characterisation of the shigella flexneri · abstract iii abstract shigella flexneri is the major...
TRANSCRIPT
![Page 1: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/1.jpg)
!!!!!!
Characterisation of the Shigella flexneri
O Antigen Polymerase Wzy
Pratiti Nath M.Sc, B.Sc (Honours)
Submitted for the degree of Doctor of Philosophy
Department of Molecular and Cellular Biology
School of Biological Sciences
The University of Adelaide
Adelaide, South Australia, Australia
May, 2015
![Page 2: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/2.jpg)
!!!!!!
![Page 3: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/3.jpg)
!!!!!!
This thesis is dedicated to my parents Mr Pradip Kumar Nath and Ms Sumita Nath, my
husband Dr Arindam Dey, and my brother Prabreesh for their love, support, and
encouragement
![Page 4: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/4.jpg)
!!!!!!
![Page 5: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/5.jpg)
Declaration
i
Declaration
I certify that this work contains no material which has been accepted for the award of any
other degree or diploma in my name, in any university or other tertiary institution and, to the
best of my knowledge and belief, contains no material previously published or written by
another person, except where due reference has been made in the text. In addition, I certify
that no part of this work will, in the future, be used in a submission in my name, for any other
degree or diploma in any university or other tertiary institution without the prior approval of
the University of Adelaide and where applicable, any partner institution responsible for the
joint-award of this degree.
I give consent to this copy of my thesis when deposited in the University Library,
being made available for loan and photocopying, subject to the provisions of the Copyright
Act 1968.
The author acknowledges that copyright of published works contained within this
thesis resides with the copyright holder(s) of those works.
I also give permission for the digital version of my thesis to be made available on the
web, via the University’s digital research repository, the Library Search and also through web
search engines, unless permission has been granted by the University to restrict access for a
period of time.
_________________________
Pratiti Nath
May, 2015
![Page 6: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/6.jpg)
ii
![Page 7: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/7.jpg)
Abstract
iii
Abstract
Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths
annually in Asia. The O antigen (Oag) component of S. flexneri lipopolysaccharide (LPS) is
important for virulence and a protective antigen. It is synthesised by a Wzy-dependent
mechanism. S. flexneri Wzy (WzySf) has 12 transmembrane (TM) segments and two large
periplasmic loops (PL). The modal chain length of the Oag is determined by chromosomally
encoded WzzSf and pHS-2 plasmid encoded WzzpHS2. Although WzySf was identified 20 years
ago, there is a lack of knowledge about its functional amino acid residues as WzySf has low
expression and poor detection. WzySf is thought to interact with WzzSf however, there is no
direct evidence on how these two proteins are associated.
A wzySf-gfp expression construct (pWaldo-wzySf-TEV-GFP or pRMPN1) was made; it
successfully expressed WzySf-GFP and complemented a wzySf mutant (!wzy). To identify
functionally important amino acid residues in WzySf, random mutagenesis was performed on
the wzySf in pRMPN1, followed by screening with colicin E2. Analysis of the LPS conferred
by mutated WzySf proteins in the !wzy strain identified 4 different mutant classes, with
mutations found in PL1, 2, 3, and 6; TM2, 4, 5, 7, 8, and 9, and cytoplasmic loop (CL) 1 and
CL5. The association of WzySf and WzzSf was investigated by transforming these mutated
wzySf plasmids into a wzySf and wzzSf deficient (!wzy !wzz) strain. Comparison of the LPS
profiles in the !wzy and !wzy !wzz backgrounds identified WzySf mutants whose
polymerisation activities were WzzSf dependent. Colicin E2 and bacteriophage Sf6c
sensitivities were consistent with the LPS profiles. Analysis of the expression levels of the
WzySf-GFP mutants in the !wzy and !wzy !wzz backgrounds identified a role for WzzSf in
WzySf stability. Hence, in addition to its role in regulating Oag modal chain length, WzzSf also
affects WzySf activity and stability.
Site-directed mutagenesis was performed on wzySf in pRMPN1 to alter Arg residues in
WzySf’s two large PLs (3 and 5) to Ala. Analysis of the LPS profiles conferred by mutated
WzySf proteins in the !wzy strain identified residues that affect WzySf activity. The importance
of the guanidium group of the Arg residues was investigated by altering the Arg residues to
![Page 8: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/8.jpg)
Abstract
iv
Lys and Glu, which generated WzySf mutants conferring altered LPS Oag modal chain
lengths. The dependence of these WzySf mutants on WzzSf was investigated by expressing
them in the !wzy !wzz strain. Comparison of the LPS profiles identified a role for the Arg
residues in the association of WzySf and WzzSf. Comparison of the expression levels of
different mutant WzySf-GFPs with the wild-type WzySf-GFP showed that certain Arg residues
affected production levels of WzySf in a WzzSf-dependent manner.
WzySf-GFP-His8 was purified by affinity chromatography and I propose that WzySf
may form dimers. The negative dominance study suggested that the dimer formation may be
not essential for functioning of WzySf. In vivo crosslinking was performed in a !wzy strain
carrying plasmids encoding His-tagged WzySf and untagged WzzSf. In vivo crosslinking was
followed by affinity purification of WzySf, and Western immunoblotting with WzzSf antibody
detected the co-purification of WzzSf. This was also supported by mass spectrometry analysis
and provided the first report of complex formation between WzySf and WzzSf. The WzySf
mutants (WzySfR164A, WzySfV92M, WzySfY137H, and WzySfR250K) having Wzz-
dependent activity were still able to form complexes with WzzSf which suggested that
although their activity is Wzz-dependent, the mutational alterations do not affect the
interaction of WzySf with WzzSf. Thus the interaction may involve many regions of WzySf.
This thesis identified and characterised functionally important amino acid residues of
WzySf, identified several novel LPS phenotypes conferred by the WzySf mutants, and found
that WzzSf affects the functioning and stability of WzySf, both positively and negatively. The
work also first time identified direct physical interaction of WzzSf and WzySf, and developed a
purification method for WzySf. Finally, I proposed a model of Wzy-dependent Oag
polymerisation through the interaction of Wzy with Wzz.
![Page 9: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/9.jpg)
Acknowledgements
v
Acknowledgements
First and foremost, I would like to thank my supervisor Associate Professor Renato Morona. I
was fortunate to have him as my mentor. I would like to appreciate him for giving me such a
wonderful project, and I really enjoyed all the challenges and opportunities came on my way.
He not only helped me to understand the research field, but also supported me throughout the
candidature. He has been a great source of inspiration. I have learned a lot from you Renato
and thank you for everything.
I would like to thank the University of Adelaide and School of Biological Sciences for
hosting me and supporting me with the scholarships and other facilities, which helped me to
conduct my research.
Throughout my doctoral study I have been fortunate to work with a number of talented
colleagues in Morona Laboratory. I would like to thank Dr Elizabeth Tran for answering
many questions, for sharing your knowledge on Shigella, and expertise on laboratory
techniques. I am thankful to Dr Stephen Attridge, Dr Alistair Standish, Matthew Doyle,
Jonathan Whittall, and Brad Qin for their help in numerous ways during my doctoral study. I
would also like to thank past and present members of Paton, Mcdevitt, and Kidd laboratories
for their support and making it such a great place to work.
I would like to take the opportunity to express my gratitude to all the teachers who
guided me from my primary school to the Masters degree and prepared me for this doctoral
study, especially Ms Mukti Basu, Mr. Rajen Mandal, Mr Amit Kumar Ghosh, Mr. Satipoti
Moitra, Dr Sharmila Chakraborty, Dr Saroj Kanti Das, and Dr Prajna Mandal. Their guidance,
care, and enthusiastic discussion helped me to pursue a research career.
I am grateful to all my friends from my childhood to now for their love, support, and
encouragement. Tania, Lipika, Mou, Santa, Jhimli, Aditi, Suhas, Tapashree, Swatilekha,
Sreetama, and Suman; thanks for making my life enjoyable and fun packed. My friends in
Adelaide have great impact on my PhD life. Without their constant company it would have
been hard to overcome the last two years of my PhD when my husband moved to interstate
for his work. Thanks to Sanchita for your company and the delicious meals cooked by you.
Thanks to Indrajit for all the parties. I would like to thank all my friends in the MLS building:
![Page 10: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/10.jpg)
Acknowledgements
vi
Min, Mabel, Zuleeza, Donald, Alex, Long, Paul, Zarina, and Rethish. Thanks to Min, Mabel,
and Zuleeza for the dinner dates and shopping sprees. I will miss the weekend outing with
you girls. Thank you Donald for all the delicious cakes and snacks. Alex and Long thanks for
the friendly chatting after a stressful day whic helped me a lot. Paul and Mabel, you used to
annoy me by your dance moves but now I really miss it. Although I still don’t think it was
actually a dance. I had a great time in MLS building with all of you and hope I will see you all
soon.
I would like to thank my family in India; without their constant support and
encouragement it would have been very difficult for me to survive on a foreign land. My
mother was my first teacher and she did a lot of sacrifices to give me a better life. I can’t
imagine a moment when I needed her and she was not there. In any difficult time my dad is
always my strength, his belief in me and encouragement mean so much to me. He always
taught me to be a good human being. They are the best parents in this world and I think
saying thanks to them will be an immense disrespect; I owe my life to you. I would like to
thank my little brother Rick for bringing all the happiness and joy in my life. He was the best
entertainment for me in his childhood (and my teenage). Although he is naughty sometimes
but I can forgive him for all the fun we had together and the lovely memories we share. I
would like to thank my brother Biswajit for all his support, love, and guidance; and my
grandma for her friendship, care, and love. I would also like to thank my uncles (especially
Sejda), cousins, father-in-law, and brother-in-law for their love and support.
And Finally, I would like to thank the man of my life Dr Arindam Dey, my best
friend, my husband, and my partner in crime. It is hard to express your contribution in my life
in words. I will never forget that you used to fly more than 3 hours from Cairns to Adelaide
every fortnight and sometimes every week to spend few hours with me. Whenever I was
stressed you came to see me and you became financially broke due to the expensive flight
tickets. You are the best man for keeping a long distance relationship and without your
unconditional support it would have been hard for me to continue my study. Not only in
personal life, you also did a lot professionally for me. Thanks for proofreading all my drafts,
and your experience as a PhD student always guided me in my study. I am looking for an
exciting future together with challenges, learning, arguments, achievements, and
unconditional love.
![Page 11: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/11.jpg)
Publications
vii
Publications
Nath, P. & Morona, R. (2015). Detection of Wzy/Wzz interaction in Shigella flexneri.
Microbiology (In press) Published online 09 July, 2015, doi:10.1099/mic.0.000132
(Chapter 5)
Nath, P. & Morona, R. (2015). Mutational analysis of the major periplasmic loops of Shigella
flexneri Wzy: identification of the residues affecting O antigen modal chain length control,
and Wzz-dependent polymerization activity. Microbiology 161, 774-785.
(Chapter 4)
Nath, P., Tran, E. N. & Morona, R. (2015). Mutational Analysis of the Shigella flexneri O-
Antigen Polymerase Wzy: Identification of Wzz-Dependent Wzy Mutants. J Bacteriol 197,
108-119.
(Chapter 3)
![Page 12: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/12.jpg)
viii
![Page 13: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/13.jpg)
Contents
!
ix
Contents
Declaration …………………………………………………………………….. i
Abstract………………………………………………………………………… iii
Acknowledgements…………………………………………………………….. v
Publications…………………………………………………………………… vii
Abbreviations…………………………………………………………………. xix
Chapter 1: Introduction ...................................................................................... 1
1.1 Indroduction ...................................................................................................................... 2
1.2 Shigella spp. ...................................................................................................................... 2
1.3 Shigellosis and epidemiology ........................................................................................... 3
1.4 Pathogenesis ...................................................................................................................... 4
1.5 Virulence factors ............................................................................................................... 4
1.5.1 Large virulence plasmid (VP) .................................................................................... 6
1.5.2 Mxi-Spa type III secretion system (TTSS) ................................................................. 6
1.5.3 Effector proteins secreted by TTSS ............................................................................ 7
1.5.4 IcsA protein ................................................................................................................ 8
1.6 Lipopolysaccharide (LPS) ................................................................................................. 9
1.6.1 Morphology .............................................................................................................. 10
1.6.1.1 Lipid A………………………………………………………………………10
1.6.1.2 Core sugar…………………………………………………………………...13
1.6.1.3 O antigen (Oag)……………………………………………………………...13
1.6.2 LPS as a virulence factor .......................................................................................... 19
1.7 LPS biosynthesis and export ........................................................................................... 22
1.7.1 Lipid A and core biosynthesis .................................................................................. 23
1.7.2 O antigen biosynthesis .............................................................................................. 24
1.7.3 LPS export ................................................................................................................ 26
1.8 Oag polymerisation protein Wzy .................................................................................... 29
1.8.1 S. flexneri Wzy (WzySf) ............................................................................................ 30
![Page 14: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/14.jpg)
Contents
!
x
1.8.2 Wzy proteins of different bacterial species .............................................................. 30
1.8.3 Comparison of WzySf with other Wzy proteins ....................................................... 33
1.9 Oag chain length regulator Wzz ...................................................................................... 34
1.9.1 S. flexneri Wzz ......................................................................................................... 34
1.9.2 Chain length and virulence ....................................................................................... 37
1.10 Association of the proteins of the Oag biosynthesis pathway ...................................... 38
1.11 Aims and hypotheses .................................................................................................... 39
1.12 Thesis Organisation ....................................................................................................... 40
Chapter 2: Materials and Methods .................................................................. 43
2.1 Bacterial strains and plasmids ......................................................................................... 44
2.2 Bacterial growth media and growth condition ................................................................ 44
2.2.1 Liquid growth media ................................................................................................ 44
2.2.2 Solid growth media .................................................................................................. 44
2.3 Chemicals and reagents ................................................................................................... 53
2.4 Antibodies and antisera ................................................................................................... 53
2.5 Nucleic acid methods ...................................................................................................... 53
2.5.1 Isolation of plasmid DNA and DNA preparation ..................................................... 53
2.5.2 Quantitation of DNA ................................................................................................ 54
2.5.3 Restriction enzyme digestion ................................................................................... 54
2.5.4 Agarose gel electrophoresis ...................................................................................... 54
2.5.5 DNA sequencing ...................................................................................................... 54
2.5.5.1 Sample preparation…………………………………………………………..54
2.5.5.2 Capillary separation DNA sequencing……………………………………….55
2.5.5.3 Sequencing analysis………………………………………………………….55
2.6 Polymerase chain reaction (PCR) ................................................................................... 55
2.7 DNA purification ............................................................................................................ 58
2.7.1 DNA gel extraction .................................................................................................. 58
2.7.2 Purification of PCR products ................................................................................... 58
2.8 Ligation of DNA fragments into cloning vectors ........................................................... 58
2.9 Transformation ................................................................................................................ 59
![Page 15: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/15.jpg)
Contents
!
xi
2.9.1 Preparation of chemically competent cells ............................................................... 59
2.9.2 Heat shock transformation ........................................................................................ 59
2.9.3 Preparation of electrocompetent cells ...................................................................... 59
2.9.4 Electroporation ......................................................................................................... 60
2.10 Mutagenesis .................................................................................................................. 60
2.10.1 Random mutagenesis .............................................................................................. 60
2.10.2 Site-directed mutagenesis ....................................................................................... 61
2.11 Characterisation of mutants ........................................................................................... 61
2.11.1 Colicin sensitivity assay ......................................................................................... 61
2.11.1.1 ColE2 swab assay…………………………………………………………61
2.11.1.2 ColE2 spot assay………………………………………………………….61
2.11.2 Bacteriophage sensitivity assay .............................................................................. 62
2.12 Protein Techniques ........................................................................................................ 62
2.12.1 Preparation of whole cell lysate ............................................................................. 62
2.12.2 Preparation of whole membrane fraction ............................................................... 63
2.12.3 SDS-PAGE ............................................................................................................. 63
2.12.4 In-gel fluorescence ................................................................................................. 64
2.12.5 Coomassie blue staining ......................................................................................... 64
2.12.6 Western immunoblotting ........................................................................................ 64
2.12.7 Over-expression of WzySf-GFP-His8 ..................................................................... 65
2.12.8 Purification of His-tagged membrane protein ........................................................ 65
2.12.9 In vivo chemical crosslinking ................................................................................. 66
2.12.10 Co-purification or pull down ................................................................................ 66
2.12.11 Proteomics analysis .............................................................................................. 67
2.13 Lipopolysaccharide (LPS) Techniques ......................................................................... 68
2.13.1 Preparation of LPS samples ................................................................................... 68
2.13.2 Analysis of LPS by silver-stained SDS-PAGE ...................................................... 68
Chapter 3: Mutational analysis of the Shigella flexneri O antigen polymerase Wzy;
Identification of Wzz-dependent Wzy mutants ................................................ 71
Title page…………………………………………………………………………………..72
![Page 16: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/16.jpg)
Contents
!
xii
Statement of authorship……………………………………………………………………73
3.1 Abstract ........................................................................................................................... 74
3.2 Introduction ..................................................................................................................... 74
3.3 Materials and Methods .................................................................................................... 77
3.3.1 Bacterial strains and plasmids .................................................................................. 77
3.3.2 Growth media and growth conditions ...................................................................... 77
3.3.3 Construction of expression vector and cloning of wzySf ........................................... 82
3.3.4 WzySf expression in Lemo21(DE3) and In-gel fluorescence ................................... 83
3.3.5 LPS method .............................................................................................................. 83
3.3.6 Random mutagenesis ................................................................................................ 84
3.3.7 Construction of the strain RMA4437 ("wzy "wzz) .................................................. 84
3.3.8 Detection of WzySf expression in S. flexneri ............................................................ 85
3.3.9 Colicin sensitivity assay ........................................................................................... 85
3.3.9.1 Colicin swab assay…………………………………………………………...85
3.3.9.2 ColE2 spot assay……………………………………………………………..86
3.3.10 Bacteriophage sensitivity assay .............................................................................. 86
3.4 Results ............................................................................................................................. 87
3.4.1 Construction of a WzySf-GFP expression plasmid ................................................... 87
3.4.2 Complementation of wzySf deficiency ...................................................................... 87
3.4.3 Random mutagenesis of wzySf .................................................................................. 89
3.4.4 LPS phenotype conferred by WzySf mutants ............................................................ 93
3.4.5 WzzSf dependence .................................................................................................... 93
3.4.6 ColE2 and bacteriophage Sf6c sensitivities ............................................................. 96
3.4.7 WzySf expression level ............................................................................................. 98
3.5 Discussion ....................................................................................................................... 98
3.6 Acknowledgements ....................................................................................................... 105
3.7 Supplementary information ........................................................................................... 106
3.7.1 Construction of pWaldo-wzySf-GFP-His8 ............................................................... 114
![Page 17: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/17.jpg)
Contents
!
xiii
Chapter 4: Mutational analysis of the major periplasmic loops of Shigella flexneri
Wzy: identification of the residues affecting O antigen modal chain length control, and
Wzz dependent polymerisation activity ........................................................... 119
Title page……………………………………………………………………………….….120
Statement of authorship…………………………………………………………………..121
4.1 Abstract ......................................................................................................................... 122
4.2 Introduction ................................................................................................................... 122
4.3 Materials and Methods .................................................................................................. 125
4.3.1 Bacterial strains and plasmids ................................................................................ 125
4.3.2 Growth media and growth conditions .................................................................... 125
4.3.3 LPS method ............................................................................................................ 125
4.3.4 Site-directed mutagenesis ....................................................................................... 128
4.3.5 Detection of WzySf expression in S. flexneri .......................................................... 128
4.3.6 Colicin sensitivity assay ......................................................................................... 129
4.3.7 Bacteriophage sensitivity assay .............................................................................. 129
4.4 Results ........................................................................................................................... 129
4.4.1 Site-directed mutagenesis of Arg residues in PL3 and PL5 of WzySf .................... 129
4.4.2 LPS phenotype conferred by the WzySf mutants .................................................... 131
4.4.3 WzzSf dependence and polymerisation activity ...................................................... 135
4.4.4 ColE2 sensitivity of strains with WzySf mutants .................................................... 136
4.4.5 Bacteriophage Sf6c sensitivity of strains with WzySf mutants ............................... 139
4.4.6 Protein expression levels of the WzySf mutants ..................................................... 140
4.5 Discussion ..................................................................................................................... 143
4.6 Acknowledgements ....................................................................................................... 148
4.7 Supplementary information ........................................................................................... 149
Chapter 5: Detection of Wzy/Wzz interaction in Shigella flexneri ............. 153
Title page…………………………………………………………………………… 154
Statement of authorship…………………………………………………………….. 155
5.1 Abstract ......................................................................................................................... 156
5.2 Introduction ................................................................................................................... 156
![Page 18: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/18.jpg)
Contents
!
xiv
5.3 Materials and Methods .................................................................................................. 158
5.3.1 Ethics Statement ..................................................................................................... 158
5.3.2 Bacterial strains, growth media and growth conditions ......................................... 158
5.3.3 Plasmids and DNA methods ................................................................................... 159
5.3.4 Purification of Wzy from Lemo21(DE3) strain ..................................................... 161
5.3.5 In vivo protein cross-linking ................................................................................... 161
5.3.6 Isolation of Wzy from S. flexneri strains ................................................................ 162
5.3.7 SDS-PAGE and Western Immunoblotting ............................................................. 162
5.3.8 In-gel fluorescence ................................................................................................. 163
5.3.9 Liquid chromatography-electrospray ionisation tandem mass spectrometry (LC-
ESI-MS/MS) .................................................................................................................... 163
5.4 Results ........................................................................................................................... 164
5.4.1 Purification of Wzy-GFP-His8 from Lemo21(DE3) ............................................... 164
5.4.2 Detection of complex formation between Wzy and Wzz by immunoblotting ....... 166
5.4.3 MS analysis of protein samples following DSP cross-linking ............................... 169
5.4.4 Analysis of the Wzy mutants with Wzz dependent properties ............................... 173
5.5 Discussion ..................................................................................................................... 175
5.6 Acknowledgements ....................................................................................................... 177
5.7 Supplementary information ........................................................................................... 178
5.7.1 Optimisation of WzySf-GFP-His8 purification ...................................................... 179
5.7.1.1 Cell fractionation…………………………………………………………...179
5.7.1.2 Optimisation of whole membrane fraction solubilisation………………….179
5.7.1.3 Metal affinity putification of WzySf-GFP-His8………………………….....181
5.7.2 Negative dominance ............................................................................................... 181
Chapter 6: Conclusion .................................................................................... 185
6.1 Introduction ....................................................................................................................... 186
6.2 Residues important for polymerisation function of WzySf ........................................... 187
6.3 Purification of WzySf ..................................................................................................... 188
6.4 Understanding the association of the Oag biosynthesis proteins .................................. 190
![Page 19: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/19.jpg)
Contents
!
