that all changed when the door opened.
In walked a beautiful blonde, wearing a flowing black skirt, scoop-neck, pink, lacey blouse and knee-high leopard print, high heel boots. She’s carrying paperwork, a large bag, and a plate of what appears to be homemade, pink cupcakes. Her makeup is flawless and her smile is wide. Surely this can’t be her. This isn’t a woman who is dying of cancer. This is a woman full of life.
“Hi,” says Jenny. “Come on in, sorry I’m late.” She thinks I care. She’s so sweet. I already love her.
We go into a conference room where Jenny tells me she doesn’t know why she was chosen for this story. “There’s nothing special about me. I just have cancer and I’m trying to fight it, and I really think there’s a lot more I could be doing,” she says.
We skip the informalities and begin to chat like girlfriends. Jenny tells me her story, and our parallels shock me. We both have teenag-ers and toddlers. We are both hard-working, go-getters. We share a quick sense of humor, a sales management background, 12-year old wedding rings, and we are about the same age. She is someone I am drawn to immediately. It’s hard to put into words why—but she radiates with a light that I can feel and as silly as it might seem, I can see it too.
Jenny is busy—too busy for cancer. She has three children at home, a thriving business with her husband, and a daughter attend-ing college in Southern California. She has a two-page to-do list with check marks, and it’s only 10:00 a.m. She tells me she feels she needs to be doing more. This round of chemotherapy has taken a lot out of her, including her hair, and she’s frustrated that she’s been forced to take a behind-the-scenes approach to working through chemo treatments. It doesn’t sit well with her.
I tell her that I don’t know where to begin. She has taken me by surprise. She reassures me, as she will do several more times during our two-hour talk. “Well, I’ll tell you that even before this [stage IV metastasized breast cancer] I thought I had my own story.”
In 2004, Jenny and her husband took a leap of faith. They moved their family of five to Rocklin and opened a staffing company from scratch. With his experience in accounting and hers in sales and marketing, it was great match. “We put everything on the line to open this business,” she says. There was no income, they had two
Hope Lives Here
{sacramento’s lifestyle magazine for women} bonnie magazine
7march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
PH
OT
O B
Y // E
MILIE
BO
UR
DA
GE
S P
HO
TO
GR
AP
HY
small children, and a ten-year old, and they were deter-mined to make it succeed.
The plan was working, for about seven months. In March of 2005, upon a routine self-exam, Jenny felt a lump in her left breast. The diagnosis was a slow-growing, breast cancer in two different quadrants of her left breast. She was 32.
The diagnosis was scary, but the doctors were opti-mistic. “I felt like there’s nothing I can do about it, so I would always take the worst case scenario, which was death, and work backwards from that,” Jenny says. The cancer was caught so early that it didn’t worry her too much. On May 5, 2005, she received a single mastec-tomy. With her positive attitude and cancer in remission, she felt ready to take on the world again. She thought that maybe this happened for a reason; she thought maybe she would be able to help someone in the future.
In 2008, as the employment market started to plunge, Jenny thought that maybe her cancer story had inadvert-ently prepared her to deal with the hit that her business would take. This scared her more than cancer. “When the economy crumbled, being that we are in the em-ployment business, we were scared,” she remem-bers. “We are a source of encouragement to people who come here and seek our services, and we didn’t have any jobs for them. That was a crisis. That was scary.”
Although she had worked through her cancer experience, she never let it affect the business. In doing so, Jenny gained confidence. “We went through that [breast cancer] as a six-month-old company,” Jenny says. “In my head, if we went through that, we could take on this recession.”
It was a long process, and there
continued on page 8
Hope Lives HereMakeup//Christi Reynolds Makeup Artisty //Sacramento
Location//Express Employment Professionals //Sacramento
8
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
JennY BeARDcontinued from page 7
were some tough decisions and dark days, but as other staffing companies closed their doors for good, the Beards’ company made it through. To celebrate, they had a small party in 2009 called THINK BIG. “It was kind of an open house,” she says. “We were expecting 30 people to come, and were amazed when 150 showed up.” It’s clear to me that Jenny puts as much positivity into her business as she does in her life, so of course it was a success.
That year, Jenny and her husband were in a good place. The kids were 20, 10, and 8-years-old. Life and business were stable and good things were on the horizon. But, with a quick getaway to Las Vegas, the couple soon found out they were pregnant.
A little boy was born in May of 2010, but as soon as she got home from the hospital, she began to have vision problems. Jenny was soon diagnosed with a rare eye disorder called a macular hole. “With a macular hole, if you don’t fix it, you go blind,” Jenny says. She knew she had been though worse, so she went forward with a procedure
to correct the hole. A vitrectomy consists of placing a gas bubble behind her retina. The proce-dure would only work if she kept her head down, looking at her toes, for seven days during recovery. “The bubble acts like a stint and I had to eat and drink while looking down,” she says. “This was harder to recover from than my mastectomy.”
Unfortunately, it was about to get a lot harder. One side effect from the delicate surgery is a retinal detachment. The solution is to have another vitrectomy. Within six months, that hap-pened—twice. To make matters worse, between her second and third surgeries, she was diag-nosed with cancer—again.
What started out as an in-patient procedure to remove a cyst, ended up being a cancer-ous tumor. The diagnosis was grim. Jenny had stage IV meta-
static breast cancer. The cancer had spread to her back, lungs, glands, and neck.
According to The Ameri-can Cancer Society, recent introductions of new chemo-therapy drugs have significantly improved survival of patients diagnosed with stage IV breast cancer, but the statistics remain at about a 20% survival rate at five years. “To me, that meant I had a 20% chance of being alive in five years,” she says. That was two-and-a-half years ago.
“It’s an ugly stat, it seems un-real. But the worst thing that can happen is I can die.” We both take a moment. This is the same thought process she had before, but this time, it feels heavier.
“With metastasized cancer, they don’t go after every tumor in your body.” Instead, she has endured three rounds of chemo, a clinical trial, and hormone
therapy. So far, none of her treatments have been success-ful. The cancer has now moved to her pancreas and her liver. Once again, she sees the lighter side of bad. “The good thing is that it’s a slow-moving cancer.”
Jenny is on her fourth round of chemo. She will find out her results at the end of March. True to her optimistic nature, she sees the good in the chemo failure. “I don’t have time to dwell on the ‘what-ifs’ because I don’t know. Not knowing is the hard part.”
Not knowing can’t be put on a to-do list. It can’t be planned for. To someone like Jenny, not know-ing can be overwhelming. “There’s so much I want and need to do – there’s kids, a business, things I want to do … I need to start taking a lot more pictures.”
I feel like I might lose it. I can’t imagine being in her shoes. But then she says something that
Jenny’s hope video caught the attention of International pop
superstar Celine Dion, who recently shared it on her Facebook page.
Kaitlyn (12), Joslyn (22), Jenny, Eric, Cody (2), Zackary (11), and Buster at Folsom Lake. PHOTO BY // SUZETTE ALLEN
9march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
“I’ve experienced so many blessings along this journey.”
—Jenny Beard // Owner, Express Employment Professionals { {
makes me want to jump across the table and hug her. “You know, people have it much worse than I do,” she smiles. “I’ve experienced so many blessings along this journey.”
She made a vision board with her employees. “We did it as an office experiment together in 2008.” She wanted to see Celine Dion, she wanted to see her daughter go to college, she wanted a new bed, and she wanted to go on a cruise to Alaska.
As time has passed, many of her visions on her board came to fruition. She got a new bed, and she not only got to see Celine Dion in concert, but the singer also posted a video of Jenny and her family on her own Facebook site (see www.readbonnie.com/video/ to watch the video). Her eldest daughter is in college and last year, her friends and family surprised her on her 40th birthday with a surprise party—including a cruise to Alaska. “I was surprised with the party, but then they pre-sented my husband and me with a cruise to Alaska.” Jenny pauses to remember that night. She smiles. “That was a really amazing surprise.”
She tells me it’s undeserving. She tells me this often. The woman who shines so brightly on others cannot accept the same love back. It’s hard for her to see how she exudes hope, but I see it. “I don’t know why people think I’m inspiring,” she says often. “I don’t think I’m doing things different than anyone else in this situation.”
I try to reassure her. She has
PH
OT
O B
Y // E
MILIE
BO
UR
DA
GE
S P
HO
TO
GR
AP
HY
been through so much. I know I am not this strong. I think I would have thrown in the towel. “I guess I don’t think about that, ever,” Jenny says.
This is true. The woman who continues to work, spend time with her family, and plan for the future, finds a sort of reprieve at her weekly chemo sessions. Once, she told the nurse, “I really just like sitting here. I can just relax. You probably hear
that all the time.” The nurse was surprised and said no, not really.
Her unpretentiousness is sweet. Her outlook is hopeful. She believes in Karma and God, and refuses to talk about dying. “There are people who can live with this disease for many, many years, like 15 years,” she says. “I truly am at peace with what-ever happens…but, I believe a miracle is about to happen.”
Before this interview, I thought
people with stage IV breast cancer were sick, in pain, termi-nal, and perhaps waiting to die. But, everything changed with this interview. Jenny is a beacon of hope. I interviewed a woman who loves life, her children, her marriage, and her company.
Even with a seemingly dev-astating diagnosis, this woman is living—more than many of us are, and that is inspiring. b
bonnie magazine {sacramento’s lifestyle magazine for women}
10 march >> 2013
in honor of Women’s History Month, bonnie partnered with the Center for sacramento History to showcase historical hats worn by or sold to local sacramento women throughout
the 18th and 19th century. The following hats will be part of the Center’s “Hats & Headware, inside the Vault Textile Tour,” happening April 18-21. it is the
first ever textile tour program featuring the Center’s extensive collection of historical hats and headware.
For more information about schedule and pricing, visit www.centerforsacramentohistory.org. A special thank
you to the Center and Veronica Kandl, curator of history, for curating the following hats for bonnie.
The Center for sacramento History is a historical research center for the sacramento region and maintains artifact, archival, photographic, and
audiovisual collections, making them available for study and exhibition to the public. Founded in 1953, the Center is the official repository for
the archival records of the City and County of sacramento and also maintains privately donated artifacts, manuscripts, and personal papers
from individuals, businesses, and organizations in the community. The CsH was originally created as an archival repository, but today it is a
highly used humanities research center and provider of public exhibitions and programs.
Photography//Emilie Bourdages Photography //Roseville
Location//Center for Sacramento History //Sacramento
fash
ion
hist
ory
11march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
“When a person is in fashion,
all they do is right.”
—Lord Chesterfield
1//Bright yellow, feather-covered, lampshade hat with
“Happy Cappers Brand for the Field and Co., L.A.” label.
Bought by donor Mrs. Winchester G. Felt for $12.95
in 1965. Mrs. Felt would wear the hat while she and
Mr. Felt were working at horse shows because it was
easy for Mr. Felt to spot the hat in the crowd.
1
12
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
“Fashion is architecture. It is a
matter of proportions.”
—Coco Chanel
TheCenterforSacramentoHistoryrunsanAdoptanArtifactProgramforartifactsinneedofdona-
tionstohelppayforthecostofconservation.Thehatsonthesetwopagesarepartofthe
programandareupforadoption.ContacttheCenter for more information on how
youcanhelp,(916)808-7072.
2
13march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
3
4
2//Light green, plaited straw bonnet, early 1880s.
Cost to adopt: $2,150
3//Horsehair hat, mid 1910s. Cost to adopt: $1,250
4//Satin riding hat, 1900s. Cost to adopt: $1,200
14
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
“Fashion is very important.
It is life-enhancing and, like everything
that gives pleasure, it is worth doing well.”
—Vivienne Westwood
5//Black-velvet-covered hunting cap with original receipt for
$30 from Sacramento Saddlery, dated March 8, 1961.
6//White plastic, hard, riding cap purchased in 1965 from
Sacramento Saddlery. Donor Mrs. Winchester G. Felt.
7//Pheasant feather-covered sou’wester hat, ca. 1965.
8//Black and white woven raffia fedora-style hat
from the early 1970s.
9//Small pheasant-covered 1950s sculptured toque hat with
“Patrice” label. Beryl Smith donation.
5
6
7
8
9
15march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
“Clothes are but a symbol of
something hid deep beneath.”
