sequence based analysis tutorial
DESCRIPTION
Sequence Based Analysis Tutorial. NIH Proteomics Workshop Lai-Su Yeh, Ph.D. Protein Information Resource at Georgetown University Medical Center. Retrieval, Sequence Search & Classification Methods. Retrieve protein info by text / UID Sequence Similarity Search - PowerPoint PPT PresentationTRANSCRIPT
Sequence Based Analysis Tutorial
NIH Proteomics Workshop
Lai-Su Yeh, Ph.D.Protein Information Resource at Georgetown University Medical Center
22
Retrieval, Sequence Search & Classification Methods
Retrieve protein info by text / UID Sequence Similarity Search
BLAST, FASTA, Dynamic Programming Family Classification
Patterns, Profiles, Hidden Markov Models, Sequence Alignments, Neural Networks
Integrated Search and Classification System
33
Sequence Similarity Search (I)
Based on Pair-Wise Comparisons Dynamic Programming Algorithms
Global Similarity: Needleman-Wunch Local Similarity: Smith-Waterman
Heuristic Algorithms FASTA: Based on K-Tuples (2-Amino Acid) BLAST: Triples of Conserved Amino Acids Gapped-BLAST: Allow Gaps in Segment Pairs PHI-BLAST: Pattern-Hit Initiated Search PSI-BLAST: Position-Specific Iterated Search
44
Sequence Similarity Search (II) Similarity Search Parameters
Scoring Matrices – Based on Conserved Amino Acid Substitution
Dayhoff Mutation Matrix, e.g., PAM250 (~20% Identity)
Henikoff Matrix from Ungapped Alignments, e.g., BLOSUM 62
Gap Penalty Search Time Comparisons
Smith-Waterman: 10 Min FASTA: 2 Min BLAST: 20 Sec
55
Feature Representation Features of Amino Acids: Physicochemical Properties,
Context (Local & Global) Features, Evolutionary Features Alternative Amino Acids: Classification of Amino Acids To
Capture Different Features of Amino Acid Residues
66
Substitution Matrix Likelihood of One Amino Acid Mutated into Another Over
Evolutionary Time Negative Score: Unlikely to Happen (e.g., Gly/Trp, -7) Positive Score: Conservative Substitution (e.g., Lys/Arg, +3) High Score for Identical Matches: Rare Amino Acids (e.g., Trp, Cys)
77
Secondary Structure Features Helix Patterns of Hydrophobic Residue Conservation
Showing I, I+3, I+4, I+7 Pattern Are Highly Indicative of an Helix (Amphipathic)
Strands That Are Half Buried in the Protein Core Will Tend to Have Hydrophobic Residues at Positions I, I+2, I+4, I+6
88
BLASTBLAST (Basic Local Alignment Search Tool) Extremely fast Robust Most frequently used
It finds very short segment pairs (“seeds”) between the query and the database sequence
These seeds are then extended in both directions until the maximum possible score for extensions of this particular seed is reached
99
BLAST Search From BLAST Search Interface Table-Format Result with BLAST Output and SSEARCH
(Smith-Waterman) Pair-Wise Alignment
Link to NCBI taxonomy
Click to seealignment
Links to iProClass and UniProtKB reports
Link to PIRSF report
Click to see SSearch alignment
1010
Blast Result & Pairwise Alignment
BLAST Aligment
1111
How do you build a tree?
Pick sequences to align Align them Verify the alignment Keep the parts that are aligned correctly Build and evaluate a phylogenetic tree Integrated Analysis
1212
Pairwise alignment:Calculate distance matrix
Mean number of differences per residue
Unrooted Neighbor-Joining Tree Branch length drawn to scale
Rooted NJ Tree (guide tree)
Root place at a position where the means of the branch lengths on either side of the root are equal
Progressive Alignment guided by the tree
Alignment starts from the tips of the tree towards the root
Thompson et al., NAR 22, 4675 (1994).