xv
6.5 Mechanism of the association of Wzz and Wzy during the O antigen polymerisation in
S. flexneri ............................................................................................................................ 192
6.6 Conclusion and future work .......................................................................................... 195
Bibliography…………………………………………………………………... 197
![Page 20: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/20.jpg)
Contents
!
xvi
List of Figures
Figure 1.1 S. flexneri pathogenesis ............................................................................................. 5!Figure 1.2 LPS structural types ................................................................................................ 11!Figure 1.3 S. flexneri Lipid A structure .................................................................................... 12!Figure 1.4 S. flexneri 2a core .................................................................................................... 14!Figure 1.5 Chemical composition of the Oag of different S. flexneri serotypes ...................... 16!Figure 1.6 Synthesis of R3 type LPS core sugar ...................................................................... 25!Figure 1.7 Organisation of S. flexneri Oag biosynthesis genes ................................................ 27!Figure 1.8 S. flexneri Y serotype Oag biosynthesis .................................................................. 28!Figure 1.9 S. flexneri Wzy (WzySf) .......................................................................................... 31!Figure 1.10 S. flexneri modal chain length ............................................................................... 35!Figure 3.1 Complementation of wzySf deficiency by WzySf-GFP ............................................. 88!Figure 3.2 Locations of mutations on the topology map of WzySf ........................................... 90!Figure 3.3 LPS phenotypes conferred by different WzySf mutants expressed in PNRM6
[!wzySf (pAC/pBADT7-1)] ....................................................................................................... 94!Figure 3.4 Comparison of the LPS phenotypes conferred by the WzySf mutants expressed in
the !wzy and !wzy !wzz backgrounds ..................................................................................... 95!Figure 3.5 Protein expression levels of the mutated WzySf-GFP compared to the positive
control ....................................................................................................................................... 99
Figure 3.S1 WzySf expression……………………………………………………………….110
Figure 3.S2 LPS phenotype conferred by the class D WzySf mutants expressed in PNRM6
[!wzySf (pAC/pBADT7-1)]………………………………………………………………….111
Figure 3.S3 Comparison of the LPS phenotype conferred by the class D WzySf mutants
expressed in the !wzy and !wzy !wzz backgrounds……………………………………… 112
Figure 3.S4 Construction of pWaldo-wzySf-GFP-His8 (pRMPN1) plasmid……………… 115
Figure 3.S5 DNA and predicted amino acid sequence of the inserted WzySf sequence in
pWaldo-TEV-GFP plasmid…………………………………………………………….… 116
Figure 4.1 Location of the mutations constructed in this study on the topology map of WzySf
................................................................................................................................................ 130!
![Page 21: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/21.jpg)
Contents
!
xvii
Figure 4.2 Comparison of the LPS phenotype conferred by the WzySf mutants expressed in the
"wzy and "wzy "wzz backgrounds ......................................................................................... 132!Figure 4.3 Protein expression level of the WzySf-GFP mutants ............................................. 141!Figure 5.1 Purification of Wzy-GFP-His8 .............................................................................. 165!Figure 5.2 In vivo cross-linking with DSP .............................................................................. 167!Figure 5.3 Analysis of protein bands by MS .......................................................................... 170!Figure 5.4 Chemical cross-linking of WzySf mutants ............................................................. 174!Figure 5.S1 Topology map of WzySf ...................................................................................... 178
Figure 5.S2 Optimisation of the whole membrane solubilisation………………………….. 180
Figure 5.S3 Negative domonance………………………………………………………….. 182
Figure 6.1 “Activation and inactivation” mechanism ............................................................. 194!
![Page 22: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/22.jpg)
Contents
!
xviii
List of Tables
Table 1.1 Antigenic determinants of various S. flexneri serotypes .......................................... 18!Table 1.2 Overview of the chapters in this PhD thesis ............................................................. 41!Table. 2.1 Bacterial strains used in this study ........................................................................ 45!Table 2.2 Plasmids used in this study ...................................................................................... 50!Table 2.3 Differenet primers made in this study ...................................................................... 56!Table 3.1 Bacterial strains and plasmids used in this study ..................................................... 78!Table 3.2 ColE2 and bacteriophage Sf6c sensitivities and WzySf-GFP expression of controls
and different classes of mutants ................................................................................................ 91
Table 3.S1 Different primers made in this study…………………………………………....106
Table 3.S2 Colicin E2 (ColE2) sensitivity (performed by swab assay) of different WzySf
mutants during screening……………………………………………………………………107
Table 3.S3 Nucleotide base change in the WzySf mutants………………………………….108
Table 3.S4 Verifications of WzySf topological model using topological prediction
programs…………………………………………………………………………………….109
Table 4.1 Bacterial strains and plasmids used in this study ................................................... 126!Table 4.2 LPS profiles of different WzySf mutant phenotypic classes ................................... 134!Table 4.3 ColE2 and bacteriophage Sf6c sensitivities, and WzySf-GFP expression levels .... 137
Table 4.S1 Primers used in this study……………………………………………………….149
Table 4.S2 Periplasmic loop (PL)3 and PL5 of WzySf……………………………………...151
Table 5.1 Bacterial strains and plasmids used in this study ................................................... 160!Table 5.2 Detected peptides by MS analysis .......................................................................... 172!Table 6.1 Comparison of WzySf and WzyPa ............................................................................ 189!Table 6.2 LPS profiles of the Wzz-dependent WzySf mutants in the presence and absence of
WzzSf ....................................................................................................................................... 191!
![Page 23: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/23.jpg)
Abbreviations
!
xix
Abbreviations
Abbreviations
~ Approximately
ABC ATP-binding cassette
ABM actin based motility
ACN Acetonitrile
ACP acyl carrier protein
Amp Ampicillin
"-Me "-mercaptoethanol
Bp base pairs
CL cytoplasmic loop
Cm Chloramphenicol
ColE2 colicin E2
DDM n-Dodecyl-"-D-maltopyranoside
DNA deoxyribonucleic acid
dNTP deoxynucleoside triphosphate
DSP dithiobis(succinimidyl propionate)
dTDP-Rha deoxythymidine diphosphate rhamnose
DTT dithiothreitol
EDTA ethylenediaminetetraacetic acid
FA formic acid
Gal galactose
![Page 24: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/24.jpg)
Abbreviations
!
xx
GFP green fluorescent protein
GI gastrointestinal
Glc glucose
GlcN glucosamine
GlcNAc N-acetylglucosamine
GlcNAc-1-P GlcNAc-phosphate
GMMA generalised modules for membrane antigens
h hour (s)
Hep L-glycero-D-manno-heptose
His8 8x histidine
HRP horseradish-peroxidase
Iap inhibitor of # polymerase
IL interleukin
IM inner membrane
IPTG isopropyl-"-D-thiogalactopyranoside
IS insertion sequence
kb kilobase pairs
kDa kilodaltons
Kdo 3-deoxy-D-manno-oct-2-ulosonic acid
Km kanamycin
LB lysogeny broth
LC-ESI-MS/MS Liquid chromatography-electrospray ionisation tandem
mass spectrometry
![Page 25: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/25.jpg)
Abbreviations
!
xxi
LDAO Lauryldimethylamine-oxide
LPS lipopolysaccharides
Lpt LPS transport
M cells membranous epithelial cells
min minute (s)
MS mass spectrometry
Mxi-Spa membrane expression of Ipa proteins and surface
presentation of antigens
NEB New England Biolabs
Ni-NTA nickel-charged agarose
N-WASP neural Wiskott-Aldrich syndrome protein
Oag O antigen
OD optical density
OD600 OD at 600 nm
OM outer membrane
PAI (s) pathogenicity island (s)
PBS phosphate buffered saline
PCP polysaccharide co-polymerase
PCR polymerase chain reaction
PEtN phosphoethanolamine
p.f.u. plaque-forming units
PLs periplasmic loops
PMNs polymorphonuclear cells
![Page 26: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/26.jpg)
Abbreviations
!
xxii
Rha rhamnose
Rif rifampicin
R-LPS rough LPS
RNA ribonucleic acid
RNase ribonuclease
rpm revolutions per minute
RT room temperature
RU(s) repeat unit(s)
Sarkosyl sodium lauroyl sarcosine
SDS sodium dodecyl sulphate
SDDS sodium dodecanoyl sarcosine
SDS-PAGE SDS polyacrylamide gel electrophoresis
Sec seconds
S-LPS smooth LPS
SR-LPS semi rough LPS
S-type short type
TBE tris-borate-EDTA
TBS tris buffered saline
TEMED N,N,N',N'-Tetramethyl-ethylenediamine
Tc or Tet tetracycline
TMs transmembrane segments
Tris tris (hydroxymethyl) aminomethane
TTBS tween tris buffered saline
![Page 27: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/27.jpg)
Abbreviations
!
xxiii
TTSS type III secretion system
UDP uridine diphosphate
Und-P undecaprenol phosphate
V volts
VL-type very long type
VP virulence plasmid
WM whole membrane
WT wild type
WzyEc Escherichia coli O86 Wzy protein
wzyFt Francisella tularensis LVS wzy gene
WzyFt F. tularensis LVS Wzy protein
WzyPa Pseudomonas aeruginosa PAO1 Wzy protein
WzySf Shigella flexneri Wzy protein
wzySf S. flexneri wzy gene
WzzpHS2 pHS2 plasmid encoded S. flexneri Wzz protein
WzzSf Chromosomaly encoded S. flexneri Wzz protein
X-Gal 5-bromo-4-chloro-3-indolyl-"-D-galactoside
![Page 28: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/28.jpg)
!
xxiv
![Page 29: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/29.jpg)
1
Acknowledgements
Chapter 1
Introduction
![Page 30: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/30.jpg)
Introduction
2
Introduction
1.1 Indroduction
Shigella spp. are well adapted human pathogens and are responsible for the disease
Shigellosis. The resistance of Shigella spp. to antibacterials is prevalent and rising (Fulla et
al., 2005). There is no available vaccine against Shigella spp. (Stagg et al., 2009).
Lipopolysaccharide (LPS) is one of the important virulence factors of Shigella and contains O
antigen (Oag), the serotype determinant and protective antigen (Raetz & Whitfield, 2002;
Yethon & Whitfield, 2001). Immunity against Shigella is serotype specific (Liu et al., 2008;
Wang et al., 2010a; Yethon & Whitfield, 2001). Oag is synthesised by a Wzy-dependent
pathway (Woodward et al., 2010). Alarmingly, new serotypes of the bacteria are emerging
(Sun et al., 2012). Understanding the mechanism behind the synthesis of Oag will be helpful
to achieve control over Shigella infection by vaccine and drug development.
This chapter reviews S. flexneri LPS and Oag as a bacterial virulence determinant, and
the roles of Wzy and other proteins in the Oag biosynthesis pathway.
1.2 Shigella spp.
Shigella spp. are Gram-negative facultative intracellular bacteria and are members of the
family Enterobacteriaceae. They are bacilli in shape, and the causative agent of the bacillary
dysentery which is also called shigellosis (Sansonetti, 2001). There are four identified species
of Shigella: S. dysenteriae (Group A), S. flexneri (Group B), S. boydii (Group C), and S.
sonnei (Group D). Each species is further subdivided due to the variation in the chemical
composition of the Oag (Lan & Reeves, 2002; Larue et al., 2009; Parsot, 2005; Simmons,
1993). Comparative genomic analysis showed that sequence divergence between S. flexneri
and Escherichia coli K-12 is roughly 1.5% and Shigella is a subtype of E. coli (Lan &
Reeves, 2002).
The convergent evolution in Shigella spp. occurred by loss of catabolic genes, flagella,
fimbriae, and acquisition of a large 200 kb virulence plasmid (VP), pathogenicity islands
(PAIs), and genes essential for modifying the LPS Oags (Al Mamun et al., 1996; Buchrieser
et al., 2000; Ingersoll et al., 2002; Jin et al., 2002; Maurelli et al., 1998; Pupo et al., 2000;
![Page 31: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/31.jpg)
Introduction
3
Rajakumar et al., 1997; Tominaga et al., 2005; Yang et al., 2005). Loss of catabolic genes,
flagella and fimbriae occurred to facilitate the adaptation to an intracellular lifestyle (Al
Mamun et al., 1996; Tominaga et al., 2005; Yang et al., 2005) and the intracellular movement
and cell-to-cell spreading of Shigella are facilitated by actin-based motility (ABM) that
exploits host factors.
1.3 Shigellosis and epidemiology
Shigellosis is an invasive disease of the lower gastrointestinal tract (GI) and it is characterised
by several symptoms including short term watery diarrhoea, bloody diarrhoea with mucoid
faeces, fever, fatigue, headaches, intestinal cramps, and severe inflammatory bowel disease
(Ashkenazi et al., 1990; Sansonetti, 2001). Shigellosis is generally a self-limiting disease but
sometimes it can create life-threatening conditions (Koster et al., 1978; Niyogi, 2005). The
rate of incidence of shigellosis is higher in developing countries (von Seidlein et al., 2006). A
recent review of literature (1990-2009) by Bardhan et al. (2010) indicated that nearly 125
million shigellosis cases occur annually in Asia, with approximately 14,000 fatalities; the
majority of deaths occur in children under 5 years of age (Bardhan et al., 2010).
Overcrowding, lack of potable water, malnutrition, cost of antibiotics, and poor sewage
management in developing countries are mainly responsible for the high incidence of
shigellosis (Hale, 1991; Jennison & Verma, 2004). S. dysenteriae is mainly responsible for
epidemic shigellosis but in endemic areas infection by any subtype of Shigella can be fatal
(Bennish, 1991). However, S. flexneri is the predominant subtype in endemic areas. In the
developing countries, the predominant serotypes of S. flexneri are 1b, 2a, 3a, 4a, and 6. In the
industrialised countries, the predominant serotype of S.flexneri is 2a (Jennison & Verma,
2004). However, new serotypes are emerging. Emergence of new serotype 1c has been
reported from Bangladesh (Talukder et al., 2003). New serotype Xv appeared in Henan
province China in 2001, and in 2002-2006 it replaced serotype 2a and became the most
prevalent serotype. It also became the most prevalent serotype in Shanxi province in 2006-
2007, and in Gansu, Anhui, and Shanghai in 2007 (Sun et al., 2012).
![Page 32: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/32.jpg)
Introduction
4
1.4 Pathogenesis
S. flexneri infection is transmitted by a faecal-oral route and ingestion of as few as 10-100
organisms is sufficient to cause the disease (DuPont et al., 1989; Waterman & Small, 1996).
S. flexneri uses the membranous epithelial cells (M cells) as a threshold to cross the epithelial
barrier and to propagate (Fig. 1.1). It invades the M cell epithelium and is released into the
intra-epithelial pocket where resident macrophages engulf the bacteria. However, the bacteria
evade the killing mechanism of the macrophage and induce pyroptosis of the macrophage. As
a result, a large amount of interleukin 1 (IL-1) is released which initiates inflammation and
recruits polymorphonuclear cells (PMNs) at the site of infection. The influx of PMNs disrupts
the integrity of the epithelium and facilitates the surge of the lumenal bacteria to the
submucosa (Jennison & Verma, 2004; Kraehenbuhl & Neutra, 2000; Sansonetti & Phalipon,
1999). After reaching the basolateral side the bacteria are able to invade the epithelial cells
through bacterial induced endocytosis, resulting in the engulfment of the bacteria within an
endocytic vacuole. Lysis of the endocytic vacuoles releases the bacteria into the cytoplasm of
the host cell (Blocker et al., 1999; Jennison & Verma, 2004). Within the host cell cytoplasm
Shigella multiplies and polymerises actin filament at one pole by use of the IcsA (VirG)
protein. ABM propels the bacteria through the cytoplasm of the host cell. Bacteria reach the
cell membrane and form a protrusion which is taken up by the adjacent cell. The protrusion is
then pinched off to form a double membrane-bound vacuole with the bacterium inside. S.
flexneri is able to lyse this vacuole, and is released into the cytoplasm of the adjacent cells
(Goldberg, 2001; Monack & Theriot, 2001; Prevost et al., 1992; Schuch et al., 1999; Suzuki
et al., 1996; Suzuki et al., 1998; Suzuki & Sasakawa, 2001). The cycle then repeats.
1.5 Virulence factors
S. flexneri has several virulence factors such as VP encoded Mxi-Spa type III secretion system
(TTSS), proteins secreted by TTSS, IcsA protein, and LPS. LPS is described in detail in
Section 1.6.
![Page 33: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/33.jpg)
Introduction
5
Figure 1.1 S. flexneri pathogenesis S. flexneri are taken up by M cells epithelium then released into the intra-epithelial pocket,
where the bacteria evade the killing mechanism of the resident macrophages and induce
pyroptosis of the macrophages. The bacteria reach the basolateral side, invade the epithelial
cells, release into the cytoplasm, and replicate. ABM propels the bacteria through the
cytoplasm of the host cell. Then the bacteria penetrate the cell membrane, release into the
adjacent cell, and repeat the cycle.
![Page 34: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/34.jpg)
Introduction
6
1.5.1 Large virulence plasmid (VP)
The pathogenicity of S. flexneri is characterised by penetrating epithelial cells (Labrec et
al., 1964) and the ~230 kb VP in the bacteria is required for this ability (Sansonetti et al.,
1982; Sasakawa et al., 1993). VPs pWR100 in S. flexneri 5, pMYSH6000 in S. flexneri 2a,
and pSS120 in S. sonnei and those in other Shigella strains are determinants for invasiveness
and disease causing ability and are collectively termed pINV plasmids (Lan et al., 2001). The
complete nucleotide sequencing of S. flexneri 2a strain 301 VP was performed by Zhang et al.
(2003) which showed that it is 221618 bp with 272 open reading frames, and insertion
sequence (IS) elements are 68 kb in length and cover 30% of the complete genome (Zhang et
al., 2003). The VP contains a 31 kb PAI which is required to elicit the invasion property and
contains the gene encoding TTSS. PAI of S. flexneri contains 28 genes bracketed by several
IS elements (Buchrieser et al., 2000; Galan & Collmer, 1999; Jouihri et al., 2003; Schroeder
& Hilbi, 2008).
1.5.2 Mxi-Spa type III secretion system (TTSS)
TTSSs are evolutionary related to the bacterial flagellar secretion system (Schroeder et al.,
2007). TTSS is a needle like structure with a basal structure spanning bacterial inner
membrane (IM) and outer membrane (OM), a hollow needle, and a hydrophobic translocator
complex that inserts into the target eukaryotic membranes (Hong et al., 2012; Schroeder et
al., 2007). TTSS is a protein transport device and translocates the effector molecules from
bacterial cytoplasm to the membrane and cytoplasm of the host cell (Galan & Collmer, 1999;
Hong et al., 2012; Jouihri et al., 2003; West et al., 2005). S. flexneri employs TTSS to invade
epithelial cells and to kill macrophages (Cossart & Sansonetti, 2004) and it is encoded by mxi
and spa genes on the VP (Blocker et al., 1999; Blocker et al., 2001; Buchrieser et al., 2000;
Cornelis, 2006; Schroeder et al., 2007; Tamano et al., 2000). Secretion by the Mxi-Spa
system is triggered after contacting the host cells (Schroeder et al., 2007; Shen et al., 2010).
![Page 35: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/35.jpg)
Introduction
7
1.5.3 Effector proteins secreted by TTSS
Studies suggested that Shigella TTSS delivers two sets of effectors: i) early effectors
including IpaA and IpgD, involved in the entry into the epithelial cells; ii) late effectors
including IpaH family proteins and VirA. The latter enables intracellular survival of the
bacteria, intracellular and cell-to-cell motility; and modulation of the host inflammatory
response (Shen et al., 2010). VP encoded Ipa (invasion plasmid antigen) A-D are dominant
antigens in the humoral immune response against S. flexneri infection (Hale et al., 1985; Oaks
et al., 1986). ipaA-D are present in an operon and IpaA-D proteins are essential for expression
of invasive functions of S. flexneri (Allaoui et al., 1992; Allaoui et al., 1993; Baudry et al.,
1987; Maurelli et al., 1985; Menard et al., 1993; Niebuhr et al., 2000; Sasakawa et al., 1988;
Venkatesan et al., 1988; Venkatesan et al., 1992). IpaB and IpaD colocalise at the TTSS
needle tip and act as a secretion plug (Olive et al., 2007). After secretion IpaB and IpaC form
a pore-like complex in the host cell membrane for bacterial uptake by pinocytosis and
translocation of other effectors. IpaD is essential for the invasion of the bacteria and also
associated with contact-mediated hemolysis of S. flexneri (Picking et al., 2005; Shen et al.,
2010). The other effector proteins secreted by TTSS include: IcsB, VirA, OspG, IpaH, OspF,
and OspC1. IcsB is essential for escaping autophagy (Ogawa et al., 2005), VirA enables the
movement of the bacteria through the dense and organised cytoplasmic network of the host.