—Virgina Woolf, in her novel, orlando:
A Biography
10//Gray felt hat with grosgrain ribbon rosette, with
“Original Movie Modes Featuring 20th Century Fox Hol-
lywood Stars” label. Belonged to Annie Louise Dunlap. She
and her husband George owned the Dunlap Dining Room,
a restaurant that was located within their Oak Park area
home from 1930-1968. Gray plastic purse, ca. 1965.
Donated by Inez Taylor.
10
16
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
12
11
13
“I dress for the image. Not for
myself, not for the public, not
for fashion, not for men.”
—Marlene Dietrich
11//Peach satin cloche decorated with pastel-colored, satin
flowers and grosgrain ribbon. McClaskey donation. Ca 1925.
12//1950s purple velvet hat with bow and veil.
“Weinstock and Lubin” and “Made by Meadowbrook
for CA,” label. Donated by Helen Clawson, artifacts
belonged to her sister, Peggy Smith.
13//Cream and black velvet hat with black
ostrich feather and floral decorations, ca. 1915.
17march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
14
“A woman’s
dress should be like a barbed-
wire fence: serving its purpose
without obstructing the view.”
—sophia Loren
14//Fur and feather hat with “Jack Sohn Hats,
Sacramento,” label. Matching fur purse muff. Possibly
made from Geoffroy’s Cat fur. The Geoffroy’s Cat is a
small, lightly built, spotted cat, which is highly variable
in coloration. Named after the French naturalist
Geoffroy St. Hilaire, they are found in the geographi-
cal range that covers practically the entire South
American continent. Ca. 1935.
18
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
bonnie magazine {sacramento’s lifestyle magazine for women}
care
er
BY // CHERISE HENRY
march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
19
{sacramento’s lifestyle magazine for women} bonnie magazine
Kang is president and founding partner of Domus Development, a residential development company. Established in 2003, the company aims to incorporate green, energy-efficient building methods and innovative technologies into affordable housing developments. As the founding board member of the California Infill Builders Federation (CIBF), Kang is also a leader in land-use policy.
Her firm focuses on sus-tainability and community revival by developing affordable housing with easy access to public transit in order for families and individuals to thrive. “By doing so, we help to protect the local environment, enhance the quality of life, while educating residents on the benefits of sustainable practices. When people have confidence they begin to thrive… and then their communities thrive,” she says.
Imagine a woman with the intelligence of a scholar, creativity of an artist, and heart of a lion.
Meet Meea Kang, residential developer for Domus Development. Kang works out of her office off K Street in downtown Sacramento and is clearly passionate about her work; this is evident to anyone within moments of meeting her.
continued on page 20
PH
OT
O B
Y // E
MILIE
BO
UR
DA
GE
S P
HO
TO
GR
AP
HY
Necklace//Heart Clothing Boutique //Sacramento
HairandMakeup//Amanda Lee //Sacramento
Location//La Valentina //Sacramento
20
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
MeeA KAnGcontinued from page 19
With nearly two decades of profes-sional experience in the field of residential development, Kang has a resume to be reckoned with. Her background in art, de-sign, architecture, construction, and com-munity development provides her with a rich source of insight and expertise. With a Masters of Architecture from Uc Berkeley and a Bachelor of Fine Arts from cornell University, she has the perfect fusion of education and professional experiences to succeed as a residential developer.
As proof of her talent and dedication to her career, she has received numerous awards on behalf of her company and its projects. Locally, this includes awards for her La valentina project here in Sacra-mento: the Best Infill Project 2012 from the Sacramento Business Journal, the Transit-oriented Development of the Year 2012 from Sacramento regional Transit, and Blueprint excellence Award 2012 from Sacramento Area council of Governments.
Personally, Kang has been awarded the Northern california real estate Women of Influence 2011 by the San Francisco Business Times, and the visionary 2020 in 2010 from Sierra Business council.
When the rubber hits the roadKang says 2012 was her company’s busi-
est year. They constructed and completed projects up and down the state, creating 1,200 jobs and 400 affordable housing units. Kang shares a look of sheer aston-ishment as she reflects on their year of huge accomplishments.
Kang talks about several local projects she’s worked on in recent years including Kings Beach in Lake Tahoe, california, La valentina in Sacramento, and Temple Art Lofts in vallejo, california.
She says one of these projects has proved to be one of the most grueling, yet ultimately satisfying, to complete— Kings Beach. “Kings Beach is a great example of doing the impossible. Absolutely every-body said, ‘there’s no way you’re going to do this, no way you’re going to accom-plish this,’” said Kang. “And we did.”
residents, individuals and families, who once slept in crawl spaces to keep warm, can now settle into quality living conditions of 77 units of affordable housing in Lake Tahoe. It was the first time in 65 years that affordable housing has been approved and built in the area.
“It’s wonderful having my daughter with me now, too, to see the passion I have with what I do,
and work so hard for.”
—Meea Kang//President and Founding Partner Domus Devlopment
Meea Kang and eight-year-old daughter Alana, in front of La valentina in downtown Sacramento.
Necklaceandtunic//Heart Clothing Boutique //Sacramento
HairandMakeup//Amanda Lee //Sacramento
Location//La Valentina //Sacramento
21march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
Kang is a fighter; you can see it in her eyes when she talks about all the trials and tribula-tions she’s experienced over the years. Perseverance and thinking about the good she is doing for the communities, she says, is what keeps her going through the most difficult times.
Kang’s recent project in Sacramento, in the Alkali Flats area, was known for drug dealing and prostitution for nearly 20 years. Kang has now transformed the area into 81 units of affordable housing called La valentina. It sits like a work of art on 12th Street at D and e Streets.
“30 percent of these units have children who are now going to neighborhood schools,” she says. “At the same time, it’s attracting young people who are benefiting from having their first apartment and embracing an urban lifestyle by using regional transit, riding bikes, and working nearby.” Post development transformation, she says, you begin to see the lo-
cal neighborhood beginning to thrive. “crime goes down, ridership on regional transit rises, and you begin to see the community blossom.”
Inspired by familyKang’s first project after starting her business was in one of Oakland’s
roughest areas. Shortly thereafter, she became pregnant and had her baby. “Basically, I gave birth as we broke ground,” she laughs.
When asked about her daughter, eight-year-old Alana, Kang’s face lights up with a smile. Kang tackles the work-life balance head on as a successful, driven businesswoman; she says she has a wonderful and flexible husband who also prioritizes family. “It’s important to balance work and life. Her [Alana] youth is so wonderful and reminds us of what’s really important in life. To have her lens to look through is important.”
Kang spends her free time volunteering and doing fundraising projects for her daughter’s school, taking frequent ski trips to the mountains, and visiting close friends in the Bay Area. But typically, she says, they like to keep a low profile on weekends.
Kang says what’s been amazing is that Alana has been alongside her for most of her major business milestones. At the Kings Beach project when Kang got her first unanimous approval from the governing board, her daughter ran from out of nowhere and jumped onto her lap, she says laughing and reminiscing.
“I think they [the board] then realized that what we were doing was something far bigger than what I wanted to do because it was serving a greater purpose. My daughter helps me to always see that,” Kang says.
Alana was also with Kang at the Sacramento La valentina grand open-ing project, cutting the ribbon with her mom and Mayor Kevin Johnson. “She’s able to be with me… and that is so important.”
Kang says she was encouraged by her mother who was a hardwork-ing woman with great passion in what she was doing every day. “It’s wonderful having my daughter with me now, too, to see the passion I have with what I do, and work so hard for.”
Kang grew up with two hardworking, loving parents who became true inspirations in her life. Her mother was a social worker working with the elderly. “She always inspired me,” says Kang. “She went back to school for her Master’s degree when my younger brother was born and yet she still continued to lead agencies in innovative senior social services.”
Her father was a professor and educator who worked strongly within the community. “Their jobs were more than just jobs. They were there to support the community.” It is obvious how much her upbringing has helped shape Kang into the woman she is today with a dynamic and encouraging spirit.
Kin
gs B
each
//Lake Tahoe
La Valentina//Sacramento
Temple A
rt L
ofts
//Va
llejo
continued on page 45
PH
OT
O B
Y // E
MILIE
BO
UR
DA
GE
S P
HO
TO
GR
AP
HY
22
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
mobilizingleadershIP
bonnie magazine is proud to partner with
the organization California WomenLead—bringingissues
affectingthelivesofwomenaroundthestate.
Mona Pasquil—Empowering Women to be Leaders on California Boards
and Commisions
WhenyoufirstmeetMonaPasquil,appointmentssecre-taryforCaliforniaGovernorEdmundG.BrownJr.,you
maynotrealizeatfirstthatsheisoneofthemostpowerfulwomeninstategovern-ment.Asappointmentssecretary,Monare-cruits,screens,andadvisesthegovernoronapplicantsforkeypaidstaffpositions,highlevelboardssuchattheCaliforniaPublicUtilitiesCommission,orHighSpeedRailCommission,ortothehundredsofvolunteerboardsthatkeepourgovern-mentmoving.Monaisthekeytomakingallofthathappen.Sittinginherofficejustafewstepsfrom
thegovernor,wetalkedaboutwhatin-spiredhertogetinvolved,whatpathledhertohercurrentposition,andwhatshestillwantstoaccomplish.
How did you get started? Did you always know you wanted a career in politics?
IremembervisitingtheStateCapitolwithmyfifthgradeclassandsayingtomyself,“Iamgoingtoworkhereoneday.”FromthereIwentontomajorinEnglishLit[sic],butthe“bug”neverleft.MymothertoldmeifIwasstillinterestedinwork-ingintheCapitolIshouldgoandfindajob,soIdid.Istartedworkingformystateassemblymem-berwhowasJohnGaramendi(nowamemberofCongress)ashisreceptionist.Thekeytobeingthereceptionistiseveryonehastogothroughyou,soIwasabletostartmeetingkeypeoplewhowentontohelpmentormeinthefuture.
Afterworkingasareceptionist,Iwasgiventheopportunitytoworkinotheraspectsoftheas-semblymember’soffice–press,legislation,localpublicpolicyissues.Iwasveryfortunatetohaveabosswhobelievedinmentoringandhelpteachmetheskillstobeaneffectiveleader.ItwasbecauseofmyworkinhisofficeandthementoringIre-ceivedthatchangedmycareerpath.
What other experiences helped lead you to the position you are in today?
AfterworkingintheStateCapitol,Ihadtheop-portunitytomovetothestatetreasurer’sofficeandworkforKathleenBrownasherlegislativedirector.ItwasinherofficethatIwassurroundedbystrong,powerfulwomenwhohelpedfurtherdevelopmyleadershipskills.Itwasinheroffice
thatIhadtheopportunitytotestifyinfrontofthestatelegislatureanddevelopanetworkthatwouldhelpininmyfuturecareerpath.
At one point, you served as lieutenant governor of California (the first woman!) – how did that
happen and what was it like?Whenmyformerboss,JohnGaramendi,was
electedlieutenantgovernorin2008,Iwenttoworkforhimashisdeputy.HewasthenelectedtoCongressandIhadtheopportunitytofillinaslieutenantgovernoruntilthenGovernorArnoldSchwarzeneggerappointedareplacement.Mymostvividmemoryofservingduringthattimewasayounggirlwhocamethroughtheofficeaspartofherschooltour.ShewaswithhermomandIinvitedthembothintomyprivateoffice.Asshelookedaroundhereyesgotbiggerandshesaid“Mom,Ididn’tknowgirlscouldhaveofficeslikethis.”Iwasproudandheartbrokenatthesametime.ProudthatIwasabletoinspireherandshowgirlscouldhaveanofficelikethelieutenantgovernorandsadthatsheneverthoughtagirlcould.Thatmomentinspiredmetoremembertheimportanceofmentoringyoungpeople,especiallygirls,andhelpingthemrealizegirlscanhaveacareerinpolitics.continued on page 24
Mona Pasquil, appointments secretary for California Gov-ernor edmund G. Brown Jr.