Multiple Sequence Alignment: CLUSTALW
1313
PIR Multiple Alignment and Tree From Text/Sequence Search Result or CLUSTAL W Alignment Interface
1414
1515
PIR Pattern Search From Text/Sequence Search Result or Pattern Search Interface
P-[IV]-[WY]-x(3)-H-[MR]-V-x(3,4)-Q-x(1,2)-D-x(4,5)-G-A-N
P-[IV]-[WY]-x(3)-H-[MR]-V-x(3,4)-Q-x(1,2)-D-x(4,5)-G-A-N
Alignment of a region involved in catalytic activity
Create Pattern and search in database:
A
B
O05689
Test sequence against PROSITE database
Signature Patterns for Functional Motifs
1616
Pattern Search Result (I)A. One Query Pattern Against UniProtKB or UniRef100 DBs
Display the query pattern
Links to iProClass and UniProtKB reports
Link to NCBI taxonomy
Link to PIRSF report
Indicate pattern sequence region(s)
1717
Pattern Search Result (II)B. One Query Sequence Against PROSITE Pattern Database
1818
Profile Method
Profile: A Table of Scores to Express Family Consensus Derived from Multiple Sequence Alignments Num of Rows = Num of Aligned Positions Each row contains a score for the alignment with each possible
residue. Profile Searching
Summation of Scores for Each Amino Acid Residue along Query Sequence
Higher Match Values at Conserved Positions
1919
Prosite PS50157 profile for Zinc finger C2H2
2020
Search One Query Protein Against all the Full-length and Domain HMM models for the fully curated PIRSFs by HMMER
The matched regions and statistics will be displayed.
Shows PIRSF that the query belongs to
Statistical data for all domains
Statistical data per domain
Alignment with consensus sequence
1
PIRSF scan
2121
Lab Section
2222
Rat eye lens phosphoproteomics in normal and cataractKamei et al., Biol. Pharm. Bull., 2005.
Normal Cataract(-) pI (+)
Mw
More phosphorylated spots in cataract sample.Digestion and MS from Spot 16 gave these peptides:
MDVTIQHPWFKRALGPFYPSRCSLSADGMLTFSGYRLPSNVDQSALS
We want to identify the protein(s) that contain these peptides
Use Peptide Search
MDVTIQHPWFKR
2323
Peptide Search
2424
Links to iProClass and UniProtKB reports
Link to NCBI taxonomy
Link to PIRSF report
Matching peptidehighlighted in the sequence
Sorting arrows
Peptide Search & ResultsSpecies restricted search
Search in UniProtKB, 23 proteins
2525
Batch Retrieval Results (I)
Retrieve more sequences
• Retrieve multiple proteins in from iProClass using a specific identifier or a combination of them• Provides a means to easily retrieve and analyze proteins when the identifiers come from different databases
2626
ID MappingID Mapping
2727
Blast Similarity Search
>P24623
• Perform sequence similarity search
What proteins are related to rat CRYAA?
http://pir.georgetown.edu/pirwww/search/blast.shtml
2929
Pairwise Alignment
3030
UniProtKBDatabaseand unique UniParc
sequences
PIR protein family classification
database
PIR Text Search ((http://pir.georgetown.edu/search/textsearch.shtml)
Let’s search for human crystallins
3131
Refine your search or start over
Display PDB ID
Let’s look for crystallins which have 3D structure
3232
Domain Display allows to compare simultaneously Pfam domains present in multiple proteins
Let’s perform a multiple alignment on the sequences containing PF00030
Share same domainarchitecture
3333
Multiple Alignment
3434
Interactive Phylogenetic Tree and Alignment
Beta B1 and gamma crystallins share the same domains, SCOP fold and share significant sequence similarity suggesting that they are related
3535
Pattern Search (I)
Search for proteins containing this pattern (PS00225) in rat
Select P07320 and perform a pattern search
3636
Pattern Search Result
Beta and gamma Crystallins have multiple copies of this pattern