Shigella mutants lacking a functional virA gene are unable to move through the cytoplasm,
and the invasiveness of these mutants is attenuated. Hence, VirA is also essential for virulence
of the bacteria (Davis et al., 2008; Yoshida et al., 2002; Yoshida et al., 2006). OspG and IpaH
modulate the inflammatory response of the host (Ashida et al., 2007; Kim et al., 2005; Okuda
et al., 2005). TTSS injects another effector protein IpgD into the epithelial cells, where IpgD
uncouples the plasma membrane from the actin cytoskeleton that allows the formation of
membrane extensions (Niebuhr et al., 2002). OspF and OspC1 have roles in the activation of
mitogen-activated protein kinase or extracellular signal-regulated kinase pathway and
transepithelial migration of PMNs, which is associated with increased inflammation and
bacterial access to the submucosa (Zurawski et al., 2006).
![Page 36: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/36.jpg)
Introduction
8
1.5.4 IcsA protein
Initially, the intercellular motility and protrusion formation of Shigella was microscopically
observed within epithelial monolayers. However, the mechanism behind this movement was
unknown but it was observed that the movement was initiated at one pole (Ogawa et al.,
1968). The genetic basis of this movement was uncovered during transposon mutagenesis of
the VP. Tn5 insertions within an EcoRI - SalI fragment of the VP, termed virG, abolished in
vitro cell-to-cell spreading and the mutants were also avirulent in the Serény test (Makino et
al., 1986). The 1,102 amino acids protein, VirG responsible for this phenotype was identified
(Lett et al., 1989). Contemporaneously, VirG protein was identified as IcsA (intra- and
intercellular spread gene A) by Bernardini et al. (1989) and they were first to report that IcsA-
mediated motility of Shigella is dependent on polymerised host F-actin at one bacterial pole
(Bernardini et al., 1989).
IcsA is an OM protein and is polarly localised on the bacterial surface (Goldberg et al.,
1993). S. flexneri ABM has been studied in a range of model systems, including microscopy
of infected tissue culture monolayers, in vitro Xenopus cell extracts, and protein
reconstitution systems (Egile et al., 1999; Goldberg & Theriot, 1995; Loisel et al., 1999).
ABM and subsequent intercellular spreading are the key features of Shigella virulence. IcsA
mediated ABM can be measured using an in vitro plaque formation assay by measuring the
plaque sizes post S. flexneri invasion of tissue culture monolayers (Oaks et al., 1985). Mutants
lacking IcsA are non-motile (Goldberg & Theriot, 1995). The in vivo way to assess Shigella
virulence known as Serény test is the evaluation of the development of Keratoconjunctivitis
following Shigella infection of guinea pig and mouse eyes (Sereny, 1957; Wood et al., 1986).
Expression of IcsA is an absolute requirement in all these models (Goldberg & Theriot,
1995). Heterologous expression of IcsA in closely related E. coli K-12 confers the ability to
polymerise actin and exhibit ABM in vitro (Goldberg & Theriot, 1995; Kocks et al., 1995;
Monack & Theriot, 2001).
IcsA is a 120 kDa autotransporter protein and has three domains: N-terminal signal
sequence (amino acids 1-52), #-domain (amino acids 53-758), and C-terminal "-domain
(amino acids 759-1102) (Goldberg, 2001; Suzuki et al., 1995). The #-domain is the
functionally active region; C-terminal "-domain anchors the IcsA protein to the OM, exposing
![Page 37: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/37.jpg)
Introduction
9
the N-terminal to the surface (Robbins et al., 2001). An unusually long signal sequence
directs the translocation of the IcsA polypeptide from the cytoplasm to the periplasm via Sec
pathway (Brandon et al., 2003). Formation of an intramolecular disulphide bridge occur in the
IcsA #-domain in the periplasm (Brandon & Goldberg, 2001) and when the "-domain inserts
itself into the OM via a "-barrel assembly machinery complex, the #-domain is exported to
the extracellular environment (Jain & Goldberg, 2007; Suzuki et al., 1995).
Two regions of IcsA (amino acids 1-104 and 506-620) in the #-domain have been
identified as responsible for the polar localisation of the protein (Charles et al., 2001) and
again insertion mutation at amino acids 532 and 563 of the #-domain affected IcsA polar
localisation and further supported the role of amino acids 506-620 of IcsA in polar
localisation (May & Morona, 2008). YidC a cytoplasmic chaperone protein was shown to
assist IcsA to localise at the pole (Gray et al., 2014) and FtsQ, a protein important for
bacterial cell division also facilitate IcsA polar localisation (Fixen et al., 2012). Shigella IcsP
protease releases ~95 KDa #-domain of IcsA by cleaving the protein at amino acids 758 and
759 (Egile et al., 1997; Shere et al., 1997; Steinhauer et al., 1999) and IcsP contributes to the
unipolar localisation of IcsA (Tran et al., 2013).
Intercellular movement of the bacteria is dependent on polarised actin polymerisation and
when concentrated at one pole the bacteria forms the F actin tail and resulted in unidirectional
propulsion (Cossart, 2000; Robbins et al., 2001). The #-domain stimulates actin assembly and
interacts with the host actin regulatory factor neural Wiskott-Aldrich syndrome protein (N-
WASP). IcsA has three N-WASP interacting regions: Region 1 (amino acids 185-312),
Region 2 (amino acids 330-382), and Region 3 (amino acids 508-730) (Teh et al., 2012; Teh
& Morona, 2013). Interaction of IcsA with N-WASP allows recruitment of Arp2/3 complex
leading to F-actin comet tail formation in mammalian cells (Egile et al., 1999; May &
Morona, 2008; Suzuki et al., 1995; Suzuki et al., 1996; Suzuki et al., 1998; Teh & Morona,
2013).
1.6 Lipopolysaccharide (LPS)
Gram-negative bacteria have an asymmetric OM and the inner leaflet of the OM is composed
![Page 38: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/38.jpg)
Introduction
10
of phospholipid and the outer leaflet is comprised of lipopolysaccharide (LPS) (Dong et al.,
2014; Raetz & Whitfield, 2002; Ruiz et al., 2009). LPS is a complex lipid and forms the
protective barrier of the Gram-negative bacteria (Sperandeo et al., 2009).
1.6.1 Morphology
LPS has three domains: Lipid A, Core sugars, and Oag. The LPS structures (Fig. 1.2) of S.
flexneri can be divided into three types: Smooth LPS (S-LPS), Rough LPS (R-LPS), and
Semi-Rough LPS (SR-LPS). S-LPS is the complete LPS structure with an Oag chain length of
11 to 17 Oag tetrasaccharide repeat units (RUs). The wild type (WT) S. flexneri contains S-
LPS. The LPS structure lacking the Oag is termed R-LPS. SR-LPS contains a single Oag
tetrasaccharide RU attached to the Lipid A and core sugar (Bone, 1993; Morona et al., 1994;
Naide et al., 1965).
1.6.1.1 Lipid A
Lipid A anchors LPS in the OM through hydrophobic interactions involving fatty acids,
including laurate and myristate. It is the most highly conserved domain of the Gram-negative
bacterial LPS. Lipid A is also known as ‘endotoxin’ as it has many effects to the mammalian
system during sepsis. The innate immune response to lipid A results in cytokine production
(Bone, 1993; Muller et al., 1993; Raetz, 1993; Ranallo et al., 2010; Yethon & Whitfield,
2001). Chemically lipid A, is an ester linked di-glucosamine with both ester and amide-linked
pyrophosphates and fatty acids (Bone, 1993). S. flexneri lipid A has the beta (1-6)-linked
glucosamine disaccharide with two phosphate groups (Fig. 1.3). Both E. coli and S. flexneri
Lipid A are glucosamine disaccharide modified by six acyl chains and the fatty acid
composition and acylation are also similar. The fatty acid acylation occurs by four (R)-3-
hydroxy fatty acids at the positions O-2, O-3, O-2', and O-3' (Lindberg et al., 1991).
![Page 39: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/39.jpg)
Introduction
11
Figure 1.2 LPS structural types S-LPS contains Lipid A, Core sugar, and Oag RUs; SR-LPS contains Lipid A, Core sugar,
and single Oag unit; and R-LPS contains Lipid A and Core sugar. n = number of Oag RUs.
![Page 40: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/40.jpg)
Introduction
12
Figure 1.3 S. flexneri Lipid A structure S. flexneri lipid A has the beta (1-6)-linked glucosamine disaccharide with two phosphate
groups. The fatty acid acylation occurs by four (R)-3-hydroxy fatty acids at the positions O-2,
O-3, O-2', and O-3'. The numbers in the circle indicate the number of the carbon atoms
present in the fatty acids. Figure adapted from D'Hauteville et al. (2002).
![Page 41: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/41.jpg)
Introduction
13
1.6.1.2 Core sugar
The 6' position of lipid A is glycosylated with a non-repeating oligosaccharide structure,
known as the core sugar. It is negatively charged LPS domain and forms intermolecular
cationic bridging to strengthen the rigidity of the cell wall (Knirel et al., 2011). LPS core
sugar region is divided into inner core and outer core. The inner core of most of the Gram-
negative bacteria possesses the eight-carbon sugar 3-deoxy-D-manno-oct-2-ulosonic acid
(Kdo). This Kdo unit links the core sugar region to the lipid A. In some LPS structures, L-
glycero-D-manno-heptose (Hep) residues are found to be linked to the Kdo in the inner core
region. In Enterobacteria the inner core has a common structure, either Kdo + 3Hep or Kdo +
3Hep + glucosamine (GlcN) (Kubler-Kielb et al., 2010; Raetz, 1990; Raetz & Whitfield,
2002; Yethon & Whitfield, 2001). S. flexneri has 2 residues of Kdo and 3 residues of Hep in
the inner core region (Knirel et al., 2011) (Fig. 1.4). The distal sugar region of the core is
known as outer core. The outer core is composed of glucose (Glc), galactose (Gal), and N-
acetylglucosamine (GlcNAc) residues and to which the Oag RU is attached (Kubler-Kielb et
al., 2010; Raetz, 1990; Raetz & Whitfield, 2002; Yethon & Whitfield, 2001). S. flexneri 2a
has the R3 type of LPS core (Kubler-Kielb et al., 2010) (Fig. 1.4).
1.6.1.3 O antigen (Oag)
Oag is the most variable domain of the Gram-negative bacterial LPS (Yethon & Whitfield,
2001). The presence of Oag S-LPS restricts the accessibility of colicins to their OM receptors
(van der Ley et al., 1986). Oag also acts as the attachment site of the bacteriophages. Other
than the serotype conversion, bacteriophages use Oag as a receptor for adsorption and
infection of the host bacterium (Lindberg et al., 1978). Oag consists of oligosaccharide RUs.
Differences in the sugar contents, linkage between sugar units, and number of sugar units
make this domain highly variable (Liu et al., 2008; Wang et al., 2010a). The Gram-negative
bacterial species are subdivided into various serotypes depending on the differences in the
composition of LPS-Oag (Wang et al., 2010a). So far, there are 19 known serotypes [1a, 1b,
1c (or 7a), 1d, 2a, 2b, 3a, 3b, 4a, 4av, 4b, 5a, 5b, 6, 7b, X, Xv, Y, and Yv] of S. flexneri
![Page 42: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/42.jpg)
Introduction
14
Figure 1.4 S. flexneri 2a core The core region is composed of Kdo, Hep, Glc, Gal, and GlcNAc. The inner core is composed
of Kdo + 3Hep and the outer core is composed of Glc, Gal, and GlcNAc. Outer core is
attached to the Oag RU. Oag chain is attached to the O-4 of Glc. n = number of Oag RU.
Figure adapted from Kondakova et al. (2010).
![Page 43: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/43.jpg)
Introduction
15
(Jakhetia et al., 2014; Sun et al., 2013a; Sun et al., 2014). Except the S. flexneri serotype 6,
the Oag of all other serotypes has the same polysaccharide backbone containing three L-
rhamnoses (Rha), and one GlcNAc (Fig. 1.5). This basic Oag structure is known as serotype
Y. In serotype Y, the Rha residues are linked by # linkage, and Rha and GlcNAc residues are
linked by " linkage [!2)-#-L-RhaIII-(1!2)-#-L-RhaII-(1!3)-#-L-RhaI-(1!3)-"-D-
GlcNAc(1!]. Addition of either glucosyl, O-acetyl, or phosphoethanolamine (PEtN) groups
by various linkages to the sugars within the tetrasaccharide repeats of serotype Y creates
different serotypes of S. flexneri (Adams et al., 2001; Allison & Verma, 2000; Jakhetia et al.,
2014; Sun et al., 2013b) (Fig. 1.5).
The genes responsible for the Oag glucosylation [gtrA, gtrB, and gtr (type)] are
arranged in a single operon (gtr cluster). Among them gtrA and gtrB are conserved, however,
gtr (type) is unique and the encoded glucosyltransferase attaches the glucosyl group to the
specific sugar in the tetrasaccharide RU (Adams et al., 2001; Adhikari et al., 1999; Allison &
Verma, 2000; Allison et al., 2002; Guan et al., 1999; Mavris et al., 1997; Stagg et al., 2009).
Presence of the oac gene for O-acetyl transferase resulted in the O-acetylation of Oag (Clark
et al., 1991; Verma et al., 1991). There is an association between bacteriophages and serotype
conversion in S. flexneri. Seven bacteriophages or prophages encode the genes known so far
for Oag modifications, among them six (SfI, SfIC, SfII, SfIV, SfV, and SfX) encode gtr gene
cluster and one (Sf6) encodes oac gene. These genes are integrated into the conserved sites of
the S. flexneri genome (Adams et al., 2001; Adhikari et al., 1999; Allison et al., 2002;
Casjens et al., 2004; Clark et al., 1991; Guan et al., 1999; Mavris et al., 1997; Stagg et al.,
2009). Glucosylation can occur on any of the residues of the basic tetrasaccharide RU but oac
mediated O-acetylation occurs at position 2 of Rha I (Jakhetia et al., 2014). Although the
glucosylation and O-acetylation are phage encoded, the PEtN modification at position 3 of
Rha II and/or Rha III is encoded by the plasmid borne opt gene (Jakhetia et al., 2014).
For S. flexneri serotypes 1b, 3a, 3b, 3c, 4b, and 7b the O-acetylation site is position 2
of Rha I (Perepelov et al., 2012). However, a new O-acetylation site have been reported:
position 3 (major) and 4 (minor) of Rha III (3/4-O-acetylation) in serotypes 1a, 1b, 2a, 5a, Y,
6 and 6a, and at position 6 of GlcNAc in serotypes 2a, 3a, and Y. The degree of 3/4-O-
![Page 44: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/44.jpg)
Introduction
16
Figure 1.5 Chemical composition of the Oag of different S. flexneri serotypes Serotype Y has the basic Oag, consisting of repeated tetrasaccharide units of !2)-#-L-RhaIII-
(1!2)-#-L-RhaII-(1!3)-#-L-RhaI-(1!3)-"-D-GlcNAc(1!. Addition of either glucosyl, O-
acetyl, or phosphoethanolamine groups to the sugar residues within the tetrasaccharide RU via
the indicated linkages generate different serotypes. Figure adapted from (Allison & Verma,
2000; Sun et al., 2012; Sun et al., 2014).
![Page 45: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/45.jpg)
Introduction
17
acetylation varies between the ranges 30-70% at position 3 and 15-30% at position 4 within
the strains of one serotype (Jakhetia et al., 2014; Perepelov et al., 2012). According to recent
study S. flexneri 3/4-O-acetylation is mediated by the oacB gene carried by a transposon-like
structure located upstream of the adrA gene on the chromosome (Wang et al., 2014). The
temperate bacteriophages SfII, Sf6, SfV, and SfX convert the basic serotype Y to serotypes
2a, 3b, 5a, and X, respectively (Allison & Verma, 2000). Lysogenic bacteriophage SfII adds a
glucose residue to the Rha III residue of the tetrasaccharide RU of S. flexneri Oag and confers
serotype II Oag modification (Mavris et al., 1997). Recently, a new bacteriophage Sf101 was
isolated from serotype 7a. It contains the oac gene and responsible for the O-acetyl
modification in serotype 7a (Jakhetia et al., 2014). Serotype converting temparate
bacteriophage SfV adds a glucosyl group to Rha II of the tetrasaccharide RU by an # 1,3
linkage (Allison et al., 2002). A newly emerged and most prevalent serotype in China is
serotype Xv. For serotype Xv the Oag modification occurs by the addition of PEtN group at
position 3 of one of the Rha residues (Sun et al., 2012) (Fig. 1.5). PEtN modification is also
present in 4av, a serotype 4a variant; and Yv, a serotype Y variant. In these serotypes a PEtN
residue is added mainly to Rha III and Rha II, respectively (Sun et al., 2013a).
The antigenic structure of S. flexneri is simple. S. flexneri possesses somatic Oags and
certain varieties possess K antigen. Determination of S. flexneri group is done by
agglutination with polyvalent serum and the type diagnosis is performed by a monospecific
serum obtained after absorption of the group agglutinins. Certain varieties of S. flexneri
serotype 6 are O-inagglutinable as they have K antigen (Bergey & Breed, 1957). The basic
Oag structure serotype Y is characterised by a single group 3,4 antigenic determinant. Oag
glucosylation and/or O-acetylation result in different type [I, II, III, IV, V, IC (or VIII)] and
group (3,4; 6; 7,8) antigenic determinants (Sun et al., 2012; Sun et al., 2013a) (Table 1.1).
Group 6 antigenic determinant is present in serotypes 3a, 3b, 1b, 4b, and 7b and they are
characterised by the presence of O-acetylation on Rha I. Type I, IC (or VII), II, IV, V; and
group 7,8 determinants are associated with Oag glucosylation (Sun et al., 2012; Sun et al.,
2013a). Serotypes X and Y lack type antigens but group antigens are 7,8; and 3,4;
respectively (Simmons & Romanowska, 1987). Serotype Xv can agglutinate with both MASF
IV-I and 7,8 monoclonal antibodies (Sun et al., 2012).
![Page 46: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/46.jpg)
Introduction
18
Table 1.1 Antigenic determinants of various S. flexneri serotypes
Serotypes Type antigen Group antigen
1a I 4
1b I 6 1c (7a) - MASF 1c
1d I 7,8 2a II 3,4
2b II 7,8 3a III 6,7,8
3b III 6,3,4 4a IV 3,4
4av IV 3,4 4b IV 6
5a V 3,4 5b V 7,8
6 VI 2,4 7b - 6
X - 7,8 Xv IV 7,8
Y - 3,4 Yv IV 3,4
![Page 47: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/47.jpg)
Introduction
19
1.6.2 LPS as a virulence factor
LPS is the immunodominant surface antigen of S. flexneri. As a surface structure it interacts
with the host and the host defense systems recognise bacteria by the elicited immune
responses to their LPS. However, inside the host LPS causes a variety of non-specific
pathological reactions, known as endotoxic reactions (Lindberg et al., 1991). The LPS
morphology of S. flexneri has a critical role in the virulence property of the bacteria (Hong &
Payne, 1997; Van den Bosch et al., 1997). An assay to measure the ability of Shigella to
invade epithelial cells, spread intercellularly, and evoke inflammatory responses is known as
the Serény test (Sereny, 1957) and previous studies showed that S. flexneri with R-LPS were
avirulent in Serény test. Strains with R-LPS could invade the tissue-culture cells but were
unable to spread intercellularly (Okamura & Nakaya, 1977; Okamura et al., 1983). S. flexenri
strains with R-LPS were also deficient in plaque formation in tissue culture monolayer, with
very small or no plaques being observed (Hong & Payne, 1997; Sandlin et al., 1995; Van den
Bosch et al., 1997; Van den Bosch & Morona, 2003).
S-LPS with very long Oag chains gives S. flexneri protection against serum killing
(Hong & Payne, 1997). LPS also plays a role in the physiological relationship between host
and the bacteria. B cells differentiate, proliferate, and secrete immunoglobulins due to the
polyclonal activation by LPS. LPS activates macrophages which enhances cytotoxicity and
phagocytosis (Lindberg et al., 1991).
A number of genes involved in the synthesis of LPS were found important for the
virulence property of Shigella spp. (Okada et al., 1991a; Okada et al., 1991b). Several studies
through mutagenesis of genes involved in the LPS biosynthesis (galU, rfe, rfb, rmlD, wecA,
wzy, and wzz) showed that the S-LPS is essential for IcsA dependent ABM and cell-to-cell
spreading (Hong & Payne, 1997; Rajakumar et al., 1994; Sandlin et al., 1995; Van den Bosch
et al., 1997; Van den Bosch & Morona, 2003). In Shigella S-LPS strains, IcsA is unipolar
however, in R-LPS strains the unipolarity is lost and IcsA can be detected over the entire
bacterial surface (Robbins et al., 2001; Van den Bosch et al., 1997). There are two proposed
hypotheses for this loss of polarity in R-LPS strains. Robbins et al. (2001) proposed that the
biophysical properties of the OM can be altered due to the mutation in the LPS biosynthesis
genes of R-LPS strains, resulting in the increased migration of IcsA from pole to the non-
![Page 48: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/48.jpg)
Introduction
20
polar sites (Robbins et al., 2001). However, according to the other hypothesis, presence of
LPS Oags masks IcsA expression in the non-polar regions and mutants lacking Oag alter
detection of IcsA at non-polar regions in addition to the pole (Morona & Van Den Bosch,
2003a; Morona & Van Den Bosch, 2003b). Although the loss of unipolarity of IcsA is
considered the cause behind the impaired ABM but the overexpression of IcsA in the S-LPS
strains resulted in circumferential localisation of IcsA similar to the R-LPS strains and ABM
was undisturbed (Van den Bosch & Morona, 2003). Hence, LPS Oag may have other critical
roles in S. flexneri cell to cell spreading.