Three speakers
Confirmed for
California Women
Lead’s Women
empowerment Day
at the Capitol
Cassandra Pye Helps You empower Your
Personal Brand
Cassandra Walker Pye will be at our Women’s empowerment Day at the capitol on Monday, August 29th, where she will share her experiences and educate attend-ees on how to form their personal “brand.” With her consulting ex-perience in and out of the political realm, she is sure to provide some fantastic insight!Pye serves as senior director in
aPCO Worldwide’s sacramento office and counsels corporate lead-ers, association executives, and political professionals on market entry, corporate positioning, food marketing, and crisis communica-tion.She has advocated for business
interests across diverse industry sectors on a broad range of policy issues, including food retailing, labor relations, environmental re-sponsibility, and lawsuit abuse for over twenty years.Since 2007, she has successfully
led the public relations and com-munications team for the world’s
23march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
What are challenges you have faced along the way?
IthinkthegreatestchallengethatI,andmostwomen,faceisthenotionthatwecan“haveitall.”Yes,Idobelievewomencanhaveitall,butnotallatthesametime.IhavehadtomakechoicesandsacrificestogettowhereIamtoday–someeasierthanothers.Ialsobelievethat,aswomen,weneedtodomoretosupporteachother.Iwasfortunatetohavepowerfulwomen (and men) who mentored mefromthefirstdayIwalkedintotheStateCapitol,butIdon’tknowifthatisstillhappening,especiallyinthepoliticalarena.Ithink,wewomen,needtorealizethereisstillalotofworktodoand we need women willing to takeleadershiproles,whetherapplying for an appointment at thestateorlocallevelorrun-ningforoffice,sothatourvoicesareheardinthedecisionmakingprocess.Weneedmorewomenwilling to mentor and support young women and empower themtobeleaders.
What do you like most about serving the governor as his
appointments secretary?Ireallyenjoyworkingfor
GovernorBrownandworkingashisappointmentssecretary.IthasgivenmetheopportunitytobethementorIalwayswantedtobe.Ourofficespendsalotoftime reaching out to different
groupslookingforapplicantsandIhavetheopportunitytomeet incredible Californians who wanttoserveinanappointedposition.Ihaveagreatteam,mostlywomen,whohelprecruitfolkswhocanpotentiallyserve.ItisafastpacejobandIneverknowwhatissuesIwilldealwithwhenIwalkintotheCapi-toleachmorning.Moreimpor-tantly,Ihavetheopportunitytotravelthroughoutthestateandshare with women and young girlsthattheytoocanhaveacareerinpublicservice.
What do you still want to accomplish? Would you
ever consider running for political office?
Ineversaynever–justliketheopportunitytoserveonthegov-ernor’scabinet,youneverknowwhatisaroundthebend.WhatIdoknowisIwouldliketofinishachildren’sbookIstartedaboutmy time as acting lieutenant governor,aswellasacollectionof funny stories about my time workinginthepoliticalarena.
Finally, what is your advice to women—young, old
and in between?Askotherwomentomentor
you and be willing to mentor otherwomen.Nomatterhowoldoryoung,youwillalwaysbeeducatingyourself.Andremem-ber–italwayscomesdowntohardwork!
Barbara a. Ortega, POW Group ; assembly Minority leader Connie Conway; Senator Liz Figueroa (ret.)
See page 38 for photos from the recent Legislative Welcome hosted by california Women Lead. +
CA
sTin
G C
ALL bonnie is looking for amatuer or
professional female models for an upcoming photoshoot.
Details: we are looking for identical twins between the ages of 20-55. To be considered, contact
bonnie editor Gayle Romasanta at 1.888.289.0521 or she can be reached via email at
24
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
California Women Lead is a nonpartisan, issue neutral association committed to encouraging and training women to be leaders in their
communities. For information on the nonprofit organization, visit www.cawomenlead.org.
THRee sPeAKeRscontinued from page 22
+
Assemblymember Joan Buchanan
fourth-largest retailer to help it introduce its store brands to the western states. Her extensive net-work of relationships with leaders in the business and labor com-munities, as well as federal, state, and local government, helps clients achieve their business and political objectives.Pye was deputy chief of staff
to california Governor Arnold Schwarzenegger and served on his historic post-recall election transi-tion team.Previously, she was vice president
of corporate affairs and political director for the california chamber of commerce, as well as the direc-tor of public affairs for the califor-nia retailers Association, director of governmental relations for the california Grocers Association and state relations manager for the Food Marketing Institute.
Karen Moore explains How to empower Your Voice through Public speaking
Karen Moore knows the benefit of taking risks. The media com-munications guru founded Moore consulting Group—now Moore communications Group—in 1992, on a “leap of faith” and entirely from the ground up. Today, her firm is one of the top-ranked media relations groups in the Southeast, recognized by o’Dwyers, Inc. 5000, and Florida Trend.her firm prides itself on connect-
ing with clients to create tailored plans of action in dealing with social media presence, campaign development, and crisis communi-cations.Moore began her career in
academia before deciding to open the firm, and has since spoken at various events including the White House Summit on Women entre-preneurs. She has also facilitated strategic planning sessions for more than 50 state and national organizations, and has conducted media training sessions for Fortune 500 companies, elected officials, and the British olympic Team.Perhaps the most striking element
of Moore’s approach is how she presents herself and her busi-ness—as a group of relatable, interested individuals who have a “world outside of Moore commu-nications Group” to operate better
within it. With Moore’s approach, public speaking ceases to be a daunting, exhausting process, and rather one that can be faced alongside consultants who are masters of their craft and are adept at handling any situation.
In a culture obsessed with quick quotes and sound bites, some-times the most intimidating part of diving into public service can be dealing with pressure that comes from the public spotlight.But with 350 awards for her firm
under her belt, Moore is a trusted expert in the media relations indus-try, and her workshop at Women empowerment Day will provide incredible insight to understand-ing communications for anyone interested in public service.
Assemblywoman Joan Buchanan—How empowered
Women Lead
Assemblymember Joan Bu-chanan, elected to the state assembly in November 2008, represents the 16th assembly. As chairwoman of the Assembly education committee, Buchanan brings a deep understanding of educational issues she gained dur-ing her 18 years of service on the San ramon valley School Board. education has been a lifelong prior-ity for Buchanan. She understands that for california’s economy to thrive in the future, we must invest in a strong public education sys-tem, including a focus on instill-
ing strong fundamentals in early grades. Since elected to the assembly,
Joan has focused on working with local leaders to solve problems. She authored a bill promoting pipeline safety and another helping local transit districts deter copper thieves from vandalizing public infrastruc-ture. Buchanan worked with Save Mt. Diablo on a bill creating a public private partnership to restore the beacon on top of Mt. Diablo.Buchanan has pursued a legislative
agenda focused on fiscal account-ability, technology, and innovation, and job creation. She has been a proponent of performance based budgeting, using data to drive decision-making, and the alloca-tion of resources. She has authored several bills to improve the develop-ment and acquisition of information technology by the State of california, recognizing that technology is critical to providing timely and cost-effec-tive services and information to the residents of california.Buchanan honed her financial
and analytical skills at Delta Dental, becoming one of the fastest ris-ing women in the company and director of commercial operations before the age of 30. She left the private sector to raise her five chil-
dren and in the process became one of San ramon valley’s most effective community activists.Her entrepreneurial approach
resulted in a number of commu-nity firsts. as vice president of the San ramon valley School Age child care Alliance she helped bring school age childcare to San ramon valley elementary schools and as PTa president at alamo el-ementary, Joan created a coalition that raised money to build a much needed outdoor theater. Buchanan is a 30-year resident
of Alamo, california and a native californian. She holds a B.A. in economics from the University of california, Santa Barbara.Buchanan will join us on the “em-
powered Women Leaders” panel along with other women leaders from the politics, business, and nonprofit community.
For more information or to purchase tickets, visit http://cawomenlead.org/womens-empowerment-day-2013/. Discount tickets are available until March 20, 2013. This event will sell out so purchase your tickets soon!
Photo C
redit: M
oore Com
munications G
roup
Karen MooreCassandra Walker Pye
25march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
27march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
travel
BY // ANNE ROSE
I’m dreaming of autumn. Sure, the calendar says spring, but to travel and travel well, you have to think ahead to get the most options, the best promotions, and the best rates.
This means planning six to twelve months ahead. It does you little good to hold out for a last-minute discounted airfare if the presidential suite at $7,000 per night is the only room left available. Hence, my clients and I are planning for autumn.
Before I get you thinking about autumn travel, I want to address the one question I am constantly asked—‘how much does it cost to go to XYZ?’ I’m not being coy to reply ‘that depends,’ because it does de-pend on numerous variables such as: what month are you traveling? How far in advance are you booking? Is the date near a holiday or a premium season for that destination? How many airlines and how many flights go to that destination? What resort are you considering and its proximity to the major tourist attractions? What room category are you consid-ering? What promotions are available? In all honesty, those variables
Fall into Vacation Plan your getaway early
The Big Island is an affordable vacation option for West coasters. PhOTO BY // shaWN CrarY
come into play, and a sharp
travel consultant will know how to manipulate those variables to maximize your budget dollars.
Basically, I can say unequivocally that no matter your budget, you can travel! Even when I’ve been unemployed, I have found a way to take my young daughter to Hawaii for some quality bonding time. No matter the destination, wholesalers are negotiating such great value-added goodies like air subsidies, free nights, daily break-fast, guaranteed room upgrades, welcome amenities, and wine tasting. Every day I receive scores of these just-launched promotions that I can use to get more value for my client’s dollar.
The biggest stumbling block is your own perceptions and
assumptions. One honeymoon couple came to me with a mod-est budget for a Hawaii honey-moon; they were hoping to be able to afford the barebones minimum: flight and a three-star property. If they hadn’t talked to me, they might have settled for just that. They were shocked when I said I would check out a five-star luxury resort for them that I knew was having an ag-gressive promotion. They were overjoyed when I was able to get them a complete package of this luxury resort, flight, and fun activities for their budget.
I just booked a luxury Ireland vacation for a family—six nights of the most opulent castle hotels, a private chauffeur for the entire week, breakfast daily, and several unique activities
continued on page 28
+You’re invited to join in a live Hawaiian adventure planned by Travel expert Anne rose with bonnie Publisher shawn Crary and Office Manager ernesto Gallardo April 2-9. They’ll be posting videos, photos, blogging live, and taking your questions and recom-mendations of places to visit while on the islands. visit www.readbonnie.com/publisher to join in!
Shawn crary and ernesto Gallardo will be island hoping next month and you’re invited to join the adventure online.
28
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
TRAVeLcontinued from page 27
for the budget land price of $1,699 each. Yet, when I mention Europe as a potential destina-tion, some people automatically assume it’s out of their reach.
Another couple came to me for a Hawaii honeymoon of two weeks, and I booked them at Hawaii’s top accommodations in the top room categories. They wanted to tack on a few days of a famous theme park in Florida and surprise, that week in Florida would have cost more than the two weeks of ultra luxury in Hawaii!
Don’t make the mistake of equating ‘cheap’ with ‘value’. Sometimes something cheap is worth exactly that. My position is that travel should be enjoyed, not suffered, so your goal and your travel agent’s goal should be to deliver the best value.
Now back to autumn—autumn is about harvest time, grapes, truffles, apples, pumpkins, and ripened produce. Autumn conjures up images of delicious meals and fine wines com-bined with perfect shirtsleeve weather, spa indulgences, and outdoor activities. This becomes a satiation of the senses and a revitalization of the spirit.
We’re extremely fortunate here in the Sacramento area to have so many varied wine regions and luxurious spas within easy reach. Of course Napa and Sonoma are one of the best known California wine regions, and within three hours of leav-ing Sacramento, you can be cozy, in front of a crackling fireplace at a luxury resort, wine glass in hand, or stripped to a plush bathrobe, heading for your ther-mal spa treatment. Revel in a full day of al fresco picnics, wine-sipping, touring the countryside and the vineyards (by private limo if you plan on doing lots of tasting!), and sampling artisanal cheeses and breads.
Whether your personality is geared to the luxury, five-star resorts with full amenities or a
quaint bed and breakfast with a chatty innkeeper, Napa and Sonoma have it all. It doesn’t hurt that some of the resorts are built upon thermal springs so when you hop into the Jacuzzi, all the stresses in your bones and muscles simply melt away.
You don’t even have to like wine to appreciate wine country! The ambience of the regions that are suitable for vineyards, are suitable for a myriad of out-doorsy activities, such as walking, bicycling, picnicking, window-shopping, strolling through little villages. Of course there are the ubiquitous spas.
