Upload File

chembl’ - warwick

1
ChEMBL What does it contain? Protein, Blast & Compound Searching Malaria Data Neglected Tropical Disease (NTD) archive Target & Taxonomy Browsing Drug Approvals

Upload: others

Post on 16-Oct-2021

10 views

Category:

Documents


0 download

Report

TRANSCRIPT

Page 1: ChEMBL’ - Warwick

ChEMBL  What  does  it  contain?

 

 

Protein,  Blast  &  Compound  Searching  

Malaria  Data   Neglected  Tropical  Disease  (NTD)  archive

Target  &  Taxonomy  Browsing

     Drug  Approvals

ChEMBL – Open Access Database For Drug Discovery

ChEMBL an Open Data Resource of Medicinal Chemistry and ... ChEMBL Japan 2014.pdf · ChEMBL an Open Data Resource of Medicinal Chemistry and Patent Data John P. Overington European

ChEMBL resources and KNIME - OpenPHACTS€¦ · ChEMBL KNIME nodes . Example: All bioactivities for hERG All6bioac9vi9es6for6hERG6 Ac9vity6value,6assay6 descripon,compound,6 reference

Warwick Cv

ChEMBL & RDKitrdkit.org/UGM/2012/Ochoa.RDKit-presentation_Final.pptx.pdfSAR Data Compound y Ki = 4.5 nM >Thrombin MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCS

Nigel Slack Warwick Business School University of Warwick, UK€¦ · Nigel Slack Warwick Business School University of Warwick, UK ©Warwick Business School 2007 What today is about

Nick Matthews The Warwick Manufacturing Group University of Warwick

Warwick Catalog

Hf Warwick

PubChem and ChEMBL Beyond Lipinski

Warwick 2011

ChEMBL US tour December 2014

between THE WARWICK SCHOOL COMMITTEE THE WARWICK …€¦ · XII General Conditions of Employment ... The School Committee of the City of Warwick and the Warwick Teachers' Union,

essential warwick

Introduction to ChEMBL - BioMedBridges

ChEMBL’€¦ · DNDi ChEMBL Compound Search Results: 5961 ALogP 2.91 2.92 3.29 3.18 PSA 103.8 107.35 83.57 83.57 HBA HBD *R05 Vic. Bonds Passes Rule Of Three

The ChEMBL bioactivity database: an update

Warwick - Amplification

ChEMBL and Structural Alerts

Warwick Ward

Warwick report

Dr Carol Hawley Warwick Medical School University of Warwick

Warwick evidence

SureChem and ChEMBL ACS CINF webinar John P ......SureChEMBL Ligand structures from patent literature ~70M ChEMBL •The world’s largest primary public database of medicinal chemistry

COURSES - Warwick

ChEMBL & RDKit · 2012. 10. 15. · Fragment library • From a set of ChEMBL molecules, RECAP* algorithm was applied. • A filter based on the number of heavy atoms and molecular

Warwick neville

SECO/WARWICK EUROPE S.A. - dinagent.com · SECO/WARWICK - holding i firme ćerke SECO/WARWICK Brazil SECO/WARWICK Allied Pvt. Ltd. (Indija) SECO/WARWICK Europe S.A. (Poljska) SECO/WARWICK

Masterarbeit - Warwick

ChEMBL database to model target of chemical compounds

ChEMBL – Large-Scale Open Access Data for Drug Discovery John Overington EMBL-EBI [email protected]

1728 WARWICK AVENUE WARWICK - RHODE ISLAND...1728 WARWICK AVENUE WARWICK - RHODE ISLAND • 6,500 SF Building • 15,246 SF of land • Signalized intersection • Office, service

Warwick - AlienBass

WEST WARWICK HEALTH EQUITY ZONE · John Magiera - West Warwick Police Karen Tarasevich - West Warwick School Department Keith Remillard - West Warwick School Department

Mining the ChEMBL Database: An Efficient Chemoinformatics ... · Mining the ChEMBL Database: An Efficient Chemoinformatics Workflow for Assembling an Ion Channel-Focused Screening