Lipid A is the bioactive component of LPS and the activator of the innate immune
response in host. Several previous studies suggested that the changes in lipid A acylation
effect the virulence property of the bacteria by influencing protein secretion of TTSS, cell
division, and OM function (Clements et al., 2007; Murray et al., 2001; Post et al., 2003;
Ranallo et al., 2010; Somerville et al., 1999; Watson et al., 2000). D’Hauteville et al. (2002)
investigated the effect of genetic detoxification of lipid A on the S. flexneri pathogenicity. S.
flexneri has two types of msbB genes: one chromosomal (msbB1) and another on the VP
(msbB2); both encode myristoyl transferase. They showed that in S. flexneri, lacking both the
msbB genes had reduced lipid A acylation degree, and caused reduced TNF# production and
epithelial lining inflammatory destruction of a rabbit model (D'Hauteville et al., 2002).
Ranallo et al. (2010) performed an extensive study to analyse the virulence property and
inflammatory potential of the S. flexneri 2a lacking both msbB genes and producing
underacylated lipid A. Attenuation of msbB mutants in an acute mouse pulmonary challenge
model correlated with decreases in proinflammatory cytokine production and in chemokine
release without noticeable changes in lung histopathology. After infection of mouse
macrophages with either single or double msbB mutants, production levels of IL-1", MIP-1#,
and TNF-# were also significantly reduced. The msbB double mutant showed defects in the
invasion and replication ability, and spreading within the epithelial cells. They also performed
a vaccination-challenge study in a mouse lung model and found that in msbB-immunised mice
both humoral and cellular responses were significantly strong (Ranallo et al., 2010). Paciello
et al. (2013) reported that Shigella has the ability to modify the composition of the lipid A and
core sugar domains, during proliferation within epithelial cells. They showed that the lipid A
![Page 49: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/49.jpg)
Introduction
21
of the LPS of intracellular bacteria is hypoacylated compared to the LPS of the bacteria grown
in laboratory medium and the immunopotential of intracellular bacterial LPS is dramatically
lower than that of the LPS of the bacteria grown in laboratory medium (Paciello et al., 2013).
Rossi et al. (2014) produced generalised modules for membrane antigens (GMMA) from
Shigella. GMMA is produced from the OM and mainly contains LPS. To reduce the
reactogenicity of GMMA they modified the Lipid A by deleting the msbB genes. GMMA
with penta-acylated Lipid A from the msbB mutant strains had 600 fold reduced activity
however, GMMA with hexa-acylated Lipid A resulted by lipid A palmitoleoylation had ~10
fold higher activity to stimulate peripheral blood mononuclear cells (Rossi et al., 2014).
S. flexneri waaJ, waaD, and waaL mutant strains are unable to synthesise inner core or
are deficient in ligating Oag to the outer core, were attenuated and failed to resist killing by
antimicrobial peptides expressed in the GI tract (Cunliffe & Mahida, 2004; West et al., 2005).
The rfbA mutant deficient in converting glucose-1-phosphate to deoxythymidine diphosphate
rhamnose (dTDP-Rha) a required step for Oag biosynthesis and the cld mutant having
truncated Oag were also attenuated (West et al., 2005). gtrV gene encodes glucosyltransferase
which adds glucose to the Oag (Guan et al., 1999). West et al. (2005) reported that Shigella
strains with gtrV deletion mutation were unable to survive in the GI tract. Their work also
suggested that LPS glucosylation allows the bacteria to survive in vivo. The gtr mutants were
unable to avoid innate immune killing but the non-invasive S. flexneri with gtr mutation,
which lacks TTSS, did not show any survival disadvantage. Hence, the effect of gtr deletion
only results after invasion into the mucosa (West et al., 2005). Shigella strains with increased
Oag glucosylation has increased ability to invade epithelial cells however, the gtr mutant
strains has decreased ability of epithelial invasion compared to the WT. LPS glucosylation
affects the TTSS function which determines cell invasion (West et al., 2005).
Following Shigella WT infection and experimental challenge strong mucosal secretory
IgA anti-Oag antibody responses are observed (Levine et al., 2007). The Oag of the LPS is
the protective antigen. After S. flexneri infection the host immune response is directed against
the Oag and the immune response is serotype specific correlated with the stimulation of local
humoral and intestinal immunity against somatic antigens. The serotype specific infection
provides protection against further infection with the same serotype (Allison & Verma, 2000;
![Page 50: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/50.jpg)
Introduction
22
Brahmbhatt et al., 1992; Formal et al., 1991; Guan & Verma, 1998; Hale & Keren, 1992;
Lindberg & Pal, 1993). In an animal experiment conducted by Formal et al. (1991), virulent S.
flexneri 2a strain was used to infect Rhesus monkeys and later the infected monkeys were
rechallenged with either S. sonnei or S. flexneri 2a strains. Monkeys rechallenged with S.
sonnei suffered disease similar to the controls, however, monkeys rechallenged with
homologous S. flexneri 2a got full protection (Formal et al., 1991). In humans, it was also
found that pre-existing serotype-specific serum antibodies against the Shigella Oag is
correlated with the resistance to homologous shigellosis (Cohen et al., 1988).
1.7 LPS biosynthesis and export
In E. coli, Shigella, and Salmonella LPS biosynthesis and export are dependent on the
products of approximately 50 genes (Schnaitman & Klena, 1993). LPS biosynthesis occurs
mainly by two separate pathways: lipid A plus core biosynthesis and Oag biosynthesis. Other
than the membrane bound enzymes for glycerophospholipids synthesis, the enzymes required
for the early stage of lipid A biosynthesis are cytoplasmic or present in the cytoplasmic
membrane (Anderson et al., 1993). In the cytoplasm after synthesis of the lipid A, the core
oligosaccharides are assembled on the lipid A. At the cytoplasmic face of the IM the Oag RUs
are assembled on Und-PP (Marino et al., 1991; Mulford & Osborn, 1983). The lipd A-core
and Oag RUs are then transported from the cytoplasmic side to the periplasmic side. The
Und-PP linked Oag RUs are polymerised into Oag chains on the periplasmic face of the
cytoplasmic membrane. The Und-P is recycled. The lipid A-core and Oag chains are ligated
(Kanegasaki & Wright, 1973; McGrath & Osborn, 1991; Mulford & Osborn, 1983;
Woodward et al., 2010). Once assembled the LPS is exported from the IM across the
periplasm, and assembled into the outer leaflet of the OM of the Gram-negative bacteria
(Sperandeo et al., 2009).
![Page 51: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/51.jpg)
Introduction
23
1.7.1 Lipid A and core biosynthesis
Lipid A synthesis in many Gram-negative bacteria resembles the one found in E. coli (Raetz
& Whitfield, 2002). Both E. coli and S. flexneri lipid A is a glucosamine disaccharide with six
acyl chains: primary acyl chains at the 2, 3, 2’ and 3’ positions and secondary acyl chains
attached to the 2’ and 3’ primary chains (Goldman et al., 2008). In E. coli and Salmonella
typhimurium Lipid A synthesis is initiated by uridine diphosphate GlcNAc acetyltransferase
(UDP-GlcNAc acetyltransferase) LpxA. This enzyme fatty acetylates the sugar nucleotide
UDP-GlcNAc. It transfers the acyl group from R-3-hydroxymyristoyl-acyl carrier protein (R-
3-hydroxymyristoyl-ACP) to UDP-GlcNAc to form UDP-3-O-(R-3-hydroxymystristoyl)-
GlcNAc (Anderson & Raetz, 1987; Galloway & Raetz, 1990; Meier-Dieter et al., 1992;
Stevenson et al., 1994; Wyckoff et al., 1998). The following steps of Lipid A biosynthesis are
mediated by the enzymes LpxC and LpxD. LpxC deacetylates the O-acetylated UDP-GlcNAc
and LpxD performs the second deacetylation. LpxD transfers a second acyl group from R-3-
hydroxymyristoyl-ACP to O-acetylated UDP-GlcNAc and forms UDP-2,3-diacylglucosamine
(Crowell et al., 1987; Raetz et al., 2007). UDP-2,3-diacylglucosamine is the immediate
precursor of non-reducing sugar of Lipid A. Some of the UDP-2,3-diacylglucosamine is
cleaved at the phosphate bond by LpxH to generate diacylglucosamine-1-phosphate or Lipid
X (Anderson et al., 1985; Raetz et al., 2007). It is the direct precursor of the reducing sugar of
Lipid A. LpxB mediates the condensation of another molecule of UDP-2,3-diacylglucosamine
with Lipid X to form the disaccharide and releases UDP. Phosphorylation of the disaccharide
formed by LpxB generates Lipid IVA (Raetz & Whitfield, 2002). In S. flexneri two Kdo
residues are then transferred by a bifunctional transferase to form keto-doxy-octonate 2 lipid
A (D'Hauteville et al., 2002). At the final steps of S. flexneri Lipid A synthesis 12-carbon
fatty acid laurate and the 14-carbon fatty acid myristate are acyl-oxyacyl-linked to two of the
four 3-OH-myristic acids available on keto-doxy-octonate 2 lipid A. htrB encodes the
transferase (LpxL or HtrB) that catalyses the acyl-oxyacyl linkage of laurate to the 3’
hydroxymyristate that is itself linked to the 2’ position of the glucosamine and msbB encodes
the transferase MsbB (LpxM) that catalyses the acyl-oxyacyl linkage of myristate on the
hydroxy-myristate that is itself linked to the 3’ position of the glucosamine disaccharide
(D'Hauteville et al., 2002; Goldman et al., 2008).
![Page 52: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/52.jpg)
Introduction
24
Genes of the chromosomal waa locus including waaF, waaC, waaL, waaD, waaJ,
waaY, waaI, waaP, waaG, waaQ, and waaA encodes the proteins for E. coli R3 type core
sugar synthesis (Kaniuk et al., 2004) (Fig. 1.6). The product of the waaA, WaaA catalyses the
synthesis of inner core. It transfers the first two Kdo residues of the core. (Kaniuk et al., 2004;
Sirisena et al., 1994; Vimont et al., 1997). WaaC and WaaF are the first and second
heptosyltransferases. Inner core assembly phosphate transferases are WaaP and WaaY. WaaP
trasfers phosphate to heptose I and WaaY to heptose II. WaaQ transfers heptose III to heptose
II (Kaniuk et al., 2004; Muhlradt, 1969; Sirisena et al., 1992; Yethon et al., 1998). Initially
WaaG, an UDP-glucosyl transferase, attaches the first Glc to heptose II, WaaI attaches a Gal
unit to the first Glc, and then WaaJ adds a second Glc to the Gal (Heinrichs et al., 1998;
Kaniuk et al., 2004). WaaD an #-1,2-glucosyltransferase responsible for addition of the
terminal glucose side branch (Kaniuk et al., 2004).
1.7.2 O antigen biosynthesis
The Oag synthesis genes are generally found in a single cluster, named Oag gene cluster.
Three main types of genes are found in this Oag gene cluster: nucleotide sugar synthesis,
sugar transferase, and O unit processing genes. The location of these genes within a species is
conserved (Wang et al., 2010a). Oag assembly and processing are performed by three
different pathways: Wzx/Wzy, ABC transporter, and Synthetase pathway. Among these three
pathways, the Wzx/Wzy pathway synthesises most Oags (Liu et al., 1996; Raetz & Whitfield,
2002; Wang et al., 2010a).
For all the three pathways, initially a sugar phosphate is transferred from an NDP-
sugar to Und-P at the cytoplasmic side of the IM. In the Wzx/Wzy pathway,
glycosyltransferases sequentially add sugar residues to the first sugar at the cytoplasmic side
of the IM to form the O unit. The flippase protein Wzx translocates this O unit to the
periplasmic side. At the periplasmic side the O units are polymerised at the non-reducing end
by Wzy via a block transfer mechanism to form the polymer. The chain length of the final
Oag is regulated by the protein Wzz (Wang et al., 2010a; Whitfield, 2006; Woodward et al.,
2010).
![Page 53: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/53.jpg)
Introduction
25
Figure 1.6 Synthesis of R3 type LPS core sugar S. flexneri has R3 type LPS core sugar. The known enzymes responsible for the synthesis of
R3 core sugar are shown. Enzymes WaaA, WaaC, WaaF, WaaY, WaaQ, WaaP, and WabB
synthesise inner core region; and WaaG, WaaI, WaaJ, and WaaD are responsible for the
synthesis of outer core region (Kaniuk et al., 2004).
![Page 54: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/54.jpg)
Introduction
26
S. flexneri follows the Wzy-dependent pathway for Oag biosynthesis. In S. flexneri
most of the Oag biosynthesis genes (except wecA) are located in the Oag biosynthesis locus
between galF and his (previously known as rfb locus) (Allison & Verma, 2000; Morona et al.,
1995) (Fig. 1.7) and the coding region for Oag biosynthesis genes is ~11 kb (Macpherson et
al., 1991). Initially, GlcNAc-phosphate (GlcNAc-1-P) is transferred from an UDP-GlcNAc to
undecaprenol phosphate (Und-P) at the cytoplasmic side of the IM by WecA. Then the
rhamnosyl transferases RfbG and RfbF add Rha residues from dTDP-Rha to the GlcNAc
(Macpherson et al., 1994; Morona et al., 1994) to form the O unit. Then rest of the proteins of
the Wzx/Wzy pathway (Wzx, Wzy, Wzz, and WaaL) complete the Oag biosynthesis (Fig.
1.8).
In the ABC transporter pathway the complete Oag chain is synthesised on the
cytoplasmic side of the IM, and the ABC transporter proteins Wzm and Wzt translocate the
Oag chain. This pathway has been described for the Oags of Klebsiella pneumoniae, Vibrio
cholerae, Yersinia enterocolitica, A-band Oag of Pseudomonas. aeruginosa, and also for the
Oags of E. coli O8, O9, O9a, O52, and O99 (Wang et al., 2010a). The Synthetase pathway is
very rare with S. enterica O54 the only known case for Oag synthesis by Synthetase pathway.
A single integral protein performs the whole Oag synthesis process and the Oag chain is
homopolymers or having two sugars (Raetz & Whitfield, 2002; Wang et al., 2010a). For all of
the three pathways, Oag ligase WaaL then ligates the Oag chains to the core-lipid A. The
complete LPS is then translocated to the OM of the bacterial cell (Whitfield & Trent, 2014).
1.7.3 LPS export
The first step of LPS export is the flipping of the LPS across the IM. The ABC transporter IM
protein MsbA translocates the R-LPS (lipid A-core) across the IM. In Oag producing strains,
the Oag is then ligated to the lipid A-core by WaaL ligase. The Lpt (LPS transport) proteins
(LptA-G) transport the LPS from the IM to the cell surface (Chng et al., 2010; Ruiz et al.,
2009; Sperandeo et al., 2009).
![Page 55: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/55.jpg)
Introduction
27
Figure 1.7 Organisation of S. flexneri Oag biosynthesis genes S. flexneri Oag biosynthesis genes (except wecA) are located in the Oag biosynthesis locus
between galF and his. The direction of transcription is indicated by horizontal red arrows.
Figure adapted from Morona et al. (1995).
![Page 56: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/56.jpg)
Introduction
28
Figure 1.8 S. flexneri Y serotype Oag biosynthesis S. flexneri Oag biosynthesis occurs on either side of the IM. Initially, GlcNAc-1-P is
transferred from an UDP-GlcNAc to Und-P at the cytoplasmic side of the IM by WecA. Then
the rhamnosyl transferases add Rha residues to the GlcNAc to form the O unit. Wzx
translocates this O unit to the periplasmic side. At the periplasmic side the O units are
polymerised by Wzy and the chain length of the final Oag is regulated by the protein Wzz.
WaaL then ligates the Oag chains to the core-lipid A.
![Page 57: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/57.jpg)
Introduction
29
Recent structural studies have disclosed the molecular mechanism of LPS transport of
the Gram-negative bacteria (Bishop, 2014; Dong et al., 2014; Qiao et al., 2014). ABC
transporter complex made of LptF, LptG, and LptB separates the LPS from the external
leaflet of the IM and takes the LPS through a filament (made of LptA and LptC) which
connects IM and OM. Then the LPS is delivered to a complex made of LptD and LptE in the
OM and this complex inserts the LPS into the outer leaflet of the OM. The X-ray crystal
structure of the LptD and LPtE complex from S. flexneri and Salmonella typhimurium showed
that LptD is made of "-strands that fold into two domains: a "-jellyroll and a "-barrel. The "-
jellyroll is away from the OM and contains a greasy groove that is able to bind Lipid A
leaving the core and Oag chain exposed. A similar "-jellyroll fold was found for LptA and
LptC. These proteins interconnect and combine the greasy "-jellyroll fold to make a passage
through the space between IM and OM. LptD forms a 26 stranded "-barrel in which the LptE
forms a roll-like structure. The hydrophilic sugar chains (core and Oag) pass through the
barrel and the Lipid A inserts into the external leaflet of the OM through a lateral opening of
the LptD between "1 and "26 (Bishop, 2014; Dong et al., 2014; Qiao et al., 2014; Whitfield
& Trent, 2014).
1.8 Oag polymerisation protein Wzy
The evidence of Oag polymerisation occurring in the periplasm was detected by McGrath and
Osborn (1991) by pulse-chase experiments using doubly conditional mutants. The Wzy-
dependent pathway is one of the most widely distributed polysaccharide biosynthesis pathway
in the nature. In Wzy homologues, there are 4-5 periplasmic loops (PLs), the larger PLs are on
the periplasmic side, and the number of transmembrane segments (TMs) vary from 10-14
(Daniels et al., 1998; Islam et al., 2010; Kim et al., 2010; Marczak et al., 2013; Mazur et al.,
2003; Zhao et al., 2014). So far there is no known X-ray crystal structure for Wzy
homologues and topology models only exist for Wzy proteins of S. flexneri (Daniels et al.,
1998), Pseudomonas aeruginosa PAO1 (Islam et al., 2010); and PssT (Wzy homologue) of
Rhizobium leguminosarum bv. trifolii strain TA1 (Mazur et al., 2003).
![Page 58: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/58.jpg)
Introduction
30
1.8.1 S. flexneri Wzy (WzySf)
The Oag polymerisation protein Wzy is encoded by the rfc/wzy gene (Macpherson et al.,
1991) (Fig. 1.7); and Morona et al. (1994) for the first time characterised S. flexneri wzy gene
(wzySf) which spans a ~2 kb region. The wzy open reading frame is located downstream of
Oag gene cluster. WT wzySf lacks detectable ribosome binding site and has four rare codons
(at positions 4, 9, 22, and 23) in the translation initiation site. The wzySf coding region has a
low G+C % and has high percentage of minor codons in the first 25 amino acids. S. flexneri
Wzy protein (WzySf) is a 43.7 kDa hydrophobic integral membrane protein (Daniels et al.,
1998; Morona et al., 1994). Daniels et al. (1998) for the first time was able to express and
visualise WzySf, and they showed by western immunoblotting using anti::PhoA serum that
WzySf::PhoA fusion protein was able to form a dimer. Based on the topological model
proposed by Daniels et al. (1998), WzySf has 12 TMs, two large PLs - PL3 and PL5; and the
amino and carboxy terminal ends are located on the cytoplasmic side of the IM (Fig. 1.9).
wzySf mutants produce SR-LPS (Morona et al., 1994). They are avirulent in Serény test and
unable to produce plaque on tissue culture cells, and have IcsA distributed over the entire cell
surface (Sandlin et al., 1996).
1.8.2 Wzy proteins of different bacterial species
Wzy proteins have extremely low detectability in cells (Abeyrathne & Lam, 2007; Collins &
Hackett, 1991). Optimising conditions for overexpression and purification of Wzy is a
laborious and time-consuming process due to the hydrophobic and transmembrane nature of
the protein, presence of rare codons in the 5’ regions, and weak ribosomal binding site (Kim
et al., 2010; Wong et al., 1999). So far, limited work has been conducted on biochemical and
functional characterisation of Wzy proteins of different bacterial species. Kim et al. (2010)
performed site-directed mutagenesis on the Francisella tularensis LVS wzy (wzyFt) and found
that modifications of the residues G176, D177, G323, and Y324 resulted in loss of Oag
![Page 59: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/59.jpg)
Introduction
31
Figure 1.9 S. flexneri Wzy (WzySf)
WzySf is an integral membrane protein. It has 12 TMs and two large PLs (PL3 and PL5). The
positions of the PLs (PL1-6) and TMs (TM1-12), and cytoplasmic loops (CL) (CL1-5) are
indicated. WzySf topology map is adapted from Daniels et al. (1998).
![Page 60: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/60.jpg)
Introduction
32
polymerisation by F. tularensis Wzy (WzyFt). Comparing amino acid sequences and predicted
theoretical topology models by TMHMM server of the Oag polymerase of different bacterial
species, and the previously determined Shigella flexneri topology model by Daniels et al.
(1998), they found that these amino acids are in close proximity on the bacterial surface (Kim
et al., 2010). Woodward et al. (2010) for the first time were able to purify a Wzy protein,
from E. coli O86 (WzyEc), and suggested that WzyEc may form dimers. They also established
an in vitro Oag polymerisation system using the purified WzyEc (Woodward et al., 2010).
Extensive work on Pseudomonas aeruginosa PAO1 Wzy (WzyPa) was performed by
Islam et al. (Islam et al., 2010; Islam et al., 2011; Islam et al., 2013). They found that PL3
and PL5 of WzyPa contain RX10G motifs and also identified sequence conservation between
PL3 and PL5 of WzyPa. Site-directed mutagenesis on the Arg residues within these two
RX10G motifs showed that these Arg residues are important for WzyPa function. They found
that at physiological pH PL3 possesses a net positive charge (pI 8.59) and PL5 possesses a net
negative charge (pI 5.49). From these findings they proposed a “catch-and-release”
mechanism of Oag polymerisation by Wzy. According to this model PL3 acts as a “capture
arm” and catches incoming negatively charged Oag subunit for subsequent transfer to PL5,
which acts as a “retention arm” and involves relatively transient interaction with the Oag. PL5
is associated with constant binding and release of the growing Oag (Islam et al., 2011). They
claimed a widespread presence of the “catch-and-release” mechanism by finding homologues
Wzy proteins to WzyPa in other bacteria using a “jackhammer” search. Interestingly, their
search was unable to find any Wzy homologues to WzyPa in Enterobacteriaceae (Islam et al.,
2013).