One thing I really love to do—and I strongly recommend it to my clients visiting Napa and Sonoma—is to take a hot air balloon ride over the countryside. It’s spectacu-lar! At points, you’re barely skim-ming over the tops of the grape-vines, so close you could reach out and touch them. And then you’re higher up and sailing next to birds while they are gliding on the thermal air currents. It’s surprisingly quiet and definitely surreal, and I feel close to the heavens. Magical doesn’t begin to describe the sensations. Afterwards, you’re usually treated to the traditional celebratory champagne and perhaps an al fresco breakfast, depending on the provider. It’s an unforgettable morning.
Please don’t say you’re afraid of heights and couldn’t even consider hot air ballooning. I could give you all the safety stats but that kind of fear isn’t really about facts, just emotions. Don’t let your phobias get in the way of enjoying these one-of-a-kind experiences. And isn’t travel really about stepping outside your comfort zone to experience the new and different, so you get new perspectives and a recharg-ing of the senses?
Further up the coast, within a three to four hour easy, but scenic drive, from Sacramento is the rugged and craggy Men-docino coastline. The region has numerous wineries, luxury resorts, quaint inns, and bed and
Santa Maria della croce houses the remains of the world’s most celebrated artists and inventors.
Imagine riding a hot air balloon,
floating above the Napa countryside.
29march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
breakfasts, with fireplaces, spas, an array of restaurants (casual to gourmet), and of course, that dramatic coast with thundering waves and starry nights. Mendo-cino is a very artsy little village: artists, handcrafters, boutique stores, and delis. I love its main grocery store—unique foods, a huge olive bar, a wonderful home goods section, and an entire aisle of locally roasted coffee. Sorry, Hawaii, but I think Mendocino coffee is one of the world’s best. When I savor a cup of Mendocino coffee at home, I am transported to the Mendocino coastline and can almost smell the air and feel the salt spray. For autumn travelers, you’re also treated to a seasonal parade of the humpback whales as they swim south from Alaska en route to Hawaii or Los Cabos. Bring your binoculars if your
accommodations don’t already include a pair.
We really are blessed to have so many resources available here in California. But let me suggest an incredible destination further afield. It requires a plane ride, but there are numerous flight options from both Sacramento and San Francisco. I’m talking about the Big Island, Hawaii, culinary and wine mecca of the Pacific. Seriously, the Big Island attracts numerous James Beard-award winning chefs and is the birthplace of Pacific Rim cuisine. Exquisite wines paired with locally sourced foods are the ultimate farm-to-table gourmet dining experience presented at some of the Kohala Coast’s luxury resorts. Spectacular food, spectacular wine, spectacular resorts, with the most spec-tacular spas in the world, amid
spectacular vistas, and you have a…well…spectacular vacation. Definitely allow a week to fully ex-
perience all the Big Island has to offer—besides eating and drink-ing and spa-ing, there is amaz-ing hiking through rainforests. Not to mention an unparalleled diversity of landscape, and mi-croclimates and the starriest sky on our planet, active volcanoes, dormant volcanoes, black sand beaches, pink sand beaches, green sand beaches, a wealth of marine life, tropical gardens, and waterfalls twice as tall as Niagara. It is a feast for all the senses!
I would be remiss if I did not point out the joys of visiting Tuscany in the autumn (one-stop flights from SFO and sometimes about the same cost as visit-ing Hawaii!). Italy’s wines are the standard by which others are judged. The names alone—Brunello di Montalcino, Valpo-licella, Montepulciano, Super Tuscan—make you want to grab your passport and head out the door.
But Tuscany has so much more than wines to offer us. Birthplace of the Renaissance, Tuscany exudes art in every medium. Naturally, there are the world-renowned art galleries and churches (Uffizi and Ac-cademia museums, Santa Maria della Croce which houses the
remains of the world’s most cel-ebrated artists and inventors). But, beyond the art on the walls or in the piazze or the architec-ture itself, Italians are artistic in everything. Men and women are stylishly dressed—even the way they carelessly toss a scarf around their necks is elegant. If you buy an item in a store, Italian merchants don’t throw it in a plastic bag like here; they studiously wrap it in gorgeously designed Florentine paper as part of the gift. On numerous occasions, I have been reluctant to undo the wrappings because they’re simply too beautiful. Your meal isn’t slopped on a plate, but artfully arranged for maximum color harmony and presentation. Window displays of wine, cheese, or dolci (des-serts) make photographs worthy of framing for your home’s walls.
Imagine hot air ballooning over the Tuscan landscape of majestic cypress trees, vineyard-dotted hills, medieval walled villages, and whitewashed villas with red-tiled roofs.
Maybe you prefer to drive a Ferrari or Lamborghini through the Tuscan countryside, wine-tasting along the way. Not into speed and Italian cars? Then try horseback riding through Tuscany or the ancient art of falconry. In autumn, you can also go truffle-hunting with the experts. Or take little day-trips to the neighboring medieval villages and experience village life, frozen in time. Tuscany is the quintessential wine-based vacation. b
Mendocino Presbyterian Church overlooks incredible cliffs. PhOTO BY // NelsON MINar
“Mendocino is a very artsy little
village: artists, handcrafters, boutique stores, and delis.”
—Anne Rose // President Celebrate-Travel, Inc.
{ {
Anne Rose is President of Cameron Park, California based Celebrate-Travel, Inc., a passionate traveler and enthusiastic expert of custom-designed vacations to select regions. She welcomes your feedback and questions
and can be reached at: [email protected] and (530) 677.6454.
+
Adventure awaits! How about wine tasting through the Tuscan countryside sporting a shiny red Ferrari?
30
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
MondaysDowntown Public Art Walking Tour: Art is All Around Ussacramento Downtown PlazaAwalkingtourshowcasingSacra-mento’s beautiful public art where tourguidesexplainthewho,how,andwhybehindtheart.Learnabouttheartists and the history behind the creations.Cost: $10. (916) 442-8575 http://www.sacramento365.com/event/de-tail/441700847/Downtown_Public_Art_Walk-ing_Tour_Art_is_All_Around_Us
All MonthBest DressedRobert T. Matsui Gallery at City HallBest Dressed is an exhibition featuring memorable costumes from Sacramen-to’sleadingperformingartsgroups.Cost: Free. (916) 808-3992http://www.sacramento365.com/event/de-tail/441744501/Best_Dressed
2-3Resound: Music Worth Sharingst. John’s Lutheran ChurchVoxMusicapresentsaremarkableconcert of music rarely presented in aperformancesetting:thatofmusicfromtheEasternOrthodoxtradition.Cost: $15. (916) 471-0507http://www.sacramento365.com/event/de-tail/441726779/Resound_Music_Worth_Sharing
916 eveNTS
bonnie magazine has partnered with Sacramento365.comtohighlightupcomingeventsthatwethink
our bonniereaderswilllove.
{march}
2-389th Annual Camellia ShowMemorial AuditoriumThousandsofcamelliasaredisplayed,givingthepublicideasaboutwhichcamelliastheywouldliketoplantintheirgardens.Cost: Free. (916) 967-8420 http://www.sacramento365.com/event/detail/441741965/89th_Annual_Camellia_Show
4-510th Annual Empty Bowlssacramento Convention CenterEmptyBowlsisRiverCityFoodBank’ssignatureeventthatraisesfunds,friends,andawarenessfortheongoingfightagainsthungerinSacramentoCounty.TherewillbeaMondayeven-ingsoupsupperandTuesdayluncheon.Cost: $30-$60. (916) 446-2627http://www.sacramento365.com/event/detail/441743289/10th_Annual_Empty_Bowls
7Ana MouraThree stages at Folsom Lake CollegeThe32-year-oldsingerhasbecomealeadingexponentoffado—thepoetic,deeplyexpressiveidiomwhichper-sonifiesthePortuguesepsyche.Cost: $12-$39. 916) 608-6888http://www.sacramento365.com/event/de-tail/441670085/Ana_Moura
7-10Sacramento Jewish Film FestivalCrest TheatreThe2013SacramentoJewishFilmFes-tivalbringsfeaturefilmsfromaroundtheglobetotheCrestTheatre.FourcarefullychosenfilmsrepresentthediversityoftheJewishculture.Cost: $8.50-$40. (916) 346-6467http://www.sacramento365.com/event/de-tail/441744041/Sacramento_Jewish_Film_Festival
8International Women’s Day: Stop Violence Against Womensouthside ParkThiseventisamarchandrallytocelebrate women and call for a end to violencetowardwomen.Therewillbe tables from local women’s health agencies,familycounselingcenters,andLGBThealthandsafespacestogiveoutinformationabouttheirser-vicestoallwhoareinterested.Cost: Free. (916) 572-6675http://www.sacramento365.com/event/de-tail/441742857/International_Womens_Day_Stop_Violence_Against_Women_
8-9California Capital Vocal Jazz & Show Choir FestivalMemorial AuditoriumCalifornia’s best high school and middle schoolshowchoirsandvocaljazzensem-bles will compete at the 2013 California CapitalVocalJazz&ShowChoirFestival.Cost: TBD. (916) 808-7777
8-31Runaway Stage’s Avenue QBlack Box Theatre – West sacramentoMuppetsgonewild!Tony-winningmusicalAvenueQisthehilariousandheartfelt story of a bright-eyed college gradwhocomestoNewYorkwithbigdreamsandlittlemoney.Cost: $21-$25. (916) 207-1226http://www.sacramento365.com/event/de-tail/441726760/Avenue_Q
9Donut DashWilliam Land ParkRun,jog,orwalktwomilesthroughshadyLandParktoMarie’sDonuts,eat four donuts (or six donut holes or nothingatall)andthentwomilesback.Cost: $17-$25. (916) 802-9225 http://www.sacramento365.com/event/de-tail/441739574/Donut_Dash
9An Acoustic Evening with Los Lonely Boys with Special GuestsThree stages Performing Arts CenterMultipleGrammyAward-winningLosLobosbringtheirrock,TexMex,folkysoundtoFolsomforanacousticshowwillpullfromalltheirfinestwork.Cost: $30-$49. (916) 608-6888http://www.sacramento365.com/event/de-tail/441670527/Carrera_Productions_An_Acoustic_Evening_with_Los_Lonely_Boys_with_Special_Guests
9 44: A Perspective on Barack Obamaevolve the GalleryAnunrestrainedvisualartperspectiveonPresidentBarackObamafeaturingavariedmixofhistoryandemotionsetchedoutwithmultiplemediums.Cost: Freehttp://www.sacramento365.com/event/detail/441737999/44_A_Perspective_on_Barack_Obama
9Rock and Worship Roadshowsleep Train ArenaTheRockandWorshipRoadshowfeaturesperformancesbyMercyMe,JeremyCamp,Tedashii,andmanyothersandisalsodedi-catedtoabiggerpurpose:helpingkidswithjuvenilediabetesviaImagineACure.Cost: $10. (916) 928-0000http://www.sacramento365.com/event/de-tail/441743304/Rock_and_Worship_Roadshow
9Saturday Night at the Lakeside Room: Jeff Minnieweather QuartetRed Lion Woodlake Hotel & Conference CenterStepbackintimewhenfinediningandjazzquartetsweretheorderoftheday.Dinerswillenjoyawonderfulpre-fixemenubyChefRogerKane,alongwithjazzanddancingtothemusicoftheJeffMinnieweatherQuartet.Cost of food & drinks.(916) 922-2020http://www.sacramento365.com/event/de-tail/441742853/Saturday_Night_at_the_Lake-side_Room_Jeff_Minnieweather_Quartet
14Art Mix: It’s ComplicatedCrocker Art MuseumVisitorswillgeekoutonallthingsab-stract,algorithmic,andcreativelycomplexwithmusicbyMusicalCharis,achore-ography competition with local dance companies,acurator-ledtour,andmore.Cost: $10. (916) 808-7000http://www.sacramento365.com/event/de-tail/441739289/Art_MixIts_Complicated
As the year-round source for Sacramento events, Sacramento365.com features comprehensive listings of arts, cultural,
and recreational activities, allowing you to see and experience all Sacramento has to offer. Here’s what’s happening this month.
continued on page 32
31march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
4 GReAT DATes
6-17Broadway Sacramento:
Disney’s Beauty & the BeastCommunity Center Theater
The most beautiful love story ever toldisaBroadwaymusicalforallgenerations.Disney’s eye-popping spectacle is filledwith unforgettable characters, lavishsetsandcostumes,anddazzlingproduc-tionnumbers.Thisshowhasbecomeaninternational sensation that has played toover35millionpeopleworldwidein13countries.
