Upload File

o2 binding properties of the product of the central exon of β-globin gene

  • Home
  • Documents
  • O2 binding properties of the product of the central exon of β-globin gene
4

Upload: sherman

Post on 21-Jul-2016

212 views

Category:

Documents


0 download

Report

TRANSCRIPT

Page 1: O2 binding properties of the product of the central exon of β-globin gene
Page 2: O2 binding properties of the product of the central exon of β-globin gene

© Nature Publishing Group1981

Page 3: O2 binding properties of the product of the central exon of β-globin gene

© Nature Publishing Group1981

Page 4: O2 binding properties of the product of the central exon of β-globin gene

1 Genetics and Biosynthesis of Human Hemoglobin The α-like globin genes The β-like genes

Gamma Globin

GLOBIN REPS

ClinicalStudy - Hindawi Publishing Corporationdownloads.hindawi.com/archive/2017/8196434.pdf · ChemotherapyResearchandPractice 3 Exon 19-censored Exon 21-censored Exon 19 Exon 21

Exon selection factor

β-globin gene transfer to human bone marrow for sickle ...content-assets.jci.org/manuscripts/67000/67930/JCI67930.v1.pdf · (CCL-βAS3), the parental DL-β AS3 vector, and a vector

Table 1 The complete coding sequences of β-globin genes of ...downloads.hindawi.com/journals/cmmm/2016/3262813.f1.pdf · Supplementary materials . Table 1 The complete coding sequences

LUẬN ÁN TIẾN SĨ Y HỌC - Hanoi Medical University · 4.2. Đột biến gen β -Globin ở bệnh nhân β -Thalassemia..... 90 4.2.1. Các đột biến gen HBB phát hiện

Polymorphism studies on microRNA targetome of thalassemiathalassemia is the result of decreased or complete absence of β-globin chain expression, leading to the imbalances of α/β

Infection, Genetics and Evolution - Semantic Scholar · PDF fileUnderstanding the contrasting spatial haplotype patterns of malaria-protective β-globin polymorphisms Carinna Hockham,

Bases genéticas y moleculares del síndrome de … · Bases genéticas y moleculares del síndrome de Brugada 297 Exon 28 Exon 9 ¿Mutación? Exon 28 Exon 28 Exon 9 V2 V2 Figura

The β-Globin LCR is Not Necessary for an Open Chromatin Structure or Developmentally Regulated Transcription of the Native Mouse β-Globin Locus Elliot

Ryan Exon Portfolio

Restoration of -globin expression with optimally designed ...Jul 18, 2020  · β-thalassemia is the most prevalent hereditary blood disorder found in Mediterranean, Middle Eastern,

ETV6 (TEL1) in Blood Cell Development and Malignancydro.deakin.edu.au/eserv/DU:30072293/rasighaemi-etv6tel1...of β-globin synthesis [25]. This may explain the observation that enhanced

Hemoglobinopathies. Hemoglobin structure globin globin globin Hgb A tetramer

Beta Globin and Mutations

Towards a comprehensive catalogue of validated and target ...krishna.gs.washington.edu/documents/gasperini_nrg_2020.pdfthe β-globin gene 22–24, the β-globin LCR was hyper - sensitive

PowerPoint Presentation · Retinoblastoma WT QRX-421 Exon 12 Exon 13 Exon 14 Exon 12 Exon 14 In-frame Exon 11 Exon 14 Out of-frame No AON QRX-421 Exon 12 Exon 13 Exon 14 Erwin van

Estrogen receptor β exon 3-deleted mouse: The importance ...that it lacked exon 3 and that splicing had occurred between exons 2 and 4 (Fig. 1C). Because of the two in-frame stop

a -globin ( 141) and b -globin (146)

Beta-Globin gene Activity

-globin ( 141) and -globin (146) V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS--H---GSAQVKGHGKKVADAL VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAF

Supplemental figure1 89101112131415 Age (weeks) Up to 39 Systemic DMBA Tumor detection Collection A D C loxP AREx2-FAREx4-R Exon 4 Exon 2 Exon 3 Exon 2

-thalassemia...β-Thalassemia is a genetic anemia caused by partial or complete loss of β-globin synthesis, leading to ineffective erythropoiesis and RBCs with a short life span

Exon Table

PBL Gen Globin Pasca

Sickle cell disease This is an inherited multisystem disorder caused by abnormal properties of RBCs containing HbS. This results from mutation in the β-globin

Apresentação - IMM 13-04-2010 - final...Exon 1 Exon 2 Exon 3 X Human -globin mRNA (AR) (AR) (AD) NMD NMD Splicing AUG Ter EJC EJC 50 - 54 nts Intron 1 Intron 2 5 ’ 3 ’ AUG Ter

P. Pathophysiology Normally, the majority of adult hemoglobin (HbA) is composed of four protein chains, two α and two β globin chains arranged into

EXON - exeter.ox.ac.uk

Globin X is a six-coordinate globin that reduces nitrite ... · Globin X is a six-coordinate globin that reduces nitrite to nitric oxide in fish red blood cells Paola Cortia, Jianmin

Interrogation of Enhancer Function by Enhanced …K562 erythroleukemia cells 35that highly express -globin genes β . We achieved 3.4 to 13.7-fold repression of β-globin genes (HBE1,

Role of HDACs in normal and malignant hematopoiesisEKLF EKLF-HDAC1/Sin3A K562 cells Inhibiting β-globin gene expression PU.1 PU.1-HDAC1/Sin3A MEL cells Inhibiting β-globin gene expression

Precision Medicine and Health Disparities: The Promise and ... · Sickle Cell Disease • The first “molecular” disease • Caused by point mutation in the β-globin chain of