Zhao et al. (2014) showed that WzyEc works in a distributive manner where the
polymerisation product leaves the active site of WzyEc after each round of reaction. They
found that at physiological pH the major PLs (PL3 and PL4) of WzyEc are positively and
negatively charged (pI values 9.08 and 4.29, respectively). Hence, they proposed that WzyEc
also follows the catch-and-release mechanism. However, the number of TMs and amino acid
sequence of WzyEc are different from WzyPa (Zhao et al., 2014).
PssT protein in R. leguminosarum is the counterpart of the Gram-negative bacterial
Wzy. Mazur et al. (2003) predicted the topology model of PssT having 12 TM and a large PL
![Page 61: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/61.jpg)
Introduction
33
between TM9 and 10. Initially, a RX10G motif was found in PssT between amino acids 350-
361 and then bioinformatics analysis identified two new RX10G motifs between amino acids
159-170 and 229-240. According to the previously predicted topology model these new
RX10G motifs are present in cytoplasmic loops (CL) 2 and 3 but studies of PssT-PhoA fusion
protein Ala-158 suggested translocation of these segment to the periplasm (Marczak et al.,
2013). Hence, Marczak et al. (2013) proposed that these motifs may have important role in
PssT polymerisation activity similar to WzyPa.
There is little knowledge about the substrate specificity and cross complementation of
different Wzy proteins. Studies showed that in Salmonella enterica A, B1, and D1 Wzy
proteins from different serogroups cross-complemented and produced relevant Oags (Makela,
1965; Nurminen et al., 1971; Valtonen et al., 1975) but were unable to produce Oag of
serogroup C2 (Naide et al., 1965). WzySf was also unable to replace WzyFt and synthesise
relevant Oag (Kim et al., 2012).
1.8.3 Comparison of WzySf with other Wzy proteins
There is very little sequence identity between wzy gene and Wzy proteins of different
bacterial species (Kim et al., 2010). The number of TMs in different Wzy proteins also varies:
WzyFt has 11 TMs (WzyFt topology model generated using TMHMM-2.0 and S. flexneri
topology model), WzyPa has 14 TMs, WzyEc has 10 TMs; however, WzySf and PssT have 12
TMs (Daniels et al., 1998; Islam et al., 2011; Kim et al., 2010; Mazur et al., 2003; Zhao et
al., 2014). WzyPa, WzyFt, and WzySf have two major PLs - PL3 and PL5 (Daniels et al., 1998;
Islam et al., 2011; Kim et al., 2010), WzyEc has two major PLs - PL3 and PL4 (Zhao et al.,
2014); however PssT has only one major PL between TM9 and TM10 (Mazur et al., 2003).
There is also a difference in the charged property of substrate of different Wzy proteins such
as, the Oag of P. aeruginosa is negatively charged (Knirel et al., 2006) but the Oag of WzySf
is neutral. WzySf is also very flexible about its substrate recruitment compared to other Wzy
proteins as polymerisation of Oags of all the serotypes of S. flexneri are performed by a single
type of WzySf.
![Page 62: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/62.jpg)
Introduction
34
1.9 Oag chain length regulator Wzz
Bacterial cell surface polysaccharides are regulated by the members of a large family of
proteins known as polysaccharide co-polymerase (PCP) family, anchored in the IM. PCPs are
subdivided into three classes (PCP1, PCP2, and PCP3) based on different characteristics such
as their association with a Wzy-dependent or ATP-binding cassette (ABC) transporter-
dependent pathway, and by the presence or absence of an additional cytoplasmic domain
(Morona et al., 2000b; Morona et al., 2009; Purins et al., 2008; Tocilj et al., 2008). All the
PCPs share some common structural features: N-terminal and C-terminal transmembrane
helices (transmembrane helices 1 and 2) separated by a polypeptide segment (~130 to 400
amino acid residues) with a coiled-coil region located externally or in the periplasm, and a
proline or glycine rich motif adjacent to the C-terminal transmembrane helix (Tocilj et al.,
2008). PCP1 and PCP2 proteins are involved in the Wzy-dependent pathway; and PCP3
proteins are involved in ABC dependent capsular polysaccharide synthesis (Morona et al.,
2009).
1.9.1 S. flexneri Wzz
The modal length of the Oag chain is regulated by Wzz proteins, members of the PCP1 family
(Morona et al., 2000a). Initially, wzz was named as regulator of O-chain length (rol) or chain
length determinant (cld) (Bastin et al., 1993; Batchelor et al., 1991). S. flexneri 2a has S-LPS
with two types of modal chain length (Fig. 1.10), short (S) type (11-17 Oag RUs) and very
long (VL) type (>90 Oag RUs), and the S-type and VL-type Oag chain lengths are determined
by WzzSf and WzzpHS2, respectively (Morona et al., 2003; Van den Bosch & Morona, 2003).
Both WzzSf and WzzpHS2 are members of the PCP1 subclass (Morona et al., 2009). Wzz is
characterised by two transmembrane helices and a large PL that comprises more than 85% of
the protein. Special feature of the PL of Wzz is the coiled coil formed by three regions
![Page 63: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/63.jpg)
Introduction
35
Figure 1.10 S. flexneri modal chain length LPS from 108 bacteria of S. flexneri 2a strain 2457T was electrophoresed on a 15% (w/v)
polyacrylamide gel and silver stained. The VL-type LPS and the S-type LPS are shown.
Figure adapted from May (2007).
![Page 64: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/64.jpg)
Introduction
36
(Marolda et al., 2008; Morona et al., 2000b). The coiled coil feature is a bundle of #-helices
that wind to form a superhelix (Lupas, 1996; Marolda et al., 2008).
Daniels and Morona (1999) performed site-directed mutagenesis to understand the
functional importance of the conserved residues in the carboxy and amino terminal ends of
WzzSf and found that not only the carboxy and amino terminal ends, but the amino acid
residues of the entire length of WzzSf are important for the Oag modal chain length control by
WzzSf. They also showed that WzzSf forms a dimer in vivo and may oligomerise up to a
hexamer (Daniels & Morona, 1999). Marolda et al. (2008) performed mutagenesis in the
coiled coil region of WzzSf and found that mutagenesis in region I (amino acid 108-130)
resulted in partial defects on the Oag modal chain length, region II (amino acids 153-173)
resulted in elimination of WzzSf function, and region III (amino acids 209-233) had no effect
on the LPS Oag modal chain length. Mutations in the coiled coil region of WzzpHS2 also
resulted in loss of Oag modal chain length control (Purins et al., 2008). Papadopoulas and
Morona (2010) performed random in-frame linker mutagenesis on wzzSf and created five
different classes (I-V) of mutants with varied Oag modal chain length [inactive (I), shorter (II
and III), nearly wild type (IV), and increased (V)]. In vivo chemical cross-linking showed
that class V mutants formed high-molecular weight oligomers but classes II and III were
unable to cross-link. Mapping of the class V mutations on the three dimensional structures
located the mutations within the inner cavity of PCP oligomer. Hence, they concluded that
stable dimer formation may be important for Oag modal chain length control by WzzSf
(Papadopoulos & Morona, 2010). Tran and Morona (2013) performed single amino acid
substitution on E. coli FepE which is a PCP1a protein and confers very long Oag modal chain
length (>80 Oag RUs). Analysis of the LPS profiles conferred by FepE mutants and chemical
cross-linking properties of the mutant FepE oligomer suggested that FepE residues located
within the internal cavity of the FepE oligomer contribute to Oag modal chain length but not
the oligomeric state of the protein (Tran & Morona, 2013). However, study of chimeric
molecules by Kalynych et al. (2012b) suggested that differences in the modal chain length
depends on the surface exposed amino acid residues in specific regions of WzzSf rather than
the oligomeric state. Cross complementation and chimeric studies using wzz from
phylogenetically similar species: E. coli, Salmonella enterica, and S. flexneri showed that
inherent variability of different Wzz lies in the PLs (Daniels & Morona, 1999; Kalynych et
![Page 65: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/65.jpg)
Introduction
37
al., 2011; Klee et al., 1997). Hence, the difference in chain length regulation by Wzz proteins
is dependent on the PLs. However, as mentioned before Daniels and Morona (1999) showed
that the entire WzzSf protein has role in Oag modal chain length regulation and recent studies
also showed that the TMs of Wzz are also important for modal chain length regulation (Islam
et al., 2013; Taylor et al., 2013).
Tran et al. (2014) analysed the colicin E2 (ColE2) sensitivity of all the classes of
WzzSf mutants generated by Papadopoulos and Morona (2010) and found that mutants with S-
type or long type (16-28 Oag RUs) modal chain lengths were more resistant to ColE2
compared to the mutants with intermediate S-type (8-14 Oag RUs), very S-type (2-8 Oag
RUs), and VL-type (>80 Oag RUs) Oag modal chain lengths. From this data they concluded
that the LPS Oag modal chain length control by WzzSf may be evolved due to selection
pressure from colicin in the environment (Tran et al., 2014).
1.9.2 Chain length and virulence
Oag is one of the virulence determinants of S. flexneri, however presence of Oag is not the
sole determinant of LPS for providing virulence but its modal chain length also plays a
critical role in the pathogenesis of the bacteria. S. flexneri wzz mutants are unable to either
form plaques on HeLa cell monolayer or form F-actin comet tails. Hence, WT Oag modality
is important for cell-to-cell spreading of S. flexneri (Morona et al., 2003). Studies showed that
S-type Oag modal chain is essential for the unipolar localisation of IcsA and efficient ABM
(Morona & Van Den Bosch, 2003a; Robbins et al., 2001; Sandlin et al., 1995). S. flexneri
strains with WzzpHS2 as the sole determinant of the Oag modal chain length and hence
producing VL-type Oag chain, are unable to form plaques on HeLa cell monolayer, having
reduced level of IcsA on cell surface, reduced virulence in Serény test, and reduced ability to
form F-actin comet tails (Van den Bosch et al., 1997). WzzSf and WzzpHS2 compete for the
available WzySf (Carter et al., 2009). Hong and Payne (1997) showed that WzzpHS2 is required
for resistance to serum killing however, WzzSf is required for invasion and intercellular spread
(Hong & Payne, 1997). Both WzzSf and WzzpHS2 are required for the optimal virulence
property of the bacteria.
![Page 66: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/66.jpg)
Introduction
38
1.10 Association of the proteins of the Oag biosynthesis pathway
Understanding the association of the participant proteins of the Wzy-dependent Oag
biosynthesis pathway is important to understand the actual mechanism behind this
biosynthesis. For a long time several research group suggested the multi-protein complex
formation in the Wzy-dependent pathway (Marolda et al., 2006; Whitfield, 2006; Whitfield,
2010). There are several proposed mechanisms about these associations such as molecular-
clock model (Bastin et al., 1993) and molecular chaperone model (Morona et al., 1995).
According to the proposed molecular-clock model, Wzz acts as a molecular clock and
regulates Wzy activity between two states: the E, or extension, state favours polymerisation,
and the T, or transfer, state favours the ligation reaction (Bastin et al., 1993). The molecular-
chaperone model describes Wzz as a typical molecular chaperone that regulates the overall
ratio of Wzy and WaaL in a complex and controls the enzyme kinetics of the ligation reaction
to define the modality (Morona et al., 1995). Tocilj et al. (2008) suggested that Wzz may
form a scaffold that recruits Wzy.
Kintz and Goldberg (2011) proposed a ruler model, which suggested that Wzz periplasmic
barrel, acts as a ruler and the Oag chain length is determined by the direct physical interaction
of the Oag polymer with the barrel of the Wzz oligomer. A more compact barrel generates
shorter Oag chain length as the area of interaction between Wzz and Oag polymer is reduced.
According to them the amount of Wzy has no correlation with the chain length of Oag (Kintz
& Goldberg, 2011). According to the model of Kalynych et al. (2012a) the growing Oag chain
adopt a higher order structure and may interfere with the proper positioning within the Wzy-
binding site. Wzz binds with the growing Oag and allows further polymerisation. After
achieving certain length the Oag can no longer be bound with the Wzz and dissociates
(Kalynych et al., 2012a). However, both of these models suggested the direct interaction of
the Oag polymer with Wzz or Wzz and Wzy but did not suggest any interaction between Wzz
and Wzy.
Islam and Lam (2014) proposed a hybrid model based on the Kintz and Goldberg (2011)
and Kalynych et al. (2012a) models. According to the hybrid model the Wzy dimer binds
with the TMs of the Wzz protomer within the PCP conserved bell-shaped quaternary
structure. The Oag chain is elongated due to the polymerisation by Wzy and the higher order
![Page 67: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/67.jpg)
Introduction
39
Oag structure destabilises the interaction of the polymer with Wzz. As the tip of the growing
Oag chain reaches the apex of the Wzz bell, the mechanical feedback of the interaction of Oag
polymer and Wzz transmits through the Oag chain to the basal Oag RU in the Wzy active site
and the Oag chain dissociates from Wzy (Islam & Lam, 2014). However, there is no direct
evidence to date on how these proteins are associated except the study of Marolda et al.
(2006) that provided the genetic data about the interaction of Wzx, Wzz, and Wzy. The work
of Carter et al. (2009) contradicts their data and suggested that may be there is no direct
physical interaction between WzzSf and WzySf.
Woodward et al. (2010) provided evidence supporting the association of Wzz and Wzy
through their in vitro polymerisation assay and suggested that Wzz and Wzy are enough to
shape the Oag chain. Islam et al. (2013) suggested that the chain length of the Oag is
determined by the interaction of Wzz and Wzy. Taylor et al. (2013) showed that the inhibitor
of # polymerase (Iap) peptide inhibits Wzy# (Oag polymerase of P. aeruginosa PAO1
serotype O5) by mimicking the Wzz TM segment and provided the evidence of direct
interaction between Wzz and Wzy. Bacterial two-hybrid system analysis in R. leguminosarum
showed that PssP protein, which is a PCP, interacts with PssL and PssT, which are Wzx and
Wzy, respectively (Marczak et al., 2013; Marczak et al., 2014). However, to date there is a
lack of evidence on the interaction of Wzy with the other proteins of the Wzy-dependent Oag
biosynthesis pathway using more direct approaches. Several studies pointed towards the
complex formation of the IM proteins during the Wzy-dependent pathway. Hence a direct
evidence of the complex formation is required to confirm these models and to know the actual
mechanism behind this pathway.
1.11 Aims and hypotheses
WzySf is an important protein in synthesising Oag, the key virulence determinant of S.
flexneri. WzySf was identified more than 20 years ago (Morona et al., 1994) but there is lack
of knowledge about its functional amino acid residues and its association with the other
proteins of the Oag biosynthesis pathway. In this thesis, I have investigated the biochemical
![Page 68: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/68.jpg)
Introduction
40
and functional characteristics of WzySf. Based on the earlier studies following hypotheses
were generated:
1. WzySf has variety of regions that are important for Oag polymerisation and chain
length control.
2. WzySf contains Arg residues in PL3 and PL5 which are essential for Oag
polymerisation.
3. WzySf interacts with WzzSf .
4. WzySf interacts physically with the other proteins of the Wzy-dependent pathway.
The following aims investigated the hypotheses:
1. To construct a suitable wzySf expression system for performing experiments to
understand the biochemical and functional characteristcs of WzySf.
2. To perform random mutagenesis on wzySf to identify the amino acid residues important
for WzySf polymerisation function.
3. To perform site-directed mutagenesis on the Arg residues on PL3 and PL5 of WzySf
and characterising the mutants based on their polymerisation activity and association
with WzzSf.
4. To optimise a purification method of S. flexneri WzySf.
5. To perform in vivo cross-linking followed by purification of WzySf to monitor the
direct physical association of the proteins of the Wzy-dependent pathway.
1.12 Thesis Organisation
The dissertation is organised as follow (Table 1.2).
![Page 69: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/69.jpg)
Introduction
41
Table 1.2 Overview of the chapters in this PhD thesis
Chapter Purpose and investigated research aims
Chapter 1 (Introduction) Introduces the research domain and provides context of the research
Chapter 2 (Materials and Methods)
Describes the experimental methods and the materials used to perform the studies
Chapter 3 Construction of a wzySf expression system, identifying functional amino acid residues of WzySf, understanding the role of WzzSf in the Oag polymerisation (Aims 1 and 2)
Chapter 4 Identifying the importance of the Arg residues in PL3 and PL5 of WzySf and characterising the WzySf mutants based on their polymerisation function and association with WzzSf (Aim 3)
Chapter 5 Purifying WzySf, investigating dimer formation of WzySf and relation of the dimer formation with the functioning of the protein, monitoring the direct physical interaction of the proteins of the Wzy-dependent pathway (Aims 4 and 5)
Chapter 6 (Conclusions) Concludes the thesis by discussing key contributions and direction for future research
![Page 70: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/70.jpg)
42
![Page 71: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/71.jpg)
43
Chapter 2
Materials and Methods
![Page 72: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/72.jpg)
Materials and Methods
44
Chapter 2: Materials and Methods
2.1 Bacterial strains and plasmids
A listing of Shigella flexneri and Escherichia coli host strains used in this work and a
complete list of strains constructed during this work is summarised in Table 2.1. Cloning
vectors and plasmids used in these studies are listed in Table 2.2.
2.2 Bacterial growth media and growth condition
2.2.1 Liquid growth media
All E.coli and S. flexneri strains were grown at 37°C in lysogeny broth (LB) (10 g/litre
tryptone, 5 g/litre yeast extract, 5 g/litre NaCl) and LB agar (LB broth, 15 g/litre Bacto agar).
Under induction conditions, 0.4 mM isopropyl-"-D-thiogalactopyranoside (IPTG) or 0.2%
(w/v) L-arabinose was added to the cultures, and they were grown for 20 h at 20°C.
Antibiotics were added as required to the media at the following final concentrations:
kanamycin (Km), 50 µg/ml, and chloramphenicol (Cm), 25 µg/ml, Ampicillin (Amp), 100
µg/ml. Liquid growth media were prepared in distilled water and sterilised by autoclaving.
2.2.2 Solid growth media
Bacteria were stored in a suspension of glycerol [30% (w/v), Invitrogen] and peptone [1%
(w/v), Difco] in Wheaton vials at -80°C. From these glycerol stocks fresh cultures were
prepared by streaking a loopful of the suspension onto LB agar with appropriate antibiotics,
followed by incubation for 16-18 h at 37°C to achieve adequate growth.
When blue/white colony screening was required, plates were supplemented with 40
µg/ml 5-bromo-4-chloro-3-indolyl-"-D-galactoside (X-Gal) and 0.5 mM IPTG that allowed
identification of recombinant plasmids in suitable E. coli via disruption of the LacZ# peptide
in pGEMT-Easy (Promega) cloning plasmids (Kovach et al., 1994).