Cost: $19-$86. (916) 557-1999http://www.sacramento365.com/event/de-
tail/441649345/Beauty_and_the_Beast
11St. Baldrick ’s Day
de Vere’s irish PubGo bald and be a hero for kids with cancer! These brave, compassion-ate souls raise money to support the effort and on this day crowds gather to witness them getting their heads shaved to show it! Whether you shave,volunteer, donate, or simply spread thewordandbetheretocheer,communitysupportisappreciated.
Cost: Free. (916) 784-6786http://www.sacramento365.com/event/de-
tail/441742306/St_Baldricks_Day_Go_Bald_for_Childhood_Cancer
21-23CORE Dance Collective:
Frayed EdgesBenvenuti Performing
Arts CenterThis show is a contemplative explora-tion of the numerous distractions that takeourfocusawayfromtheimportantrelationships in our life with those we care about. Also featured is After theStorm,anuplifting,dynamicpiececel-ebratingthefearlesshumanspirit,setto the music of the innovative artistsMumford&Sons.
Cost: $20-$25. (916) 491-1028http://www.sacramento365.com/event/de-
tail/441744516/Frayed_Edges
16St. Patrick’s Day Parade
& Festivalold sacramento
Hundredsofcolorfulmarchersdressedingreen,alongwithIrishandHighlanddancers,pipeanddrumbands,historicre-enactors and a variety of culturalorganizations, will all join together tobe a part of the 17th Annual St. Pat-rick’s Day Parade. The parade drawspeoplefromalloverNorthernCalifor-nia bringing together thousands in the 28-acrehistoricstatepark.
Cost: Free. (916) 442-8575http://www.sacramento365.com/event/
detail/441738048/17th_Annual_St_Patricks_Day_Parade
Photo C
redit: s
cott Beld
ing
32
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
14Downtown Beer Bustsacramento Downtown Plaza south MallAneveningoflocalfood,beer,artandmusic,proceedsfromthiseventwillbenefittheDowntownSacramentoFoundation(DSF)DowntownMuralProjectinTheKaydistrict.Cost: $35-$45 (916) 442-8575http://www.sacramento365.com/event/de-tail/441744964
15Pablo CruiseHarlow’sLegendaryPabloCruiseisamutli-platinumsellinggroup,withseveraltop20hits,including“LovewillFindaWay”and“What’chaGonnaDo.”Cost: $22.50. (916) 441-4693http://www.sacramento365.com/event/de-tail/441744119/Pablo_Cruise
15Girls Night OutWackford Community & Aquatic ComplexEnjoyamagicaleveningofgirlyfun.Putonyourpartyclothesandenjoyachocolatefountainbuffet,shopping,swag,crafts,andvendorexhibits.Cost: $10-$12. (916) 405-5600http://www.sacramento365.com/event/de-tail/441719303/Girls_Night_Out
15-16Sacramento Food Film FestivalGuild TheaterExpandyourknowledgeoffoodissueswith a series of documentaries and eventsattheSacramentoFoodFilmFestival.Cost: $7-$55. (916) 595-7822http://www.sacramento365.com/event/de-tail/441733550/Sacramento_Food_Film_Festival
16Run or DyeMcClellan AirbaseOthereventsmayfocusonrecord-ingthefastesttimeorbeingthefirstinyouragegrouptocrossthefinishline,butRunorDyeisallaboutbeingthemostcolorful,run-tastic,andfunevent.Cost: $40. (801) 256-6765http://www.sacramento365.com/event/de-tail/441730996/Run_or_Dye
16Poetry/Art/Jazz Live at the Centersacramento Fine Arts CenterMusiciansfromtheDaveBrubeckInstitutewillcomposemusicandprominent poets from the Sacramento PoetryCenterwillcomposeverseinspiredbySFAC’spopularAnimalHouseArtExhibit.Cost: $20. (916) 971-3713http://www.sacramento365.com/event/detail/441742098/PoetryArtJazz_Live_at_the_Arts_Center
16Lady Businesssacramento Comedy spotSacramento’sonlyall-femaleimprovtroupe uses true stories from the audience and cast members to create a long form improvshowwithsmarthumor,unex-pectedcharacters,andguaranteedlaughs.Cost: $8. (916) 444-3137http://www.sacramento365.com/event/de-tail/441740982/Lady_Business
20Creative Juices Sip & Paint: Lavender FieldsLa Provence RestaurantThisisafun,socialpaintingsessioninwhich you are guided through paint-ingthefeaturedartwork.Gearedto-wardtheartnovice,sonoexperienceneeded to create an amazing paint-ing—allwhileyousiponacocktail.Cost: $45. (916) 719-0934http://www.sacramento365.com/event/de-tail/441743069/Creative_Juices_Sip_and_Paint_La_Provence_Lavendar_Fields
21-23Quilt, Craft, and Sewing FestivalCal expoYoucanfindprettymuchanythingcreativeatthisspecialeventincludingsewing,quilting,needle-art,knitting,rubberstamping,embossing,scrapbooking,andfabricarts.Cost: $10. http://www.sacramento365.com/event/de-tail/441743516/Quilt_Craft_and_Sewing_Festival
21-24Sacramento Ballet: A Midsummer Night’s DreamCommunity Center TheaterImps,fairies,sprites,andallofthewoodlandfolkwilladdtothehilariouspandemonium in the classic comedy oflovegonehaywire.Cost: $17-$70. (916) 552-5800 x2http://www.sacramento365.com/event/detail/441622549/A_Midsummer_Nights_Dream_
916 eVenTscontinued from page 30
33march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
+For more info on other
Sacramento events visit www.Sacramento365.com or
simply scan this QR code with your smartphone.
22Leo KottkeCrest TheatreLeoKottkeisknownforafingerpick-ingstylethatdrawsoninfluencesfromblues,jazz,andfolkmusic,andforsyncopated,polyphonicmelodies.Cost: $25-$45. (916) 974-1357http://www.sacramento365.com/event/de-tail/441739271/Leo_Kottke
25Focus on Film: The 400 Blows and Antoine ColetteMondavi Center – Vanderhoef studio TheatreThisFocusonFilmserieseventfo-cusesontheworkofFrenchNewWavedirectorFrançoisTruffaut,screeninghis1959filmThe400Blowsandhis1962filmAntoineandCollette.Cost: $10. (530) 754-2787http://www.sacramento365.com/event/de-tail/441648145/Focus_on_Film_The_400_Blows_and_Antoine_Colette
27-May 5Master Harold… and The Boyssacramento Theatre CompanyTheplaytakesplaceinSouthAfricaduring the apartheid era and explores howbothloveandhatecaninfluenceourlivesdependentonwhatwearesurroundedby. Cost: $15-$46. (916) 443-6722http://www.sacramento365.com/event/de-tail/441669912/Master_Haroldand_the_Boys
30-31Spring EggstravaganzaFairytale TownThispopular,fun-filledfamilyweekendfeaturesegghunts,prizes,spring-themedhands-onactivities,andpictureswithPeterCottontail.Cost: $5. (916) 808-7462http://www.sacramento365.com/event/de-tail/441733380/Spring_Eggstravaganza
{april}3Wine Trivia NightRevolution WinesComebrushuponyourwineknowl-edge,enjoyvineyardtotablewines,farmtotableeats,andgreatcompanyalongwithsomehealthycompetition.Cost: Free. (916) 444-7711http://www.sacramento365.com/event/de-tail/441733664/Wine_Trivia_Night
6Fight for Air ClimbWells Fargo CenterByjoiningtheFightforAirClimb,youaremakingthecommitmenttofightlungdiseasesoeveryonecanbreatheeasier- including you!Cost: $25. (916) 585-7664http://www.sacramento365.com/event/de-tail/441742971/Fight_for_Air_Climb_2013
6Sacramento Beer & Chili FestivalFremont ParkEnjoyachilicookoffcompetition(in-dustryandindividual),unlimitedbeertastingsprovidebylocalbreweries,andlivemusic.Cost: $15-$40. (916) 716-2319http://www.sacramento365.com/event/detail/441726845/2nd_Annual_Sacramento_Beer_Chili_Festival
6Festa di Vinoscottish Rite CenterTherewillbemusic,dancing,auctions,and the area’s best wineries and res-taurantsreadytoimpress.Cost: $45. http://www.sacramento365.com/event/de-tail/441741529/Festa_di_Vino
34
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
spring is near, ladies! in spirit of the good ol’ groundhog who said we’d see spring early this year, we’ve gathered some beginning of spring must-haves to help keep you dry, stylish, and oh-so-fabulous all season long.
reta
il th
erap
y
{springflings}BY // CHERISE HENRY
Playful Bubble NecklaceTheinfamousbubblenecklace.I’msureyou’veseen
thisitemfloatingaroundonPinterestandotherblogsites.Inspiredbythecolorsoftheseason,it’s
theperfectplayfuladditiontoanybasicoutfit.
$13Charming Charlie
330 Palladio Pkwy Suite 2001 // Folsom (916) 817-8390
ergonomic Garden ToolsTheRadiusTrowelandHandForkgarden tools feature the newly patented ergonomicgrip.Thecomfortablecurveprovidesmoreleveragewithlesswriststress.Thealuminumbladeissurpris-inglylight,yetremarkablystrongforallyourgardeningneeds.
$10 eachGreen Acres8501 Jackson Rd (at the corner of Florin Perkins) // Sacramento(916) 381-1625
Floppy Straw HatThesunisshining…coverthatbeau-tifulfaceofyourswiththisversatile,
lightweightpaperstrawhat.Perfectforthecitystreets,backyardgarden-
ingoroutontheriver.
$35.99Whole Foods
4315 Arden Way // Sacramento(916) 488-2800
everyday comfy Gloves
Althoughabitwarmer,it’snotyetwarmenoughforjustbarehands…trythesecomfortablysoftandusefulglovesforthe
spring season! With holes for yourfingers,itkeepsyourhands
freeatalltimes.Takingphotos?Noproblem.Emailingfromyour
iPhone?Theseglovesgotchacovered.
$44Krazy Mary’s Fashion Boutique
3230 Folsom Blvd.Sacramento // (916) 442-6279
35march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
Spring-stylin’ rain BootsInneedofwaterproof,outdoorbootsforgardening,ormaybejustfortherainyseason?Thesestylishbootsof-fer durable rubber and insulation for optimalcomfort.Constructedwitheasypull-onhandlesandfunprints,youcanlookasgoodasyourfeetfeel.
$85Green Acres8501 Jackson Rd (at the corner of Florin Perkins) // Sacramento(916) 381-1625
{springflings}
Fun, Sequined BagThisspringseason,we’reseeingalotofsherbetcolorsofpaleblues,yellows,purples,andpinks.Foralittlebitofplayfulnesswhilekeepingithandy,optforastruc-
turedbagforallyourday-to-dayneeds.
$50Charming Charlie
330 Palladio Pkwy Suite 2001 // Folsom (916) 817-8390
Blooming Peach BlushLet’sbrightenupthosecheeksofyours!This
ripe,juicypeachy-keencoralshadewilltrans-form your complexion into your inner farm
girl—cheerful,glowing,andshiningwithhealth.Andthebestpart…SavageJennybeautyprod-
uctsareall-naturalandorganic.
$24.99Whole Foods
4315 Arden Way // Sacramento(916) 488-2800
Air SwimmersKidsfullofenergyandstuckindoorsduringthe
rainyseason?Nofear,Nemoishere.AirSwim-mersworkwellineventhesmallestofrooms
andhavecompleteup,down,and360degreeturningcontrol.SimplyfilltheAirSwimmerwith
heliuminexpensivelyatanypartyorgrocerystorethatcarriesballoons…itwillstayinflated
forweeksandyoucanfillitagainandagain.Re-motecontrolhasnevercometolifesomagically!
$29.99Fry’s Electronics
180 N Sunrise Ave //Sacramento(916) 517-1500
Think emerald Green for Spring!Emerald green is the color of 2013 according to thecolorexperts,Pantone,Inc.Twiceayearthecompany holds a secret meeting of repre-sentativesfromvariousnations’colorstandardsgroups.Aftertwodaysofdebateandpresenta-tions,thegroupchoosesacolorforthefollowingyear.Thechosencoloristhenannouncedtothe world through Pantone View,whichfashiondesigners,florists,andmanyothercompaniespurchasetoguidefuturedesignsandproducts.Expecttoseeemeraldgreenheavilythisspringandthroughouttheyear.