![Page 73: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/73.jpg)
Materials and Methods
45
Table. 2.1 Bacterial strains used in this study
Strain Relevant characteristics # Source E. coli DH5# F- endA1 glnV44 thi-1 recA1 relA1 gyrA96
deoR nupG #80dlacZ!M15 !(lacZYA-argF)U169 hsdR17(rK- mK+)
Lab stock
XL10-Gold Tet r!(mcrA)183 !(mcrCB-hsdSMR-mrr)173 endA1 supE44 thi-1 recA1 gyrA96 relA1 lac [F´ proAB lacIqZ!M15Tn10 (Tetr) Camr]
Stratagene
Lemo21(DE3)
fhuA2 (lon) ompT gal ($ DE3) (dcm) "hsdS/ pLemo(Cmr)
New England Biolabs
PNRM1 DH5# (pGEMT-Easy-wzySf) This study PNRM3 DH5# (pWaldo-TEV-GFP) This study PNRM4 DH5# (pRMPN1) This study PNRM15 Lemo21(DE3) (pRMPN1) This study PNRM22 XL10-Gold (pRMPN2) This study PNRM24 XL10-Gold (pRMPN3) This study PNRM26 XL10-Gold (pRMPN4) This study PNRM27 XL10-Gold (pRMPN5) This study PNRM 30 XL10-Gold (pRMPN6) This study PNRM53 XL10-Gold (pRMPN7) This study PNRM56 XL10-Gold (pRMPN8) This study PNRM57 XL10-Gold (pRMPN9) This study PNRM59 XL10-Gold (pRMPN10) This study PNRM61 XL10-Gold (pRMPN11) This study PNRM64 XL10-Gold (pRMPN12) This study PNRM66 XL10-Gold (pRMPN13) This study PNRM67 XL10-Gold (pRMPN14) This study PNRM69 XL10-Gold (pRMPN15) This study PNRM71 XL10-Gold (pRMPN16) This study PNRM73 XL10-Gold (pRMPN17) This study PNRM95 XL10-Gold (pRMPN19) This study PNRM98 XL10-Gold (pRMPN21) This study PNRM100 XL10-Gold (pRMPN22) This study PNRM103 XL10-Gold (pRMPN23) This study PNRM114 XL10-Gold (pRMPN24) This study
![Page 74: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/74.jpg)
Materials and Methods
46
Table 2.1 continued Strain Relevant characteristics # Source PNRM116 XL10-Gold (pRMPN25) This study PNRM179 XL10-Gold (pRMPN27) This study PNRM182 XL10-Gold (pRMPN28) This study PNRM184 XL10-Gold (pRMPN29) This study PNRM185 XL10-Gold (pRMPN30) This study PNRM187 XL10-Gold (pRMPN31) This study PNRM209 XL10-Gold (pRMPN32) This study PNRM210 XL10-Gold (pRMPN33) This study PNRM211 XL10-Gold (pRMPN34) This study PNRM212 XL10-Gold (pRMPN36) This study PNRM230 XL10-Gold (pRMPN35) This study S. flexneri PE638 S. flexneri Y rpoB (Rifr) (Morona et al., 1995) RMM109 PE638 !wzy (Rifr) (Morona et al., 1994) RMA4337 RMM109 !wzz (Rifr Tetr) This study PNRM5 RMM109 (pWaldo-TEV-GFP) This study PNRM6 RMM109 (pAC/pBADT7-1) This study PNRM7 PE638 (pWaldo-TEV-GFP) This study PNRM8 PE638 (pAC/pBADT7-1) This study PNRM9 RMM109 (pRMPN1) This study PNRM10 PE638 (pRMPN1) This study PNRM11 PNRM6 (pWaldo-TEV-GFP) This study PNRM12 PNRM8 (pAC/pBADT7-1) This study PNRM13 PNRM6 (pRMPN1) This study PNRM14 PNRM10 (pAC/pBADT7-1) This study PNRM16 PNRM6 (pRMPN2) This study PNRM17 PNRM6 (pRMPN3) This study PNRM18 PNRM6 (pRMPN4) This study PNRM19 PNRM6 (pRMPN5) This study PNRM20 PNRM6 (pRMPN6) This study PNRM75 PNRM6 (pRMPN7) This study PMRM76 PNRM6 (pRMPN8) This study PNRM77 PNRM6 (pRMPN9) This study PMRM78 PNRM6 (pRMPN10) This study
![Page 75: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/75.jpg)
Materials and Methods
47
Table 2.1 continued Strain Relevant characteristics # Source PMRM79 PNRM6 (pRMPN11) This study PMRM80 PNRM6 (pRMPN12) This study PMRM81 PNRM6 (pRMPN13) This study PMRM82 PNRM6 (pRMPN14) This study PMRM83 PNRM6 (pRMPN15) This study PMRM84 PNRM6 (pRMPN16) This study PMRM85
PNRM6 (pRMPN17) This study PMRM87 PNRM7 (pRMPN2) This study PMRM88 PNRM7 (pRMPN3) This study PMRM89 PNRM7 (pRMPN5) This study PMRM90 PNRM7 (pRMPN6) This study PMRM91 PNRM7 (pRMPN7) This study PMRM92 PNRM7 (pRMPN8) This study PMRM93 PNRM7 (pRMPN15) This study PMRM94 PNRM7 (pRMPN16) This study PMRM119 PNRM6 (pRMPN19) This study PMRM120 PNRM6 (pRMPN20) This study PMRM121 PNRM6 (pRMPN22) This study PMRM122 PNRM6 (pRMPN23) This study PMRM123 PNRM6 (pRMPN24) This study PMRM124 PNRM6 (pRMPN25) This study PNRM126 RMA4337 (pAC/pBADT7-1) This study PMRM127 PNRM126 (pRMPN2) This study PMRM128 PNRM126 (pRMPN3) This study PMRM129 PNRM126 (pRMPN5) This study PMRM130 PNRM126 (pRMPN6) This study PMRM131 PNRM126 (pRMPN7) This study PMRM132 PNRM126 (pRMPN15) This study PMRM133 PNRM126 (pRMPN16) This study PMRM134 PNRM126 (pRMPN1) This study PMRM135 PNRM126 (pWaldo-TEV-GFP) This study PMRM136 PNRM126 (pRMPN8) This study PMRM137 PNRM126 (pRMPN10) This study
![Page 76: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/76.jpg)
Materials and Methods
48
Table 2.1 continued Strain Relevant characteristics # Source PNRM140 PNRM126 (pRMPN13) This study PNRM141 PNRM126 (pRMPN14) This study PMRM142 PNRM126 (pRMPN9) This study PMRM143 PNRM126 (pRMPN11) This study PMRM144 PNRM126 (pRMPN19) This study PMRM145 PNRM126 (pRMPN24) This study PMRM146 PNRM126 (pRMPN25) This study PMRM147 PNRM126 (pRMPN23) This study PMRM148 PNRM126 (pRMPN21) This study PMRM149 PNRM126 (pRMPN22) This study PMRM150 PNRM126 (pRMPN12) This study PMRM151 PNRM126 (pRMPN17) This study PNRM153 PNRM126 (pRMPN4) This study PNRM159 PNRM13 (pWSK29-wzzSf) This study PNRM161 PNRM13 (pWSK29) This study PNRM190 PNRM6 (pRMPN27) This study PNRM192 PNRM6 (pRMPN28) This study PNRM194 PNRM6 (pRMPN29) This study PNRM196 PNRM6 (pRMPN30) This study PNRM198 PNRM6 (pRMPN31) This study PNRM216 PNRM6 (pRMPN32) This study PNRM218 PNRM6 (pRMPN33) This study PNRM220 PNRM6 (pRMPN34) This study PNRM222 PNRM6 (pRMPN36) This study PNRM232 PNRM6 (pRMPN35) This study PNRM246 PNRM126 (pRMPN27) This study PNRM248 PNRM126 (pRMPN28) This study PNRM250 PNRM126 (pRMPN29) This study PNRM252 PNRM126 (pRMPN30) This study PNRM252 PNRM126 (pRMPN30) This study PNRM254 PNRM126 (pRMPN31) This study PNRM256 PNRM126 (pRMPN32) This study PNRM258 PNRM126 (pRMPN33) This study
![Page 77: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/77.jpg)
Materials and Methods
49
Table 2.1 continued Strain Relevant characteristics # Source PNRM260 PNRM126 (pRMPN34) This study PNRM262 PNRM126 (pRMPN35) This study PNRM264 PNRM126 (pRMPN36) This study PNRM271 RMM109 (pWSK29-wzzSf) This study PNRM289 PNRM16 (pWSK29-wzzSf) This study PNRM293 PNRM122 (pWSK29-wzzSf) This study PNRM299 PNRM85 (pWSK29-wzzSf) This study PNRM301 PNRM192 (pWSK29-wzzSf) This study
# Rifr, rifampicin resistant; Kmr, kanamycin resistant; Cmr, chloramphenicol resistant; Tetr,
tetracycline resistant. $DE3 is $ sBamHIo !EcoRI-B int::(lacI::PlacUV5::T7 gene1)i21
!nin5. pLemo is pACYC184-PrhaBAD-lysY.
![Page 78: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/78.jpg)
Materials and Methods
50
Table 2.2 Plasmids used in this study
Plasmid Description # Source pGEMT-Easy Cloning vector Promega pRMCD6 Source of wzySf (modified codons at
positions 4, 9, and 23) (Daniels et al., 1998)
pAC/pBADT7-1 Source of T7 RNA polymerase; Cmr (McKinney et al., 2002) pWaldo-TEV-GFP Cloning vector with GFP tag; Kmr (Waldo et al., 1999) pGEMT-Easy-wzySf wzySf with BamHI and KpnI sites This Study pRMPN1 pWaldo-wzySf-TEV-GFP This Study pCACTUS Suicide vector containing sacB, Cmr,
and orits (Morona et al., 1995)
pRMA577 Suicide vector contatining SphI-SphI fragment with the rol gene
(Morona et al., 1995)
pCACTUS-wzzSf::Tcr Suicide mutagenesis construct to construct the strain RMA4337
This Study
pWSK29 Cloning vector; Ampr (Wang & Kushner, 1991) pWSK29-wzzSf pWSK29 with S. flexneri 2a wzzSf (Murray et al., 2006)
pRMPN2 pRMPN1 with R164A point mutation in the wzySf
This Study
pRMPN3 pRMPN1 with R250A point mutation in the wzySf
This Study
pRMPN4 pRMPN1 with R258A point mutation in the wzySf
This Study
pRMPN5 pRMPN1 with R278A point mutation in the wzySf
This Study
pRMPN6 pRMPN1 with R289A point mutation in the wzySf
This Study
pRMPN7 pRMPN1 with G130V point mutation in the wzySf
This Study
pRMPN8 pRMPN1 with L11I point mutation in the wzySf
This Study
pRMPN9 pRMPN1 with N86K point mutation in the wzySf
This Study
pRMPN10 pRMPN1 with L28V point mutation in the wzySf
This Study
pRMPN11 pRMPN1 with P165S point mutation in the wzySf
This Study
![Page 79: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/79.jpg)
Materials and Methods
51
Table 2.2 continued Plasmid Description # Source
pRMPN12 pRMPN1 with G82C point mutation in the wzySf
This Study
pRMPN13 pRMPN1 with N147K point mutation in the wzySf
This Study
pRMPN14 pRMPN1 with L191F point mutation in the wzySf
This Study
pRMPN15 pRMPN1 with L214I point mutation in the wzySf
This Study
pRMPN16 pRMPN1 with P352H point mutation in the wzySf
This Study
pRMPN17 pRMPN1 with V92M point mutation in the wzySf
This Study
pRMPN19 pRMPN1 with F52Y point mutation in the wzySf
This Study
pRMPN21 pRMPN1 with F52C/I242T point mutation in the wzySf
This Study
pRMPN22 pRMPN1 with C60F point mutation in the wzySf
This Study
pRMPN23 pRMPN1 with Y137H point mutation in the wzySf
This Study
pRMPN24 pRMPN1 with L49F/T328A point mutation in the wzySf
This Study
pRMPN25 pRMPN1 with F54C point mutation in the wzySf
This Study
pRMPN27 pRMPN1 with R164K point mutation in the wzySf
This Study
pRMPN28 pRMPN1 with R250K point mutation in the wzySf
This Study
pRMPN29 pRMPN1 with R258K point mutation in the wzySf
This Study
pRMPN30 pRMPN1 with R278K point mutation in the wzySf
This Study
pRMPN31 pRMPN1 with R289K point mutation in the wzySf
This Study
pRMPN32 pRMPN1 with R164E point mutation in the wzySf
This Study
pRMPN33 pRMPN1 with R250E point mutation in the wzySf
This Study
pRMPN34 pRMPN1 with R258E point mutation in the wzySf
This Study
![Page 80: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/80.jpg)
Materials and Methods
52
Table 2.2 continued Plasmid Description # Source
pRMPN35 pRMPN1 with R278E point mutation in the wzySf
This Study
pRMPN36 pRMPN1 with R289E point mutation in the wzySf
This Study
# Kmr, kanamycin resistant; Cmr, chloramphenicol resistant; Tcr or Tetr, tetracycline resistant.
![Page 81: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/81.jpg)
Materials and Methods
53
2.3 Chemicals and reagents
Unless otherwise stated chemicals and reagents were sourced from the following suppliers:
Promega, Invitrogen, Sigma-Aldrich, Roche, BD, Qiagen, New England Biolabs, and
Anatrace. Key chemicals used in this study were L-arabinose (Sigma, Catalogue number
A3256), IPTG (Biovectra, Catalogue number 1882), Sodium dodecanoyl sarcosine (Anatrace,
Catalogue number S300), n-Dodecyl-"-D-maltopyranoside (DDM, Sigma Catalogue number
D4641), 40% Bis-Acrylamide solution (BioRad, Catalogue number 161-0141), Ammonium
persulphate (BioRad, Catalogue number 161-0700), N,N,N',N'-Tetramethyl-ethylenediamine
(TEMED, Sigma Catalogue number T22500), Formaldehyde (Sigma, Catalogue number
F8775), Proteinase K (Invitrogen, Catalogue number 25530-015), and Dithiobis(succinimidyl
propionate) (DSP) (Thermo Fischer Scientific, Catalogue Number 22585).
2.4 Antibodies and antisera
Affinity purified rabbit polyclonal anti-WzzSf was made by Daniels and Morona (1999). The
WzzSf antibody was used at 1:750 for Western immunoblotting. Mouse monoclonal His6
antibody (Genscript) was used at 1:50000 for Western immunoblotting. For Western
immunoblotting goat anti-rabbit horseradish-peroxidase(HRP)-conjugate or a goat anti-mouse
HRP-conjugate (KPL) was used as secondary antibody at 1:30,000.
2.5 Nucleic acid methods
2.5.1 Isolation of plasmid DNA and DNA preparation
Plasmid DNA was isolated by using the QIAprep spin miniprep kit (Qiagen) following the
manufacturer’s instructions. PCR amplified DNA and restriction enzymes digests were
purified using QIAquick PCR purification kit (Qiagen). Gel extracted DNA was purified
using PureLink gel extraction kit (Invitrogen).
![Page 82: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/82.jpg)
Materials and Methods
54
2.5.2 Quantitation of DNA
Concentration of DNA was determined by the absorption measurement at 260 nm assuming
that an optical density (OD) of 1.0 is equal to 50 µg/ml double stranded DNA. Purity of DNA
was evaluated by the ratio of A260nm to A280nm and the DNA was considered pure and used for
further manipulation if the ratio is ~2.0.
2.5.3 Restriction enzyme digestion
Restriction digestion of plasmid DNA and PCR amplicons were prepared as per the
manufacturer’s (New England Biolabs) instructions. Where required the restriction enzymes
were heat inactivated prior to further manipulation according to the manufacturer’s
instructions.
2.5.4 Agarose gel electrophoresis
DNA samples for electrophoresis were mixed with one-tenth volume of tracking dye [0.1 %
(w/v) bromophenol blue, 20% (v/v) glycerol, 0.1 mg/ml RNase; heated at 100°C for 30 min]
and separated on 1% (w/v) agarose gels using 1x TBE buffer (67 mM Tris, 22 mM boric acid,
1 mM EDTA) at 120 V for 45 min. EcoRI-restricted bacteriophage SPP1 known standards
were used to determine the sizes of the DNA. The SPP1 sizes (kb) were: 8.51, 7.35, 6.11,
4.84, 3.59, 2.81, 1.95, 1.86, 1.51, 1.39, 1.16, 0.98, 0.72, 0.48, 0.36, and 0.09. The EcoRI
digested SPP1 molecular weight standards were prepared as described previously (Ratcliff et
al., 1979). Gels were stained with 3x GelRed (Biotium) for 15-30 min. DNA bands were
visualised using GelDoc XR system (Biorad).
2.5.5 DNA sequencing
2.5.5.1 Sample preparation
A mixture of 600-1200 ng plasmid DNA and 1 µl primer was adjusted to 12 µl with Milli Q
water in a 1.5 ml reaction tube. The samples were sent to the Australian Genome Research
![Page 83: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/83.jpg)
Materials and Methods
55
Facility (AGRF), Plant Genomic Centre, University of Adelaide, PMB1 Glen Osmond,
Urrbrae, SA 5042.
2.5.5.2 Capillary separation DNA sequencing
DNA sequencing of the plasmid DNA was carried out at AGRF using the ABI Prism Big Dye
Terminator Version 3.1 in an Eppendorf Mastercycler. The 12 µl of the total reaction volume
contained 1 µl of template DNA, 1 µl of primer, and 4 µl of BIG DYE reaction mix. The
sequencing reaction consisted of 25 cycles of DNA denaturation (95°C, 30 sec), primer
annealing (50°C, 15 sec), and extension (60°C, 4 min). The reaction mix was then precipitated
using the ethanol/sodium acetate method. Briefly, 8 µl Milli Q water was added to the
reaction mix to adjust the volume to 20 µl. Then 3 µl 3 M sodium acetate (pH 4.6), 62.5 µl
non-denatured 95% ethanol, and 14.5 µl Milli Q water were added to 20 µl reaction mix and
incubated at room temperature (RT) for 1 h. DNA was collected from the reaction mix as
pellet by centrifugation (13,200 x g, 20 min, RT, Eppendorf Centrifuge 5415R), DNA pellet
was washed in 250 µl 70% (v/v) ethanol, and was dried for 1 h at RT. Sequencing reactions
were analysed by AGRF.
2.5.5.3 Sequencing analysis
DNA sequencing data obtained from AGRF was analysed and aligned with the native DNA
sequence using DNAMAN (Version 4.22).
2.6 Polymerase chain reaction (PCR)
Oligonucleotides used in this study are purchased from GeneWorks (Adelaide) and Integrated
DNA Technologies (USA). The oligonucleotides are listed in Table 2.3. General PCR was
carried out in a 20 µl reaction mix containing 1x ThermoPol Reaction Buffer (NEB), 200 µM
dNTPs (Sigma), 50 µM of each primer, 100 ng DNA template (either plasmids or genomic
DNA), and 0.25 Unit Taq DNA polymerase (NEB). PCR reactions were performed in an
![Page 84: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/84.jpg)
Materials and Methods
56
Table 2.3 Differenet primers made in this study
Primer* Sequence (5’-3’) # Purpose PN1_wzySfKpnF GGCGGTACCATGAATAATATTAATAAAATT
TTTATTACA amplification Of wzySf
PN2_wzySfBamHR GCGGGATCC TTTTGCTCCAGAAGT GAGGTTA
amplification of wzySf
ET35_F AGAGTAGAAAATAATAATGTTTCT
Construction of RMA4337
ET35_R GGCAAGCTTTTACTTCGCGTTGTAATTACG Construction of RMA4337
PN5_R164A_F AGCGAGTTCTTTTTTGCCCCCGATGGGGC R164A mutation PN6_R164A_R GCCCCATCGGGGGCAAAAAAGAACTCGCT R164A mutation PN9_R250A_F ATGCTTTACATGGTCGGATCAGCCAGTGAA
GATTCTGAC R250A mutation
PN10_R250A_R GTCAGAATCTTCACTGGCTGATCCGACCATGTAAAGCAT
R250A mutation
PN11_R258A_F GTGAAGATTCTGACTCTGTTGCCTTTAATGATTTATATTTTTATTATAAAAATGTTG
R258A mutation
PN12_R258A_R CAACATTTTTATAATAAAAATATAAATCATTAAAGGCAACAGAGTCAGAATCTTCAC
R258A mutation
PN13_R278A_F GCGACGTTCTTGTTTGGAGCCGGATTTGGTTCATTTATATTAG
R278A mutation
PN14_R278A_R CTAATATAAATGAACCAAATCCGGCTCCAAACAAGAACGTCGC
R278A mutation
PN15_R289A_F TCATTTATATTAGATCGATTAGCCATTGAAATAGTACCTCTTGAG
R289A mutation
PN16_R289A_R CTCAAGAGGTACTATTTCAATGGCTAATCGATCTAATATAAATGA
R289A mutation
PN27_R164K_F GACTAGCGAGTTCTTTTTTAAACCCGATGGGGC
R164K mutation
PN28_R164K_R GCCCCATCGGGTTTAAAAAAGAACTCGCTAGTC
R164K mutation
PN29_R250K_F ATGCTTTACATGGTCGGATCAAAAAGTGAAGATTCTGAC
R250K mutation
PN30_R250K_R GTCAGAATCTTCACTTTTTGATCCGACCATGTAAAGCAT
R250K mutation
PN31_R258K_F CGGATCACGCAGTGAAGATTCTGACTCTGTTAAATTTAATGATT
R258K mutation
PN32_R258K_R AATCATTAAATTTAACAGAGTCAGAATCTTCACTGCGTGATCCG
R258K mutation
![Page 85: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/85.jpg)
Materials and Methods
57
Table 2.3 continued Primer* Sequence (5’-3’) # Purpose PN33_R278K_F GCGACGTTCTTGTTTGGAAAAGGATTTGGTT
CATTTATATTAG R278K mutation
PN34_R278K_R CTAATATAAATGAACCAAATCCTTTTCCAAACAAGAACGTCGC
R278K mutation
PN35_R289K_F GGTTCATTTATATTAGATCGATTAAAAATTGAAATAGTACCTCTTGAG
R289K mutation
PN36_R289K_R CTCAAGAGGTACTATTTCAATTTTTAATCGATCTAATATAAATGAACC
R289K mutation
PN41_R164E_F GACTAGCGAGTTCTTTTTTGAGCCCGATGGGGC
R164E mutation
PN42_R164E_R GCCCCATCGGGCTCAAAAAAGAACTCGCTAGTC
R164E mutation
PN43_R250E_F ATGCTTTACATGGTCGGATCAGAGAGTGAAGATTCTGAC
R250E mutation
PN44_R250E_R GTCAGAATCTTCACTCTCTGATCCGACCATGTAAAGCAT
R250E mutation
PN45_R258E_F CGGATCACGCAGTGAAGATTCTGACTCTGTTGAGTTTAATGATT
R258E mutation
PN46_R258E_R AATCATTAAACTCAACAGAGTCAGAATCTTCACTGCGTGATCCG
R258E mutation
PN47_R278E_F GCGACGTTCTTGTTTGGAGAGGGATTTGGTTCATTTATATTAG
R278E mutation
PN48_R278E_R CTAATATAAATGAACCAAATCCCTCTCCAAACAAGAACGTCGC
R278E mutation
PN49_R289E_F GGTTCATTTATATTAGATCGATTAGAGATTGAAATAGTACCTCTTGAG
R289E mutation
PN50_R289E_R CTCAAGAGGTACTATTTCAATCTCTAATCGATCTAATATAAATGAACC
R289E mutation
*F, Forward; R, Reverse; # Bold and underlined - restriction enzyme coding region; Bold -
changed codon.
![Page 86: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/86.jpg)
Materials and Methods
58
Eppendorf Mastercycler Gradient PCR thermocycler with 25-35 amplification cycles adjusted
according to the DNA being amplified. Each standard cycle involved denaturation of the
template at 95ºC for 30 sec, annealing of primers to the DNA at a temperature ranging from
55-70ºC for 30 sec, and extension at 72ºC for 1 min/kb of DNA. Amplification of specific
gene sequences for cloning was performed in a 50 µl reaction volume in an Eppendorf
Mastercycler Gradient PCR thermocycler using Phusion high-fidelity DNA polymerase
(Finnzymes) following manufacturer’s protocol.
2.7 DNA purification
2.7.1 DNA gel extraction
10 µl tracking dye (See Section 2.5.4) was added to 50 µl overnight restriction enzyme
digested DNA samples and were electrophoresed in 1% agarose in TBE at 120 V for 45 min.