36
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
bonnie magazine {sacramento’s lifestyle magazine for women}
emily Bradford18 // High school student“I love this area. I don’t live here, but when I come visit my family who live in Folsom, I just love it. The shopping is great and the atmosphere is fun.”
We want to know what the ladies are lovin’ every month in our i Love… section. This month we’re stopping by Folsom to find out what women, and girls, LoVe about Folsom living.
{ilove...}BY // CHERISE HENRY
rose Wilson31 // sushi Chef + Mom
“Folsom has a lot of great food and tons of shopping and it’s easy and close to where we
live in Placerville.”
Sarah Hill27 // Bartender on sutter street “I used to live in Old Folsom, and could walk to work here on Sutter Street, and all the bars and shops anytime. Sutter Street is really popular for a lot of people from all over Sacramento. We’re a tight knit group here in Folsom and I love that.”
Lesley Storz39 // elementary school Teacher
“We love the parks, the trails, the outdoor setting, the athletics, and sports for my kids. We love the sense of community and how close knit we all are. And of course, I love the schools here—for my kids and for me as a teacher.”
Gracie and Natalie Storz 9 and 8 // Daughters and soccer Players
“We love the parks and to play soccer. Oh, and we love living next to the lake, it’s so much fun!”
Lily Wilson8 ½ // Daughter“I love shopping with my mom! And going to the Folsom Zoo—I’m going to be a veterinarian when I grow up and work with tigers!”
chantelle rogers20 // Restaurant employee
“Folsom is a lot bigger than where I’m from, so it’s nice to visit with all the shopping and
different things to do here.”
Bernedette Kelly44 // Physician
“I love the close knit and family friendly community we have here. Folsom has great, safe neighborhoods, and tons of opportunities for
kids’ activities.”
Abigail Kelly10 // Daughter and soccer Player
“I like the parks and schools. I love the people and have lots of friends here.”
37march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
37
{sacramento’s lifestyle magazine for women} bonnie magazine
ASK MISS KNoW IT ALL
Whenyourbffisunavailable,oryou’retooembarassedto
askmom,adviceisjustaclickaway!Submityouranonymousquestionsatwww.readbonnie.com/ask
Dear MKiA,I am new to the dating
game, fresh out of a four-year relationship with a man who I thought I was
going to marry. I now have to face reality—I’ve let my-self go. I’m about 40 pounds overweight and it’s affect-
ing my dating life. Help!
>>I’ve been there. I’m actually stillthere. What works for me, may notworkforyou,soIwilltellyouthis,geta skinny group of friends. Hang outwiththem.Eatwhattheyeat,workoutwith them, and drink your water, lotsofit.Skinnygirlsdothingsdifferentlythanus.WhenIwanttostayhomeandwatchBreakingBad(ohMahGawd,canJulygetherefastenough?),myskinnierfriendsarehiking.WhenIwanttosleepin,myfitnessfriendsarerunning—andwalking—5ks in their neighborhoods.WhenIwantranchdressing,theyareordering balsamic. When I circle theparking lot for closer parking space,theyarecontentwithparkingfarawayand trotting on in. These little thingsshow big results. I’m bitterly married,soI’mnotgoingtodothesethings,butyougogirl,andthenhollerback.
Dear MKiA,Thank you for writing this column, it really makes me laugh. I am in my twenties
and battling severe depres-sion. My doctor has offered antidepressants but I feel
like that is not going to solve the problem, only
mask it. I don’t want to be
on pills the rest of my life. Any advice?
>>First, thanks mama. I try tomake people laugh, but sometimes,it’s time to be all serious and shit.Like now. Guess what? I battle de-pression too. It’s true. I’m not al-ways this funny, witty, charming,extremely good-looking columnist.At times, I’ve been known to cryunder my covers while the familygathers in my house for dinner. It’strue. That happened, and that wasmycluetoaskforhelp.SoIdid.AndI felt the exact same way you did. Iwasscaredandanxious,whichwasalmost means for another prescrip-tion.Eventually, Igave itatry,andIbelieveitsavedme,mymarriage,andperhapsmylife.
The trick is getting a pill thatworkswithyourbody.First,Itriedsome weird pill and it just mademesleep.Then,theyputmeonan-otherone,andafterafewweeks,itactuallystartedtowork.Iwasfeel-ing better. From there, we workedon the dosage. And then, for thenextfiveyears,Iwasonantidepres-sants,andIwashappy.Theydidnotmask my feelings or make me feellike a zombie. They simply liftedthat heavy veil and allowed me tohave the energy to talk about myissues with a certified therapist,my family,and friends.Aftera fewyears,IfiguredoutthatIneededtodo what I love in order to have alife I love.Once Ididthat, Igotoffmypillsandtoday,I’mok.Istillgetbluesometimes,butI’mnolongerdebilitated.
Talk to your doctor, because I amno doc or therapist. But get helplady,becausethereisanAWESOMElife out there waiting for you to findit.
Dear MKiA,My mother-in-law is a nice continued on page 44
woman, and she watches the kids a lot and helps
out a lot, but I don’t want her in my daily life. My husband disagrees and
said we should be thank-ful for her help. He thinks that since she helps us, we shouldn’t restrict the time
that she spends with us. He has a great relation-
ship with her and loves to spend time with her. I just
want my space.
>>Ahhh, you poor thing. So youhave a nice MIL and she watchesyour kids and helps out a lot, andshe’s great, but not every day. Areyou crazy? You have the best ofboth worlds—a nice MIL and hap-py husband. Don’t give her toomany rules, unless she’s crazyandsnoopingandbeatingthekids(hard). Isuggestyouapproachthisdifferently.Tellyourhubbythatyoulove the time she spends with thefamily,butmaybeonedayperweek-endcanbefamilydaysonly.Iwouldtellyoutoaskforadatenight,butI bet your perfect MIL would jumpfor another occasion to watch her sweet grandkids. You need to chillout mama. Chances are, you’re go-ing to outlive her, and unless youwant your hubby to resent you the rest of his life, you need to lay offabit.
Dear MKiA,I recently had a dear
friend pass away after a long battle with cancer. She was an incredibly
strong woman who spoke her mind and gave her
opinion without remorse. It taught me a valuable life lesson to not candy coat your opinion. I wonder, if God forbid you were stricken with a terminal
illness, what would you want Bonnie readers to take from your column?
>>First of all, I am very sorry foryour loss. This world needs morepeople like her—to speak theirminds,giveopinions,andstandupfortheirbeliefs.Doyouknowwhy?Because honesty is appreciated in authenticrelationships,liketheoneshehadwithyou.Iamcertainthatifyouaskedyourfriend—“Doesmybutt look fat in these jeans?”—shewould tell you, “Yeah, now go getthat other outfit on and let’s rock&roll!”
Yourquestionhitssortofclosetohome. I don’t have a terminal ill-ness,butIknowpeoplewhodo.IfIwerestrickenwithaterminalill-ness, I would first tell it to take ahike. Next, I guess I would like myreaders to know that it’s ok to behonest,withoutbeinghurtful.Andbeing honest with those who are in your life is sacred. You don’t haveto candy coat anything if you’re speakingfromyourheart,andyourtruefriendswillappreciatethat.Butthere is a time and place to speakyour mind. I would never give myopinionwhenit’snotasked.Iknowwhentoshutup.Thepointis,ifyouask me, I’m telling you the honesttruth.Ifyoucan’thandlethat,thendon’task.NowexcusemewhileIgohaveabottleofwine.
Dear MKiA,I’m a mother of three
teenagers. Recently, my oldest, 16, was fired from his first job for shoplifting. I am angry, embarrassed,
and humiliated. He says he knows he was wrong and it won’t happen again. He
promises us that he has learned from it. But I can’t
get over the feeling of disappointment. What do I do?
>>RUN! Just kidding. I think thathe’sanormal16-year-old.Firstofall,
38
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
snap shotsPHOTOS BY // DEBORAH GOLDSTEIN PHOTOGRAPHY
OnJanuary30,2013,CaliforniaWomenLeadhosted its annual LegislativeWelcomeatSacramento’sParkUltraLounge.Over250guestsenjoyedawonderfulSac-ramentoeveningasCaliforniaWomenLeadhonoredthe2013LegislativeWomen’sCaucus.Guestsnetworkedwithstatelegislators,includingmanywhowererecentlyelected,aswellasleaders from Sacramento busi-ness,political,andnonprofitcommunity.ThisisCaliforniaWomenLead’spremiereventtoraise funds for our leadership and appointments trainings around the state and would not be a success without the support of our members and sponsors.MarkyourcalendarsforJanuary2014soyoucanattendnextyear’sevent!Formore information on upcoming CaliforniaWomenLeadeventsvisitwww.cawomenlead.org.
Assemblymember Jimmy Gomez; Kara Cross, state Farm; Kelly shaw, PIFC; hanna Basler, state Farm; Bob Smith, State Farm.
When//January 30, 2013
Where//Park Ultra Lounge 1116 15th Street Sacramento
What//2013 Legislative Women’s Caucus
Who//California Women Lead
heidi Barsuglia, sempra Utilities; senator Marty Block; Tamara rasberry, Sempra Utilities.
Senator ellen corbett & Senator Liz Figueroa (ret.).
Jessica Mapes-Yoas, california Women lead; samantha harrod, California Women Lead.
Commissioner lauren hammond, California Gambling Commission; Trus-tee Teri Burns, Natomas Usd; John Garcia, Kaiser Permanente; Kimberly L. Quinones, california Women Lead.
39march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
dana Garel, lilly; Kirk Kleinschmidt, Kaiser Permanente; Kit Wall, Kit Wall Productions.
erin sullivan, Capitol Network; Jelisaveta Gavric, Capitol Network; erin Clark, capitol Strategies Group.
Jaime Huff, Southern california edison; Tamara rasberry, sempra Utilities.
senator Marty Block; senator Mark leno; assemblywoman Bonnie lowenthal; candidate Fiona Ma, State Board of equalization.
executive director/CeO rachel Michelin, California Women lead; assemblymember reggie Jones-sawyer; Barbara a. Ortega, POW Group.
california Women Lead State Board of Directors Senator Liz Figueroa (ret.); Trustee Teri Burns, Natomas Usd; regent Charlene Zettel, University of california.
Jim Willett, The doctors Company; commissioner Lauren Hammond, california Gambling commission
Sacramento’SLeading Print PartnerBut don’t just take our word for it, look at the magazine you’re reading now! DOME Printing is proud to partner with Bonnie Magazine to bring you the finest publication possible.
800.343.3139 | domePrinting.com
High-Quality Printing
Customer Service with a Personal Touch
Printer of this Issue of Bonnie Magazine
41march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
Sacramento’SLeading Print PartnerBut don’t just take our word for it, look at the magazine you’re reading now! DOME Printing is proud to partner with Bonnie Magazine to bring you the finest publication possible.
800.343.3139 | domePrinting.com
High-Quality Printing
Customer Service with a Personal Touch
Printer of this Issue of Bonnie Magazine
FABUNIverSITY
Haveyoueverbeenoverwhelmedwiththesheernumberof optionswhenitcomestomakeupbrushes?ChristiReynolds
explainsthenecessarytoolsforaflawlessmakeupapplication.
it’strueladies,whenit comes to apply-ingmakeup,itre-ally is all about the
brushes.Ialwaysaskmyclients,”youwouldn’tpaint your house with yourfingers,wouldyou?”Althoughtheyaremostlikelytheheftiestin-vestmentyouwillmaketowardyourmakeupcollection,greatbrushesare for sure the most important.But,withtheright choices and proper care,theywilllastyoufor years!
The best textures to look for:
Anyofthebrushesyouuseforblending,suchasshadows,blushes,powders,etc.,shouldbemadeofnaturalhairforbestresults,andyearsofgooduse.(Don’tworry—thehairforthebrushesIrecommendarehumanelyacquired!)Goforponyorgoat blends for the best eye shadow application.Whilesablebrushessoundluxurious,Ifindthattheyareactuallytoosofttodepositverymuchpigment.