50 µl DNA sample was loaded into the center well and 4 µl of DNA samples were loaded into
the flanking wells. The flanking lanes were cut from the rest of the gel and stained with 3X
Gel Red. Flanking lanes were exposed to UV light and the desired DNA band was marked.
The central lane was then aligned with the marked flanking lanes and the DNA band of
interest was excised from the central lane. The extracted DNA was purified using the
PureLink Quick Gel Extraction kit (Invitrogen) following the manufacturer’s protocol. The
purified DNA was used in the ligation reactions.
2.7.2 Purification of PCR products
PCR products were purified using the QIAquick PCR purification Kit (Qiagen) to remove the
enzymes, oligonucleotides, and salts prior to use in the ligation reactions.
2.8 Ligation of DNA fragments into cloning vectors
Ligation reactions were performed following the manufacturer’s (NEB) protocol where PCR
products and plasmids for ligations were mixed in a molar ratio of 3:1 (insert:vector).
![Page 87: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/87.jpg)
Materials and Methods
59
Ligation with the pGEMT-Easy vector was performed as instructed by the manufacturer
(Promega).
2.9 Transformation
2.9.1 Preparation of chemically competent cells
Overnight cultures were diluted 1:20 in 10 ml LB broth and incubated at 37ºC to an OD600 of
~0.4-0.6. Cultures were then centrifuged (2,200 x g, 10 min, 4ºC) to get the bacterial cell
pellet. The cell pellet was resuspended in ice-cold 0.1 M MgCl2, and re-centrifuged as before.
Then the cell pellet was resuspended in 1 ml ice-cold 0.1 M CaCl2 and incubated on ice for 1
h, followed by similar centrifugation as above. Finally, the bacterial cell pellet was
resuspended in 0.5 ml ice-cold 0.1 M CaCl2 containing 15% (v/v) glycerol. The chemically
competent bacterial cells were stored at -80ºC or used fresh.
2.9.2 Heat shock transformation
Chemically competent cells were thawed on ice for 10 min and mixed with 6-10 µl of ligation
product. The mix was then left on the ice for 30 min prior to 3 min heat shock in a 37°C water
bath followed by 5 min incubation on ice. 900 µl of SOC medium [20 g/litre tryptone (BD), 5
g/litre yeast extract, 2.5 mM KCl, 20 mM MgSO4, 8.6 mM NaCl] with 0.2% (w/v) glucose
was added to the mix and the mix was incubated at 37°C for 1-3 h to allow the expression of
the antibiotic resistance genes in the plasmids. Cells were plated onto LB agar plates with
appropriate antibiotics and incubated at 37°C for 16-18 h.
2.9.3 Preparation of electrocompetent cells
Overnight cultures were sub-cultured 1:20 in 10 ml LB broth and incubated at 37ºC to an
OD600 of ~0.4-0.6 and centrifuged (2,200 x g, 10 min, 4ºC) to get the cell pellet. The cell
pellet was resuspended in 10 ml ice-cold Milli Q water and centrifuged as before. The cell
![Page 88: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/88.jpg)
Materials and Methods
60
pellet was again resuspended in 5 ml ice-cold Milli Q water and re-centrifuged as before. The
bacterial cell pellet was resuspended in 200 µl ice-cold 10% (v/v) glycerol. 100 µl aliquots of
the suspension were stored at -80°C or used fresh.
2.9.4 Electroporation
A 100 µl aliquot of the electrocompetent cells was thawed on ice, 2-5 µl of the plasmid DNA
was added to the aliquot, and then the cells and plasmid mix was added to a pre-chilled
electroporation cuvette (0.2 cm gap, Bio-Rad). The mix was then electroporated using an
electroporation device (Bio-Rad Gene Pulser, 2.5 kV, 25 µF, Pulse Controller 200 %). 900 ml
of SOC medium (Section 2.9.2) with 0.2% (w/v) glucose was added to the mix and incubated
for 1-3 h at 37°C. The electroporated cells were plated on LB agar with appropriate antibiotics
and incubated for 16-18 h at 37°C.
2.10 Mutagenesis
2.10.1 Random mutagenesis
Random mutagenesis was performed using the GeneMorph II EZ-Clone Domain Mutagenesis
Kit (Catalogue number 200552; Stratagene) according to the manufacturer’s instructions with
the primers PN1_wzySfKpnF and PN2_wzySfBamHR (Table 2.3). S. flexneri wzy (wzySf) coding
region in plasmid pRMPN1 (Table 2.2) was mutagenised with an error-prone DNA
polymerase. The mutagenised plasmids were transformed into competent XL10-Gold cells
(Agilent Technologies). Plasmid DNA was then isolated from randomly chosen transformed,
mutated colonies and transformed into strain PNRM6 (Table 2.1). Colicin swab assays were
performed to screen the mutants (see below). Plasmid DNA was isolated from putative
mutants, transformed into XL10-Gold cells, and subjected to DNA sequencing (AGRF,
Adelaide, Australia).
![Page 89: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/89.jpg)
Materials and Methods
61
2.10.2 Site-directed mutagenesis
QuickChange Lightning Site-Directed Mutagenesis Kit (Catalogue number 210518,
Stratagene) was used to perform site-directed mutagenesis on wzySf in pRMPN1 plasmid
following the manufacturer’s instructions. Mutagenised plasmids were transformed into
XL10-Gold. Plasmids were isolated from the mutated strains and the precise position of the
mutation within the coding region was determined by DNA sequencing (AGRF, Adelaide,
Australia). Finally, the mutated plasmids were transformed into PNRM6. The oligonucleotide
primers used for site-directed mutation are listed in Table 2.3.
2.11 Characterisation of mutants
2.11.1 Colicin sensitivity assay
For the colicin sensitivity assay His6-colicin E2 (ColE2) with an initial concentration of 1
mg/ml was purified from E. coli BL21(DE3) carrying pET41b expressing C-terminal His-
tagged colicin E2 (Sharma et al., 2009; Tran et al., 2014).
2.11.1.1 ColE2 swab assay
A 2-fold serial dilution of 1 µg/ml ColE2 was swabbed onto antibiotic-selective LB agar
plates with a cotton swab. The plates were left to dry for 1 h at RT. Overnight cultures were
diluted 1:20 in LB with antibiotics and incubated at 37ºC to an OD600 of ~0.4-0.6 and
centrifuged. Cultures were induced where required. Individual cultures were then swabbed
perpendicular to the ColE2 streak, and the plates were left to dry for another 1 h at RT. The
plates were then incubated for 16-18 h at 37°C. The ColE2 susceptibilities of the test strains
were recorded and images were taken using a Canon scanner (CanoScan 9000F) against a
dark background.
2.11.1.2 ColE2 spot assay
A spot assay was performed using the serial dilutions of ColE2. Overnight cultures were
![Page 90: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/90.jpg)
Materials and Methods
62
diluted 1:20 in LB with antibiotics, incubated at 37ºC to an OD600 of ~0.4-0.6 and centrifuged.
Cultures were induced where required. One hundred microlitres of the individual cultures
were spread onto LB agar plates with appropriate antibiotics. The plates were left to dry for 2
h at RT. A 2-fold serial dilution of 1 µg/ml ColE2 [denoted neat (N)] was spotted on the dried
plates, and the plates were left to dry for another 3 h at RT. The plates were then incubated for
16-18 h at 37°C. The endpoints of the killing zones of test strains were recorded. Images were
taken as described above.
2.11.2 Bacteriophage sensitivity assay
The procedures of phage propagation and phage stock preparation have been described
previously (Mavris et al., 1997; Morona et al., 1994). The concentration of the bacteriophage
Sf6c stock used was 8.6 x 107 p.f.u./ml. Overnight cultures were diluted 1:20 in LB with
antibiotics and incubated at 37ºC to an OD600 of ~0.4-0.6 and centrifuged. Cultures were
induced where required. 100 µl of the individual cultures was spread onto LB agar plates with
appropriate antibiotics. The plates were left to dry for 2 h at RT. Serial dilutions of the
bacteriophage Sf6c stock were spotted on the dried plates, and the plates were dried for a
further 3 h at RT. The plates were incubated for 18 h at 37°C. The phage sensitivities of the
test strains were recorded. Images were taken as described above.
2.12 Protein Techniques
2.12.1 Preparation of whole cell lysate
Overnight cultures were diluted 1:20 in LB with antibiotics and incubated at 37ºC to an OD600
of ~0.4-0.6 and centrifuged. Cultures were induced where required. Cultures equivalent to
5x108 bacteria were harvested by centrifugation (16,000 x g, 1 min, 4ºC, Eppendorf
Centrifuge 5415R). For Western immunoblotting the pellet was resuspended in 100 µl 1x
sample buffer [0.0625 M Tris- HCl, 10% (v/v) glycerol, 2% (w/v) SDS, 0.02% (v/v)
bromophenol blue, and 5% (v/v) "-mercaptoethanol ("-Me) (Sigma)]. For in-gel fluorescence
the pellet was resuspended in 20 µl PBS, and 20 µl buffer A [200 mM Tris-HCl (pH 8.8),
![Page 91: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/91.jpg)
Materials and Methods
63
20% (v/v) glycerol, 5 mM EDTA (pH 8.0), 0.02% (w/v) bromophenol blue, 4% (w/v) SDS,
and 0.05 M dithiothreitol (DTT)] was then added to the cell suspension. Solubilised cell
suspensions were incubated at 37ºC for 5 min unless otherwise stated.
2.12.2 Preparation of whole membrane fraction
Overnight cultures were diluted 1:20 in LB with antibiotics and incubated at 37ºC to an OD600
of ~0.4-0.6 and centrifuged. Cultures were induced where required. Cells were harvested from
the 50 ml culture by centrifugation (9,800 x g, Beckman J2-21M induction drive centrifuge,
10 min, 4°C), and the cell pellet was resuspended in 4 ml sonication buffer (20 mM Tris-HCl,
150 mM NaCl, pH 7.5). The mixture was then lysed by sonication, followed by centrifugation
(2,200 x g, Sigma 3K15 tabletop centrifuge, 10min, 4°C) to remove debris.
Ultracentrifugation was performed in a Beckman Coulter Optima MAX-XP tabletop
ultracentrifuge (126,000 x g, 1 h, 4°C) to isolate the whole-membrane (WM) fraction. The
WM fraction was resuspended in PBS and then solubilised in buffer A (Section 2.12.1) and
was incubated at 37ºC for 5 min.
2.12.3 SDS-PAGE
Samples for SDS-PAGE were heated at 37ºC for 5 min prior to loading, unless otherwise
stated. Samples were electrophoresed on 15% (w/v) acrylamide gels in PAGE running buffer
[0.025 M Tris-HCl, 0.2 M glycine, 0.1% (w/v) SDS] at 200 V for 1-2 h using either the Bio-
Rad Mini-Protean System III or the Sigma vertical gel electrophoresis unit. BenchMark Pre-
stained Protein standard (Invitrogen; 190 kDa, 120 kDa, 85kDa, 60 kDa, 50 kDa, 40 kDa, 25
kDa, 20 kDa, 15 kDa, 10 kDa) and BenchMark Fluorescent Protein standard (Invitrogen; 155
kDa, 100 kDa, 65kDa, 41 kDa, 33 kDa, 23 kDa, 12 kDa) were used as guides to estimate the
protein molecular mass.
![Page 92: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/92.jpg)
Materials and Methods
64
2.12.4 In-gel fluorescence
In-gel fluorescence was performed as described before (Drew et al., 2006) with some
modifications. Purified protein samples were mixed 1:1 with buffer A (Section 2.12.1) and
heated at 37ºC for 5 min. The whole cell (Section 2.12.1) and WM (Section 2.12.2) samples;
and purified protein samples were separated on 15% (w/v) SDS polyacrylamide gels and
BenchMark Fluorescent Protein Standard (Section 2.12.3) was used as a molecular mass
standard. Gels were rinsed with distilled water and fluorescent imaging of the gel was
performed to detect the protein expression with a Bio-Rad Gel Doc XR + System using Image
Lab software (excitation at 485 nm and emission at 512 nm).
2.12.5 Coomassie blue staining
Protein samples separated on SDS-PAGE (Section 2.12.2) were stained with Coomassie Blue
staining solution [45% (v/v) methanol, 10 % (v/v) glacial acetic acid, and 0.3 % (w/v)
Coomassie Brilliant Blue R-250 (Thermo Scientific)] for overnight at RT with agitation, then
destained with destaining solution [40% (v/v) methanol, 10 % (v/v) glacial acetic acid] until
the background stain was removed.
2.12.6 Western immunoblotting
Proteins separated on SDS-PAGE (Section 2.12.3) were transferred to a 0.45 µm
nitrocellulose membrane (Bio-Rad) for 1-2 h at 400 mA in transfer buffer [3.06 g/litre Tris,
0.2 M glycine, 5% (v/v) methanol]. The membrane was blocked for 1 h at RT with 5% (w/v)
skim milk in TTBS [2.4 g/litre Tris, 0.12 M NaCl, 0.05% (v/v) Tween 20 (Sigma)] and then
incubated with the appropriate primary antibody (Section 2.4) in the same TTBS buffer for
overnight at RT. The membrane was then washed 3 times with TTBS (10 min each) followed
by incubation in appropriate secondary antibody in TTBS buffer for 2 h at RT. Then the
membrane was washed 3 times with TTBS (5 min each) and 3 times with TBS [2.4 g/litre
Tris, 0.12 M NaCl] (5 min each). Chemiluminescent Peroxidase Substrate-3 (Sigma) was
used following the manufacturer’s protocol for detection. The membrane was then exposed to
![Page 93: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/93.jpg)
Materials and Methods
65
an X-ray film. For visualisation of bands of interest the film was developed using a Curix 60
automatic X-ray film processor (AGFA).
2.12.7 Over-expression of WzySf-GFP-His8
Bacterial strains harbouring pRMPN1 plasmid (pWaldo-TEV-wzySf-GFP-His8) (Table 2.2)
were grown for 16-18 h at 37°C in LB broth with appropriate antibiotics and then diluted 1/20
into fresh LB broth and grown to mid-exponential phase (OD600 of ~ 0.4 to 0.6). Where
required, the growth medium was supplemented with 0.2% (w/v) glucose to suppress protein
expression. Before induction, cells were centrifuged (2,200 x g, Sigma 3K15 tabletop
centrifuge, 10 min, 4°C) and washed twice with LB broth to remove glucose. Under induction
conditions, 0.4 mM IPTG or 0.2% (w/v) L-arabinose was added to the cultures, and they were
grown for 20 h at 20°C. Antibiotics were added as required to the media. In S. flexneri strains,
the plasmid pAC/pBADT7-1 (Table 2.2) encodes T7 RNA polymerase which drives the
expression of the wzySf-gfp gene in pRMPN1 plasmid.
2.12.8 Purification of His-tagged membrane protein
WzySf-GFP-His8 was purified following the method of Woodward et al. (2010) with some
modifications. PNRM15 [Lemo21(DE3) (pRMPN1)] strain were grown for 16-18 h at 37 °C
in LB broth with appropriate antibiotics and then diluted 1/20 into fresh LB broth and grown
to mid-exponential phase (OD600 of ~ 0.4-0.6). Then 0.4 mM IPTG was added to the cultures,
and they were grown for 20 h at 20°C. Cells were harvested from 200 ml induced culture by
centrifugation (9600 x g, Beckman Coulter Avanti J-26XP centrifuge, 8 min, 4°C) and the
cell pellet was washed with sonication buffer (20 mM Tris-HCl, 150 mM NaCl, pH7.5)
followed by disruption of the cell by sonication. Cell debris was removed by centrifugation
(2200 x g, SIGMA 3K15 table top centrifuge, 10 min, 4°C). Then the WM fraction was
isolated by ultracentrifugation (Beckman Coulter Optima L-100 XP ultracentrifuge, 250,000 x
g, 1 h, 4°C) and solubilised in 500 µl Milli Q water and 500 µl 2x solubilisation buffer [40
mM Tris-HCl, 300 mM NaCl, 10% (w/v) sodium dodecanoyl sarcosine (SDDS) (Anatrace),
pH 7.5] at 4°C for overnight. Unsolubilised material was removed by ultracentrifugation
![Page 94: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/94.jpg)
Materials and Methods
66
(Beckman Coulter Optima Max-XP tabletop ultracentrifuge, 160,000 x g, 1 h, 4°C) and the
solubilised supernatant was incubated with 100 µl IMAC Ni-Charged Resin (Bio-Rad) pre-
equilibrated with equilibration buffer [20 mM Tris-HCl, 150 mM NaCl, 5 mM imidazole,
0.1% (w/v) n-dodecyl-"-Dmaltopyranoside (DDM) (Sigma), 10% (v/v) glycerol, pH 7.5] for
1 h at RT. Incubated Ni-NTA beads were washed with wash buffers [20 mM Tris-HCl, 150
mM NaCl, 0.1% (w/v) DDM, 10% (v/v) glycerol, pH 7.5] of different imidazole
concentrations (10 mM, 20 mM, and 50 mM). Finally, WzySf-GFP-His8 was eluted in 200 µl
elution buffer [20 mM Tris-HCl, 150 mM NaCl, 250 mM imidazole, 0.1% (w/v) DDM, 10%
(v/v) glycerol, pH 7.5].
2.12.9 In vivo chemical crosslinking
In vivo crosslinking with DSP was performed as described before (Daniels & Morona, 1999)
with some modifications. Overnight cultures were diluted 1:20 in LB with antibiotics and
incubated at 37ºC to an OD600 of ~0.4-0.6 and centrifuged. Cultures were induced where
required. 200 ml cultures were centrifuged (9600 x g, Beckman Coulter Avanti J-26XP
centrifuge, 8 min, 4°C) and the pellets were washed with DSP cross-linking buffer [150 mM
NaCl, 20 mM sodium phosphate buffer (Na2PO4/NaH2PO4), pH 7.2]. Then the pellets were
resuspended in 200 ml of DSP cross-linking buffer followed by cross-linking with 0.2 mM
DSP for 45 min at 37°C. Excess DSP was quenched with 20 mM Tris-HCl, pH 7.5 and the
cells were washed again with DSP cross-linking buffer. Harvested cells were then either
stored at -20°C or immediately disrupted by sonication for protein purification.
2.12.10 Co-purification or pull down
Cells (from Section 2.12.9) were washed with sonication buffer (20 mM Tris-HCl, 150 mM
NaCl, pH 7.5) and were disrupted by sonication (Branson B15) followed by centrifugation
(2200 x g, SIGMA 3K15 table top centrifuge, 10 min, 4°C) to remove cell debris. Then the
WM fractions were isolated by ultracentrifugation (Beckman Coulter Optima L-100 XP
ultracentrifuge, 250,000 x g, 1 h, 4°C) and were solubilised in 1 ml solubilisation buffer [20
mM Tris-HCl, 0.5 M NaCl, 20 mM imidazole, 4% (w/v) DDM, 10% (v/v) glycerol, pH 7.5]
![Page 95: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/95.jpg)
Materials and Methods
67
overnight at 4°C. Unsolubilised material was removed by ultracentrifugation (Beckman
Coulter Optima Max-XP tabletop ultracentrifuge, 160,000 x g, 1 h, 4 °C). Then the soluble
material was incubated with 200 µl of Ni-NTA resin (QIAGEN) pre-equilibrated with
equilibration buffer [20 mM Tris-HCl, 500 mM NaCl, 20 mM imidazole, 0.1% (w/v) DDM,
10% (v/v) glycerol, pH 7.5] for 1 h at RT. The Ni-NTA resin was washed with wash buffers
[20 mM Tris-HCl, 500 mM NaCl, 0.1% (w/v) DDM, 10% (v/v) glycerol, pH 7.5] of different
imidazole concentrations (20 mM, 30 mM, 50 mM, and 80 mM). Finally, the proteins were
eluted from the resin with 200 µl of elution buffer [20 mM Tris-HCl, 500 mM NaCl, 250 mM
imidazole, 0.1% (w/v) DDM, 10% (v/v) glycerol, pH 7.5].
2.12.11 Proteomics analysis
Liquid chromatography-electrospray ionisation tandem mass spectrometry (LC-ESI-MS/MS)
was performed at the Adelaide Proteomics Centre. Protein samples were electrophoresed on
4-12% SDS-PAGE gels (Catalogue number NPO322BOX, Invitrogen) followed by staining
with Brilliant Blue G (Sigma). Novex sharp unstained protein standard (Thermo Fisher
Scientific) was used as molecular mass standard. Regions and bands of interest were excised
and destained with 100 mM ammonium bicarbonate (NH4HCO3) in 30% (v/v) acetonitrile
(ACN). Samples were then washed with 50 mM NH4HCO3, reduced with 0.5 µmol DDT in
50 mM NH4HCO3, and alkylated with 2.75 µmol iodoacetamide in 100 mM NH4HCO3
followed by digestion with 100 ng trypsin (Promega) in 5 mM NH4HCO3 in 10% (v/v) ACN.
Resulting peptides were extracted using three washes of 1% (v/v) formic acid (FA) in water,
1% (v/v) FA in 50% (v/v) ACN, and 100% (v/v) ACN, respectively. The volumes of the
resulting peptide extracts were reduced by vacuum centrifugation to approximately 1 µl and
resuspended with 0.1% (v/v) formic acid in 2% (v/v) ACN to a totalvolume of 10 µl prior to
LC-ESI-MS/MS analysis. LC-ESI-MS/MS was performed using an Ultimate 3000 nano-flow
system (Dionex) coupled to an Impact II QTOFmass spectrometer (Bruker Daltonics) via an
Advance CaptiveSpray source (Bruker Daltonics). Post acquisition, acquired spectra were
subjected to peak detection and deconvolution using Compass Data Analysis for OTOF
![Page 96: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/96.jpg)
Materials and Methods
68
(Version 1.7, Bruker Daltonics). Processed MS/MS spectra were then exported to Mascot
generic format and submitted to Mascot (Version 2.3.02) for identification.