Forcreamoraqueousbasedproductslikeprimers,concealersandfoun-dations,syntheticblendsarebest!Choosesoftflatshapesthatwillblendconcealerandothercreamssmoothly.
BrushUponyour MakeupBrushKnowledge!
BY // CHRISTI REYNOLDS
The top multi-tasking ‘shapes’ you will need for a great collection:Eyes-
AbasicblendingbrushliketheMAC#224brushisastapleinmykit.Whiledesignedfortheeyes,Iuseitnotonlyforbuffingshimmeronthelidandshadowthroughthecrease,butalsoforhighlightingcheekbones,andthecupid’sbowoftheupperlip.
AnotherMACclassicisthe#219, or pencil brush for getting that perfect smokyeyeorsmudgyliner.Thisbrushisperfectfordetailingalleyemakeup,andotherfacialfeatures.
Face-NamedafterthetraditionalmakeupbrushtechniqueoftheJapanese
geishas,thesoftandcompact‘kabuki’stylebrushlikethisonebyBdelliumisamazingforbuffinginpowdersandblushes.Itisalsoagreatchoiceforbody bronzing and adding shimmer to decolletage and collarbones!
Andyoudon’thavetobreakthebankwhenchoosingbrushesforconceal-erandfoundation,oreveneyelinerandlipstick.IstockupontheseRoyalandLangnickelstylesfrommylocalcraftstoreforjustafewdollarsapiece.You’llbeamazedatthestylesanddesignsofartandpaintbrushesthatarefantasticforyourmakeup,atafractionofthedepartmentstore’sprice.
Brush care-Skipthepretty(andexpensive)brushcleanserstheysellby
thebottleatthemakeupcounter.Thesearereallydesignedformakeupartistsforquickcleaningbetweenclients,notathoroughcleanse.Instead,dustyourbrushoffonatis-sueortowelbetweencolors,andoptforhairshampooorevenliquiddishsoaptogently,yetdeeplycleanyourbrushes.Sudsthemupatleastonceamonth,orasneededforthebrushesyouusemostoften.Laythemflattodryonatowelovernight,andtheywillbereadytousebymorning.Displaythosebeautifulbabiesinaprettycontainerwhereveryouliketoputyourmakeupon!
MeeT ouR MAKeuP MAVen Christi Reynolds is a beauty, bridal, and commercial makeup artist for the Sacramento and Bay Areas. For Christi’s complete bio and portfolio, please visit her website at www.sacramentomakeupartist.com.
+
42
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
pop
cul
ture
More than 40 million people are consist-ently looking for love online.
With this many hopeless romantics turning to the Internet to pursue relationships, there are bound to be some manipulative scam artists out there just waiting for the right opportunity.
“Catfish” – other than the obvious definition – is a person who pretends to be someone they’re not using Facebook, social media, or other online tools to cre-ate false identities, particularly to purposely pursue deceptive online romantic relationships, as defined by Urban Dictionary.
You may have heard this term quite a bit lately.
Most recently involving a Notre Dame football player, Manti Te’o, who is under speculation of playing a role – victim or otherwise—in a romance turned false identity turned deceitful tragedy.
Catfish is also the name of a 2010 documentary involving a young man pursuing a romantic relationship with a woman online, transforming into a story of love and online scheming. Fast forward a few years and
Ladies, don’t get caught in a net of deceptive online romance
BY // CHERISE HENRY
continued on page 44
43march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
We’ve gathered some tips on how to avoid being caught in the deceptive net of a catfish to help you and friends beware of these types of situations.
>>ImageUse Google “search by image” feature to check for multiple Facebook profiles with the same image. Catfish use other people’s images as their own when creating their fake identity.
>>FriendsIf a person’s profile has fewer than 100 friends or if there are photos of the person with other people who are not tagged, be cautious. These may be pictures taken off an innocent person’s profile.
>>Traumatic Accident or IllnessCar accidents, deaths in the family, and chronic illness is extremely common in catfish scams because the best way to avoid meeting up is by having some type of traumatic experience.
>>No Webcam, Skype or FacetimeIf a person avoids any type of face-to-face interaction, in person or over the internet/phone, then this is an early potential warning sign that they are trying to avoid you seeing who they really are.
>>Trust Your GutSometimes, it’s as simple as trusting your gut and not necessarily following your heart. If you think something fishy is going on, it might just be a little you inside waving a big red flag.
44
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
today we have a docudrama on MTV called Catfish: the TV show, following people with similar deceptive fates.
Clearly this is something reoccurring in our society that should continue to be ad-dressed with the hope of preventing future incidents.
You may be thinking, what kind of person would ever fall for someone they’ve never met in person? Well, love is a powerful thing—blinding perhaps. And it’s probably something you think would never happen to you.
Take 27-year-old Sacramento native, Adam*, for example. Adam met a woman online in 2007, let’s call her Sarah* (*we are not using real names to preserve identities, as requested). Adam and Sarah talked every day on the Internet and on the phone. He lived in Sacramento and she lived in Los Angeles. They planned to meet up numerous times throughout their six months of “dating,” but something would always come up preventing them to finally meet face-to-face.
One day, Sarah’s “brother” called Adam to tell him that she had been in a terrible accident and had passed away. And that was that… he never heard from anyone again.
Adam says it took him a while to step back and see the situation clearly. Hindsight is 20/20, after all. “I ran through every conversa-tion we had over and over in my head. My frustration grew and I finally began to see what had happened,” he said. “To this day, only a few of my friends know what really happened. It’s just too embarrassing to talk about.”
Although online dating is a great way to meet people, it’s impor-tant to keep an eye out for red flags that could potentially lead to a catfish at the end of the line…online. b
CATFisHcontinued from page 44
hegotajob,whichathisageispracticallyunheardof.Hehasambitionandheiswillingtowork,butremember,heisstillachild.Childrenmakemis-takes.Theyaresupposedto.Theyareimmatureandtheymessupandtheylearnfromit,sothattheydon’trepeatitintheirfutureliveswhenthiscouldnegativelyaffecthiminwayshewouldneverunderstandatthispointintime.Trytotalktohim.Tellhimthatyoubelieveinhimandyoutrusthimtodotherightthinginthefuture.Tellhimthatyouknowhe’slearnedfromthis,andthen,encouragehimtogetanotherjob.Oncehe’sworkingagain,checkinwithhimfromtimetotime,hejustmightendupsurprisingyou(notwithsomethinghestole,butbymaturingabit).
Dear MKiA,It seems like every week, we hear about another
school shooting. I know statistically speaking, the odds of it happening to our daughter’s school are slim to
none, but I can’t help thinking that I should consider ho-meschooling my kids. What are your thoughts on this?
>>I am going to get so much hate mail for this. But, you asked, and so I’ll tell you what I think. Inmypersonalopinion,unlessyou’reaneducated,accredited,experiencedteacher,professor,oreducator,youhavenobusinesshomeschoolingyourchild.([email protected]).
Protecting our children is natural. I went through a phase when mydaughterwasyounger.Shewasputinthebestprivateschools,andnowshe attends public school. I have had good and bad experiences at both.Buthavingseenthegoodandbadoftheprivateandpublicsector,Ibelievethatthereisabetterwaytoeducateouryouthwhereyoumixitupabit—a little private schooling, a little public schooling, and a lot of parentalinvolvement.
Afriendofminechoseto“homeschool”herchildrenthroughherlocalschooldistrict.Thisdidn’tmeanthatshesatherkidsdownandpulledanassignmentfromthinaireveryday.Onthewebsite,itstates“Thechild’seducationisbasedonacooperativemodelknownastheAcademicPyra-mid.Thestudent,theparent-teacher,andacredentialededucationalcon-sultant work together to meet the individualized needs of the student.”The children attended class once a week, and study sessions whenevertheyneededthem,inagroupofother“homeschooled”children.Theyweresupported by the daily work of the parent-teacher, bi-monthly meetingswithaprofessionalteacher,andsocially,theyseeotherkidsjustlikethemonaregularbasis.Theyalsoparticipatedinsports,music,andotherac-tivitiesthatmyfriendpaidfor.Itsoundslikeaperfectsystemtome.Andifyourchildorchildrenwouldbenefitfromthat—maybeyoushouldlookinto it. Both of her children are in college now and they are extremelysmartandoutgoingindividuals.
But this is not the life for everyone. For instance, my daughter and Iwouldneversurvivedailyacademic lessonsathome.Firstofall, Ican’tevendothealgebrathatshehasnow.HowcanIteachhersomethingIcan’tevendo?Next,wearebothairheads.Yougetushomealone,andnoworkgetsdone—weendupatthemall.PeoplelikeherandIneedanen-vironmentwithlotsofpeople,lotsofactivity,andastructuredschedule.Then,weneedhamsterwheelstoruninattheendoftheday.So,publicschoolingisperfectforherrightnow.
Look,Iknowthatguncontrolisahotissuethesedays.But,weshouldn’tshieldourchildrenfroma“mighthappen”scenario.Ifwealldidthat,noonewoulddrivethemincars,allowthemtowalkhome,sendthemtothestore,oreatfastfood.Researchyouroptionsandchoosewhatfeelsrightforyourchild.
Miss KnoW iT ALLcontinued from page 37
45march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
When times get rough, keep pushing“It’s a hard business [development]. It’s not for everyone. But I’m very
committed to what I do,” says Kang. Sometimes, she says, these projects are overwhelming with such mammoth hurdles and constant changing of direction. “Sure, sometimes we feel as if we were ready to throw in the towel. It’s like they’re pulling the rug out from underneath us to see if we would survive. And we have… every time.”
Kang says she has absolutely no regrets. She pushes the boundaries to get things to happen and, at the end of the day, she knows that she can get things done that few can. “I’m [a] glutton for punishment. If someone says I can’t do it, I need to prove them wrong.” When you accomplish your goal after all [the] trials and tribulations there’s really something to be learned from your experience,” she says.
Kang believes that women have incredible inner strength. “especially when tied with a moral code that you believe that what you do is not only right, but good for you and good for others,” she says. “Maybe right now only I see that, but I know I can get others to see it too and believe some-thing positive can happen.”
She says if you make mistakes, keep going and just keep trying. “There are always going to be nay-sayers and only one person who says you can do this. And usually, that’s just you,” she laughs. “It’s about just going for it.”
It’s all about the communitiesKang’s most recent project in vallejo involves the restoration and
development of the old Masonic Temple building in the downtown area. “Women were not even allowed into the building back in the day. When I was walking the floors, I thought about that,” she says. “how interesting that you fast forward hundreds of years and it takes a woman to save the building and help restore the community.”
Kang has redeveloped the building to include 29 apartments and lofts that will be designated to artists to house a creative atmosphere with talented artists. The project is set to finish in the spring. “I grew up prac-ticing art and playing music that inspired me. I think it’ll inspire other kids who can find an outlet and help inspire them to get the confidence they need to succeed in life.”
She says her work is about injecting life into these communities with creative opportunities for young people, and elderly, who take pride in ownership and to feel secured and respected. “It doesn’t stop at the end of our project. The residents take their new found confidence and then spread it out into the community for years to come,” she says. “It feels so great to finally get to the end after all the struggles and take a step back
and watch these new communities blossom.” b
MeeA KAnGcontinued from page 21
For more information about Meea Kang and Domus Development’s current and past projects visit www.domusd.com.
+
Meea and Alana Kang in the La valentina courtyard.
46
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
6Weeks
24Weeks
30 Weeks
Workout:Noexerciseperdoctor’sorders
After 18Weeks Weight:162lbs
Waist:36.5”
Thigh:24”
Chest:39.25”
12Weeks
StayingFocusedUsingStrategyandHelpfulMobileAppslif
e tr
ansf
orm
atio
n
BY // GAYLE ROMASANTA
Afterblackingoutforafewseconds last month during circuit class,mydoctororderedmenottoexercise until after seeing a cardi-ologistandneurologist.I’veseenbothandbothhaveorderedmanytestsforthenexttwomonths.AllmydoctorsthinkI’mfine,buttheywanttomakesurenothingisamiss,beforeIgetbacktoexercising.
SoIfocusedoneatingcleanforweeks13to18.Iputallmyenergyinto reading about nutrition and findingouthowtomakefoodmyallyinpreventativehealth.IalsowrotedowneverythingIateusingwww.mynetdiary.com.Thiswebsiteandmobileappisamazing.It’sfreeforabasicversion,andhashelpedkeepmeontracktomeetmygoal—losing40poundsbyJuly.AftertypinginhowmanypoundsIwanttoloseinhowmanymonths,itreportsifI’monscheduleornot,everydayandweekly.BasedonthefoodsIenterforeverymeal,itanalyzesdailyifI’veeatenmyrecommended amount of fruits and vegetables,water,fiber,saturatedfat,andcholesterolintake.ItgivesmekudosforwhatI’mdoingrightandrecommendationsonwhatI’m
doingwrong.Forinstance,IforgottoeatbreakfastonmorethanoneoccasionanditgavemetheanalysisthatIneededtoeatahighfiberbreakfast,soIdon’toverindulgelaterintheday.Thefoodchoicesalsoseemtobeendless.WheneverItypeinthefoodI’veeaten,it’sbeeninthedatabase,withthecaloriecount.Itcan’tbebeat,especiallyifit’sfree.Iupgradedfor$3.99,soIcouldhavea more in-depth analysis of what I’meatingandmoretipsonhowtomakemyeatinghabitsbetter.Thisisrelativelycheapwithwhatyouget.Tome,it’smoreusefulthanWeightWatchers online and mobile tools I’veusedinyearspast.It’sdefinitelyalotcheaper.AlthoughI’msureWeight Watchers is great for those whomakeitworkforthem.Forme,sinceIcan’tbecountedontomakeittomeetings,thisappfitsme muchbetter.
My analysis so far has been positive,butwithouttheexercise,I’mbehindinlosingweight.Ilostfourpoundsforthissix-weekperiod.Whichisnormalandhealthy.However,IwashopingtolosemoreifIwasabletoexercise.However,I’mupbeataboutit—almostonepoundaweekisahealthywaytoloseweight.It’salsosometimesa
ingforCarnivores.Sheraisedherfamilyonavegetariandiet.She’snothardcoreoroverlypreachyabouthowshe’savegetarian.Sheactu-ally told me she eats meat if she’s a visitoratsomeone’shome.“Idon’ttrytoconvertanyone.It’sapersonalchoice.Thepointofmyshowistohelppeoplestayontrack,”Antoninisaid.Whichiswhyshecreatedherchannelandwebsite—thereareveg-etarians out there who want to eat meat.Whatshouldtheyeattosatiatetheircravings,butstilleatwithouttherealstuff?
goodstrategytojustfocusoneat-ingcleanfirst,beforebringinginexercise.I’mgivingmyselfapatontheback.I’vegonedownasizeinclothing.Yay!
InmylastarticleIinterviewedDr.SheriPruittfromKaiserPermanente,abehavioralscientistspecializinginweightloss.Shetoldmestatisticsshow successful weight loss includes foodjournaling.Thisperiod,IvisitedBonnieAntonini,alocalblogger,fromCarmichael.Avegetarianforoverfifteenyears,shealsohasaYoutubechannelcalled,VegetarianCook-
Baseline StatisticsWeight:178.6lbs.//Waist:41¾”
Thigh:25½”//Chest:43½”
The key to adding mock meat to your diet is finding the ones that work for your recipe and your taste buds.
18Weeks
47march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
Antoniniwasgraciouswhenwemet.Sheletusintoherbeautifulhomeand showed me (with my toddler in tow)howtomakeavegetarianmealthatmyfamilywouldlove.Shemadesmoothiesoutofhomemadeyogurt,berries,andbananas,whichwasahitwithmyson.Shealsoshowedmehowtomakenomeatcorndogs.Iwasalittlebitskepticalaboutthecorndogs.I’mnotafanoffakehotdogs.Butaftershemadethem,I’mabeliever.Itturnsout,Iwasbuyingthewronghotdogbrand.“Youneedtofindthemeatsthatworkforyouandforthedishyou’remaking,”shetoldme.Shetoldmethatsheusesdifferentkindsoffakemeatfordifferentdishes.Forinstance,shelovesMorningstarfakebeefcrumblesforspaghetti,andtheWorthingtonLomaLindaLinkettsinacanforhercorndogs.Shealsogavemeahelpfultiponwheretofindmyfakemeatsatareasonableprice.SheusuallygoestotheSeventhDayAdventistBookCenter,locatedat5207MadisonAvenue,wheretheyalwayshavebulkspecials.
Afterweateheryummyfood(and after my son surprisingly ate a wholecorndog—he’ssopicky),wewenttothecenter.Lowandbehold,there was more than one aisle devotedtovegetarian“meat,”muchcheaperthanwhatIcouldfindataWholeFoodsMarketoranothergro-cerystore.TherewerebrandsIhadneverseen,includingtheLinkettsinacanthatAntoniniusedinhercorndogrecipe.Somewillarguethatfake,processed,vegetarianmeatislikemethadonefordrugusers.It’snotashealthyasjusteatingvegetableswithouttheprocessedfood.Well,Ifindithelpfulinmydiet.I’mstilltryingtofigureouthowtonavigate
insTAnT GRATiFiCATion
My before and after a series of three chemi-cal peels and hydrating enzyme treatments by Kellie Lynn esthetics at Byuti Salon.
i’m done with my series of three chemical peels and my last hydrating Cranberry sugar Cane enzyme Treatment with Kellie Lynn esthetics at Byuti salon. i was a facial “virgin” before i worked with Kellie. Do i think it works and ulti-mately contributes to my radiant transformation for the new Year? Definitely yes—just look at my before and after photos. However, a caveat, i found a knowledgeable esthetician who used quality prod-ucts. if you are going to do a peel and facials, make sure you’ve researched your esthetician. Also, you should have basic knowledge of your skin and your body. is your skin type more prone to have adverse affects to peels, like increased hyperpigmentation? Are you al-lergic to dairy? if so, you shouldn’t do a lactic acid peel. An experienced esthetician will know the answers to these questions and more to help guide your skin trans-formation. Make sure you find that person, otherwise, there is potential for an inexperienced esthetician to do damage to your skin that could take awhile to stabi-lize or worse, lead to permanent scarring.
PH
OT
OS
BY
//EM
ILIE B
OU
RD
AG
ES
PH
OT
OG
RA
PH
Y
throughmynewlifeasavegetarian.I’musingvegetarianmeatsaspartofmystrategytokeepmemindfulofmygoalandtokeepmefrombingingonKFConabadday.Formorereci-pes,youcanfindAntoniniathttp://vegetariancookingforcarnivores.wordpress.com.
Thismonthdefinitelycouldhavebeenbetter.ButIgivemyselfkudosforlosingfourpounds,trackingeverythingIate,everyday,andbe-
inghonestaboutit.Ialsokeptupmyvegetarianpledge.Goingintomyfifthmonth,beinghealthyissomethingIneverthoughtIcoulddo.What’smystrategyfornextmonth?I’mdoinga“21-dayadven-turecleanse”basedoffofcancersurvivor’sKrisCarr’sbook,CrazySexyDiet.Thedietisnamedafterher documentary Crazy Sexy Cancer (youcanwatchitonNetflixoriTunes),whereshecapturesherlife
afterherinoperablestageIVcancerdiagnosis.FeaturedonOprahandherdocumentaryshownonTLC(TheLearningChannel),shetechni-callystillhascancer,butitisstable.andnolongerprogressing.Sheisveganandbelievesinjuicing.I’mnotsureifIhaveitinmetobecomevegan,but,Iwilltrythe21-daycleanse.Staytunedfornextmonth’s
issue! b
Before
After
Bonnie Antonini making me and my son, Jude, a family friendly lunch of vegetarian corn dogs and yogurt, banana, berry smoothies.
48
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
{reviewed}BY // SOMMER HAYES
it’s Women’s History Month and bonnie is celebrating
by creating a list of must-have women’s books. This is a short list out of the many in-
spirational books that would broaden anyone’s knowledge
about the women’s move-ment and how women have shaped the political, histori-
cal, and artistic landscape of the united states. if you
didn’t read any of these books while in high school or college, then pick one or all of them to read this month
and beyond. every month at bonnie is a reason to
celebrate women’s history. Reading books is a way to celebrate our history. it is also a good reminder that while we’ve come a long way since not being able
to vote, there is also much inspiration to gain to push
ourselves even further.
our Bodies ourselves By The Boston Women’s Health
Book CollectiveBirthed from the Feminist movement,
this book offers insight about women and their bodies and their personal accounts on life. This compilation covers topics rang-ing from abortion (both for and against) to postpartum depression. Originally written for students as a manual of women’s issues, this book is much more than a textbook but a definite “go to” book of topics that will benefit all women. It is also a wonderful reference book for illnesses, diseases, and holistic and medically proven treatments.
Available at: Barnes & Noble Arden Fair
1725 Arden WaySacramento, CA 95815
(916) 565-0644
The Women’s room By Marie French
This bestselling novel originally published in 1977, voiced the controversial feelings of women who gave up their careers and education to marry and start families in the 1950s. This novel explores the mind set of women and their inner most feelings and fol-lows the characters through to the 1970s. A few were happy, while others were painfully distraught, and mentally unstable because of this decision to stay at home and raise their families. Many took the opportunity to go back to school during the Women’s Lib-eration movement and found freedom and fought for equality among the sexes.
Available at: www.Amazon.com
49march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
49march >> 2013
{sacramento’s lifestyle magazine for women} bonnie magazine
When everything changed: The Amazing Journey of American Women from
1960 to Present By Gail Collins
Collins presents a resilient timeline of the evolution on women beginning with the 1960s to the 2008 presidential election. This comprehensive narrative is a blend of women in history with a vibrant twist. The author revisits the time when most women stayed home and took on the roll as “house wife,” asking their husbands permission to open a new credit card. This compilation covers five decades of history of women in America and celebrates the vast changes that have been made over the years.
Available at: Barnes & Noble Arden Fair
1725 Arden WaySacramento, CA 95815
(916) 565-0644
Big Girls Don’t cry: The election That
changed everything for American Women
By Rebecca TraisterThis book brings attention to the 2008
presidential election and how it gave femi-nism an exciting new life. It also shows how the campaign for presidency opened up dialogue about gender, race, and generational difference. In the last few years, Michelle Obama became the first African American woman to become the First Lady of the United States and more women are becom-ing involved in politics and government activities. Traister discovers how American women and public figures like Michelle Obama, Hillary Clinton, Sarah Palin, and Ga-brielle Gifford and others are beginning to shape political history.
Available at: Barnes & Noble Arden Fair
1725 Arden WaySacramento, CA 95815
(916) 565-0644
The Avid Reader at The Tower 1600 Broadway
Sacramento, CA 95818(916) 441-4400
Their eyes Were Watch-ing God
By Zora neale Hurston This 1930s classic presents a southern
love story that captivates the reader’s attention. A story of love, heartbreak, and resentment, it captures the reinvention of a woman who refuses to fall into a pit of sorrow when life’s challenges are presented to her. She manages to overcome two bad marriages, physical and emotional abuse, failed dreams, and a life filled with poverty and grief. A critical success when it was first published, this book is still a classic and taught in high school and college curriculum.
Available at: Sacramento Public Library
828 I StreetSacramento, CA 95814
(916) 264-2700
204,973:
50
bonnie magazine {sacramento’s lifestyle magazine for women}
march >> 2013
bonnie magazine {sacramento’s lifestyle magazine for women}
{She-tistics}BY // CHERISE HENRY
Random statistics and facts to pique your interest about the world around you.
the name of Sacramento’s first elephant. Her moniker was devised from an S for Sacramento, U for The Union newspaper that sponsored her purchase in 1948 and E for elephant.
16% of women who say
they would track their partner’s movements
via a GPS implant.
the number of sexual partners an average woman aged 20 to 59 has had during their
lifetime.
The median weekly earnings for full-time working women.
$669
SUE: The number of visitors Historic Old Sacramento attracts each year.
5,000,000
4:1920: the year the 19th amendment was ratified in the U.S. granting women the right to vote.
8 million: the number of women across the U.S. who voted in elections for the first time in 1920.
60: number of years for the remaining states to ratify the 19th amendment.
Mississippi: the final state to ratify the 19th amendment in 1984.
>>
total number of active duty women in the military
(as of November 30, 2012).
of women want to change at least one
aspect of their physical appearance.
90%
200: thenumberofwomenfeaturedattheRemarkableWomenExhibitattheCaliforniaHistoryMuseuminSacramento.