2.13 Lipopolysaccharide (LPS) Techniques
2.13.1 Preparation of LPS samples
LPS samples were prepared as described previously (Hitchcock & Brown, 1983). Overnight
culture of bacteria was diluted 1:20 and at 37ºC with aeration to OD600 of ~0.6. If required the
culture was induced. The equivalent of 109 bacteria were harvested by centrifugation (16,000
x g, 1 min, 4ºC, Eppendorf Centrifuge 5415R) and resuspended in 50 µl lysing buffer [10%
(w/v) glycerol, 2% (w/v) SDS, 4% (w/v) "-ME, 0.1% (w/v) bromophenol blue, 1 M Tris-HCl,
pH 7.6]. Samples were heated for 5-10 min at 100ºC, then 10 µl of 2.5 mg/ml proteinase K
(Invitrogen) was added followed by incubation at 56ºC for ~16 h. LPS samples were stored at
-20ºC or used immediately.
2.13.2 Analysis of LPS by silver-stained SDS-PAGE
Silver-staining was performed as described previously (Tsai & Frasch, 1982) with minor
changes. LPS samples (Section 2.13.1) were heated at 100ºC for 5-10 min. Then 5-10 µl of
the heated samples were loaded on an SDS 15% (w/v) polyacrylamide gel and eletrophoresed
using the Sigma vertical gel electrophoresis unit (gel dimension: 16.5 cm x 22 cm) at 12 mA
for 16-18 h. The gel was fixed for 2 h in fixing solution [40% (v/v) ethanol, 5% (v/v) glacial
acetic acid in Milli Q water] with gentle agitation and then oxidised in oxidising solution
[40% (v/v) ethanol, 5% (v/v) glacial acetic acid, 0.7% periodic acid in Milli Q water] for 5
min. After 1.5-2 h washing in Milli Q water (changed water at 15 min intervals), the gel was
stained for 10 min in staining solution [2 ml NH4OH, 0.12 g NaOH, 1 g solid silver nitrate in
150 ml Milli Q water]. The gel was washed again in Milli Q water for 1 h (changed water at
10 min intervals) and developed with pre-warmed (42ºC) developing solution [50 mg/ml
citric acid in 1 litre Milli Q water (warmed to 42ºC) with 500 µl 37% (v/v) formaldehyde
![Page 97: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/97.jpg)
Materials and Methods
69
solution (added just prior to developing)] and stopped by addition of the stopping solution
[4% (v/v) glacial acetic acid in Milli Q water].
![Page 98: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/98.jpg)
!
70
![Page 99: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/99.jpg)
!
71
Chapter 3
Mutational analysis of the Shigella flexneri O antigen
polymerase Wzy; identification of Wzz-dependent Wzy mutants
![Page 100: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/100.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
72
Mutational analysis of the Shigella flexneri O antigen
polymerase Wzy; identification of Wzz-dependent Wzy
mutants
Pratiti Nath, Elizabeth Ngoc Hoa Tran, and Renato Morona
Discipline of Microbiology and Immunology, School of Molecular and
Biomedical Science, University of Adelaide, Adelaide 5005, Australia
J Bacteriol. 2015 Jan 1;197(1):108-19. doi: 10.1128/JB.01885-14. Epub 2014 Oct 13.
![Page 101: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/101.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
73
Statement of Authorship
Title of Paper Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-dependent Wzy mutants
Publication Status Published Publication Details J Bacteriol. 2015 Jan 1;197(1):108-19. doi: 10.1128/JB.01885-14. Epub 2014 Oct
13.
Author Contributions By signing the Statement of Authorship, each author certifies that their stated contribution to the publication is accurate and that permission is granted for the publication to be included in the candidate’s thesis. Name of Principal Author (Candidate)
Pratiti Nath
Contribution to the Paper Performed all experiments, performed analysis on all samples, interpreted data, and wrote manuscript.
Signature
Date 20.5.15
Name of Co-Author Elizabeth Ngoc Hoa Tran Contribution to the Paper Purified His6-ColE2 and constructed the strain RMA4337.
Signature
Date
Name of Co-Author Renato Morona Contribution to the Paper Supervised development of work, helped in data
interpretation, manuscript evaluation, and editing.
Signature
Date
![Page 102: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/102.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
74
Chapter 3: Third paper
3.1 Abstract
The O antigen (Oag) component of lipopolysaccharide (LPS) is a major virulence determinant
of Shigella flexneri and is synthesied by the Oag polymerase, WzySf. Oag chain length is
regulated by chromosomally encoded WzzSf and pHS-2 plasmid encoded WzzpHS2. To
identify functionally important amino acid residues in WzySf, random mutagenesis was
performed on the wzySf in a pWaldo-TEV-GFP plasmid, followed by screening with colicin
E2. Analysis of the LPS conferred by mutated WzySf proteins in the wzySf deficient ("wzy)
strain identified 4 different mutant classes, with mutations found in the Periplasmic Loops
(PL) - 1, 2, 3, and 6; Trans-membrane (TM) regions - 2, 4, 5, 7, 8, and 9; and Cytoplasmic
Loops (CL) - 1 and 5. The association of WzySf and WzzSf was investigated by transforming
these mutated wzySf plasmids into a wzySf and wzzSf deficient ("wzy "wzz) strain. Comparison
of the LPS profiles in the "wzy and "wzy "wzz backgrounds identified WzySf mutants whose
polymerisation activity was WzzSf-dependent. Colicin E2 and bacteriophage Sf6c sensitivities
were consistent with the LPS profiles. Analysis of the expression levels of the WzySf-GFP
mutants in the "wzy and "wzy "wzz backgrounds identified a role for WzzSf in WzySf
stability. Hence, in addition to its role in regulating Oag modal chain length, WzzSf also
affects WzySf activity and stability.
3.2 Introduction
Shigella flexneri lipopolysaccharide (LPS) is crucial for pathogenesis (Sperandeo et al.,
2009). LPS is exclusively located in the outer leaflet of the outer membrane (OM) and has
three domains: 1) Lipid A - a hydrophobic domain which anchors LPS to the OM, 2) the core
oligosaccharides - a non-repeating oligosaccharide domain, and 3) the O-antigen (Oag)
polysaccharide - an oligosaccharide repeat domain (Sperandeo et al., 2009) (Raetz &
Whitfield, 2002). The complete LPS structure with Oag chains is termed smooth LPS (S-
LPS). However, the LPS structure lacking the Oag is termed rough LPS (R-LPS), and LPS
![Page 103: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/103.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
75
with a single Oag tetrasaccharide repeat unit (RU) attached to the Lipid A and core sugar is
termed semi-rough LPS (SR-LPS) (Morona et al., 1994). S. flexneri is subdivided into various
serotypes depending on the differences in the composition of LPS Oag. So far there are 17
known serotypes of S. flexneri (Sun et al., 2013b). Except for S. flexneri serotype 6, the Oag
of all other serotypes has the same polysaccharide backbone containing three L-rhamnose
residues (Rha), and one N-acetylglucosamine (GlcNAc). This basic Oag structure is known as
serotype Y. Addition of either glucosyl, O-acetyl, or phosphoethanolamine (PEtN) groups by
various linkages to the sugars of the Y serotype tetrasaccharide repeat creates different S.
flexneri serotypes (Allison & Verma, 2000; Sun et al., 2012; Wang et al., 2010b). Oag is the
protective antigen as immunity against the S. flexneri infection is serotype specific (Jennison
& Verma, 2004; Stagg et al., 2009). S-LPS confers resistance to complement (Hong & Payne,
1997) and colicins (Tran et al., 2014; van der Ley et al., 1986), and Y serotype Oag acts as a
receptor to bacteriophage Sf6 (Lindberg et al., 1978).
S. flexneri Oag biosynthesis occurs by the Wzy-dependent pathway. Most of the Oag
biosynthesis genes (except wecA) of S. flexneri are located in the Oag biosynthesis locus
between galF and his (Allison & Verma, 2000; Morona et al., 1995). S. flexneri Oag
biosynthesis occurs on either side of the inner membrane (IM). Initially N-acetylglucosamine
phosphate (GlcNAc-1-P) is transferred from uridine diphosphate-GlcNAc (UDP-GlcNAc) by
WecA to undecaprenol phosphate (Und-P) at the cytoplasmic side of the IM (Guo et al.,
2008; Liu et al., 1996; Wang et al., 2010b). RfbG and RfbF then add Rhamnose (Rha)
residues from thymidine diphospho-rhamnose (dTDP-Rha) to the GlcNAc (Macpherson et al.,
1995; Morona et al., 1994) to form the O unit. In the Wzy-dependent model of LPS assembly,
the flippase protein Wzx translocates this O unit to the periplasmic side. At the periplasmic
side, the O units are polymerised at the non-reducing end by the Oag polymerisation protein
Wzy via a block transfer mechanism to form the polymer. The chain length of the final Oag is
regulated by the protein Wzz (Daniels et al., 1998; Morona et al., 1994). Finally, the Oag
ligase WaaL ligates the Oag chains to the previously synthesied core-lipid A. The Lpt
proteins (Lpt A-G) then transport the LPS from the IM to the OM (Ruiz et al., 2008;
![Page 104: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/104.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
76
Sperandeo et al., 2009).
The Oag polymerisation protein WzySf is encoded by the rfc/wzy gene. WzySf is a 43.7
kDa hydrophobic integral membrane protein. It has 12 transmembrane (TM) segments and
two large periplasmic (PL) domains (Daniels et al., 1998; Morona et al., 1994). Based on a
topology model proposed by our group, the amino and carboxy terminal ends are located on
the cytoplasmic side of the IM. The wild type (WT) wzySf gene lacks a detectable ribosome
binding site, and has a low G+C %, and a high percentage of minor codons in the first 25
amino acids, contributing to low expression and poor detection of the protein (Daniels et al.,
1998; Morona et al., 1994).
Islam et al. (2011) performed extensive work on Pseudomonas aeruginosa Wzy
(WzyPa) and showed that both PL3 and PL5 of WzyPa contain RX10G motifs, which are
important for the functioning of WzyPa. They also found several Arg residues within these
two motifs are also important for WzyPa function (Islam et al., 2011). However there is little
sequence identity between WzyPa and WzySf. So, it is not possible to predict the functional
amino acid residues of WzySf from another model.
Wzz is a member of the polysaccharide co-polymerase (PCP) family. S. flexneri has two
types of Wzz - chromosomally encoded WzzSf and pHS-2 plasmid encoded WzzpHS2. S.
flexneri 2a has S-LPS with two types of modal chain length: short (S) type (11-17 Oag RUs)
and very long (VL) type (>90 Oag RUs), and the S-type and VL-type Oag chain lengths are
determined by WzzSf and WzzpHS2, respectively. Controlling Oag chain length is crucial for
bacterial virulence, and loss of WzzSf mediated Oag modal chain length regulation affects
virulence due to masking of the OM protein IcsA (Morona et al., 2003; Morona & Van Den
Bosch, 2003b). Daniels and Morona (1999) showed that WzzSf forms a dimer in vivo and may
oligomerise up to a hexamer. Formation of these large complexes is consistent with the
hypothetical complex formation between Wzz and other enzymes of the Oag biosynthesis
pathway, including Wzy (Bastin et al., 1993; Morona et al., 1995). WzzSf and WzzpHS2
compete for the available WzySf (Carter et al., 2009).
![Page 105: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/105.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
77
Woodward et al. (2010) showed that Wzz and Wzy are sufficient to determine the Oag
modal chain length. There are several proposed mechanisms for modal length control by Wzz
and its association with Wzy: a molecular clock model was proposed by Bastin et al. (1993)
and a molecular chaperone model was proposed by Morona et al. (1995). Tocilj et al. (2008)
suggested that Wzz may form a scaffold and recruits Wzy. However, there is no direct
evidence to date on how these proteins are associated with each other in Oag polymerisation
and chain length control.
In this study we were able to overexpress and detect WzySf-GFP expression in S.
flexneri. We performed random mutagenesis on wzySf, and following screening with colicin
E2, for the first time identified amino acid residues important for WzySf function. We
classified the wzySf mutants based on their LPS profiles. We were able to determine mutant
protein expression levels, and also characterised the mutants depending on the phage and
colicin sensitivities they conferred. These findings provided insight to Wzy structure and
function. We further identified WzzSf-dependent WzySf mutants, and identified a novel role
for WzzSf in WzySf Oag polymerisation activity and stability, in addition to its role in
regulating Oag modal chain length.
3.3 Materials and Methods
3.3.1 Bacterial strains and plasmids
The strains and plasmids used in this study are shown in Table 3.1.
3.3.2 Growth media and growth conditions
The growth media used were Lysogeny broth (LB) (10 g/liter tryptone, 5 g/liter yeast extract,
5 g/liter NaCl) and LB agar (LB broth, 15 g/liter bacto agar).
![Page 106: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/106.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
78
Table 3.1 Bacterial strains and plasmids used in this study
Strains or Plasmids Characteristics* Reference Strains S. flexneri PE638 S. flexneri Y rpoB (Rifr) (Morona et al., 1995)
recruiWzy RMM109 PE638!wzy, Rifr (Morona et al., 1994) RMA4337 RMM109 !wzz (Rifr, Tetr) This study PNRM6 RMM109 (pAC/pBADT7-1) This study PNRM11 PNRM6 (pWaldo-TEV-GFP) This study PNRM13 PNRM6 (pRMPN1) This study PNRM75 PNRM6 (pRMPN7) This study PNRM76 PNRM6 (pRMPN8) This study PNRM77 PNRM6 (pRMPN9) This study PNRM78 PNRM6 (pRMPN10) This study PNRM79 PNRM6 (pRMPN11) This study PNRM80 PNRM6 (pRMPN12) This study PNRM81 PNRM6 (pRMPN13) This study PNRM82 PNRM6 (pRMPN14) This study PNRM83 PNRM6 (pRMPN15) This study PNRM84 PNRM6 (pRMPN16) This study PNRM85 PNRM6 (pRMPN17) This study PNRM119 PNRM6 (pRMPN19) This study PNRM120 PNRM6 (pRMPN21) This study PNRM121 PNRM6 (pRMPN22) This study PNRM122 PNRM6 (pRMPN23) This study PNRM123 PNRM6 (pRMPN24) This study PNRM124 PNRM6 (pRMPN25) This study PNRM126 RMA4337 (pAC/pBADT7-1) This study PNRM134 PNRM126 (pRMPN1) This study PNRM131 PNRM126 (pRMPN7) This study PNRM132 PNRM126 (pRMPN15) This study PNRM133 PNRM126 (pRMPN16) This study
![Page 107: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/107.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
79
Table 3.1 continued Strains or Plasmids Characteristics* Reference S. flexneri PNRM136 PNRM126 (pRMPN8) This study PNRM137 PNRM126 (pRMPN10) This study PNRM140 PNRM126 (pRMPN13) This study PNRM141 PNRM126 (pRMPN14) This study PNRM142 PNRM126 (pRMPN9) This study PNRM143 PNRM126 (pRMPN11) This study PNRM144 PNRM126 (pRMPN19) This study PNRM145 PNRM126 (pRMPN24) This study PNRM146 PNRM126 (pRMPN25) This study PNRM147 PNRM126 (pRMPN23) This study PNRM148 PNRM126 (pRMPN21) This study PNRM149 PNRM126 (pRMPN22) This study PNRM150 PNRM126 (pRMPN12) This study PNRM151 PNRM126 (pRMPN17) This study E.coli XL10-Gold
Tetr !(mcrA)183 !(mcrCB-hsdSMR-mrr)173
endA1 supE44 thi-1 recA1 gyrA96 relA1 lac
(F´ proAB lacIqZDM15 Tn10Tetr Cmr)
Stratagene
Lemo21(DE3)
fhuA2 (lon) ompT gal ($ DE3) (dcm) "hsdS/
pLemo(Cmr)
New England Biolabs
PNRM15 Lemo21(DE3) (pRMPN1) This study Plasmids pRMCD6 Source of wzySf (Daniels et al., 1998) pAC/pBADT7-1 Source of T7 RNA polymerase; Cmr (McKinney et al.,
2002) pWaldo-TEV-GFP Cloning vector with GFP tag; Kmr (Waldo et al., 1999) pRMPN1 pWaldo-wzySf-GFP; Kmr This study pRMPN7 pRMPN1 with G130V point mutation in the
wzySf gene
This study
pRMPN8 pRMPN1 with L111I point mutation in the
wzySf gene
This study
![Page 108: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/108.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
80
Table 3.1 continued Strains or Plasmids Characteristics* Reference Plasmids pRMPN9 pRMPN1 with N86K point mutation in the
wzySf gene
This study
pRMPN10 pRMPN1 with L28V point mutation in the
wzySf gene
This study
pRMPN11 pRMPN1 with P165S point mutation in the
wzySf gene
This study
pRMPN12 pRMPN1 with G82C point mutation in the
wzySf gene
This study
pRMPN13 pRMPN1 with N147K point mutation in the
wzySf gene
This study
pRMPN14 pRMPN1 with L191F point mutation in the
wzySf gene
This study
pRMPN15 pRMPN1 with L214I point mutation in the
wzySf gene
This study
pRMPN16 pRMPN1 with P352H point mutation in the
wzySf gene
This study
pRMPN17 pRMPN1 with V92M point mutation in the
wzySf gene
This study
pRMPN19 pRMPN1 with F52Y point mutation in the
wzySf gene
This study
pRMPN21 pRMPN1 with F52C/I242T point mutations in
the wzySf gene
This study
pRMPN22
pRMPN1 with C60F point mutation in the
wzySf gene
This study
pRMPN23 pRMPN1 with Y137H point mutation in the
wzySf gene
This study
pRMPN24 pRMPN1 with L49F/T328A point mutation in
the wzySf gene
This study
![Page 109: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/109.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
81
Table 3.1 continued Strains or Plasmids Strains or Plasmids Strains or Plasmids Plasmids Plasmids Plasmids pRMPN25 pRMPN1 with F54C point mutation in the
wzySf gene
This study
pCACTUS Suicide vector containing sacB, Cmr, and
Orits
(Morona et al., 1995)
pRMA577 Suicide vector contatining SphI-SphI
fragment with the rol gene
(Morona et al., 1995)
pCACTUS-
wzzSf::Tcr
Suicide mutagenesis construct to construct the
strain RMA4337
This study
* Rifr, rifampicin resistant; Kmr, kanamycin resistant; Cmr, chloramphenicol resistant; Tetr,
tetracycline resistant. $ DE3 is $ sBamHIo "EcoRI-B int::(lacI::PlacUV5::T7gene1)i21
"nin5. pLemo is pACYC184-PrhaBAD-lysY.
![Page 110: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/110.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
82
Unless otherwise stated strains were grown in LB broth with aeration for 18 h at 37°C,
then diluted 1/20 into fresh LB broth and grown to mid-exponential phase (OD600 of 0.4 -
0.6). Where required growth medium was supplemented with 0.2% (w/v) glucose to suppress
protein expression. Before induction, cells were centrifuged (2200 x g, SIGMA 3K15 table
top centrifuge, 10 min, 4°C) and washed twice with LB broth to remove glucose. Under
induction conditions, 0.4 mM isopropyl-!-D-thiogalactopyranoside (IPTG) or 0.2% (w/v) or
L-arabinose was added to cultures and grown for 20 h at 20°C. Antibiotics were added as
required to the media at the following final concentrations: kanamycin (Km), 50 µg/ml and
chloramphenicol (Cm), 25 µg/ml.
3.3.3 Construction of expression vector and cloning of wzySf
Primers PN1_wzySfKpnF and PN2_wzySfBamHR (Supplementary Table 3.S1) which
incorporated KpnI and BamHI restriction sites, respectively, were used to amplify the
previously mutated wzySf coding region (GenBank accession number X71970) in the
pRMCD6 plasmid (Table 3.1), possessing three changes at codons 4, 9 and 23 (Daniels et al.,
1998). The rare codons 4, 9 and 23 are present in the translation initiation site of WzySf and
causes lower expression of the wild-type WzySf. The codons ATA, ATA and AGA at 4, 9 and
23 were changed to ATT, ATT and CGT, respectively, and resulted in increased expression of
WzySf (Daniels et al., 1998). Following restriction digestion with enzymes BamHI and KpnI,
the amplified wzySf was ligated into similarly digested pWaldo-TEV-GFP (Waldo et al.,
1999), resulting in the plasmid pWaldo-wzySf-TEV-GFP (denoted pRMPN1). PCR, restriction
enzyme digestion, agarose gel electrophoresis, ligation, and transformation were performed as
described previously (Morona et al., 1994; Morona et al., 1995).
![Page 111: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/111.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
83
3.3.4 WzySf expression in Lemo21(DE3) and In-gel fluorescence
For WzySf expression in Lemo21(DE3) cells (Table 3.1), strains were induced with IPTG and
the over-expressed WzySf-GFP fusion protein was detected by In-gel fluorescence following
the method of Drew et al. (2006) with some modifications. Cells (5X108) were harvested
from the induced culture and washed twice in 200 &l phosphate buffered-saline (PBS). The
pellet was re-suspended in 20 &l PBS and 20 &l Buffer A [200 mM Tris-HCl (pH 8.8), 20%
(v/v) glycerol, 5 mM EDTA (pH 8.0), 0.02% (w/v) bromophenol blue, 4% (w/v) SDS, and
0.05 M DDT] was then added to the cell suspension. The solubilised cell suspension was
incubated at 37°C for 5 min. Samples were then electrophoresed on SDS 15% (w/v)
polyacrylamide gels (SDS-15% PAGE) and BenchMark Pre-Stained Protein Ladder
(Invitrogen) was used as a molecular mass standard. The gel was rinsed with distilled water
and fluorescent imaging of the gel was performed to detect WzySf-GFP protein expression
with a Bio-Rad Gel Doc XR + System using Image Lab software (excitation at 485 nm and
emission at 512 nm).
3.3.5 LPS method
LPS was prepared as described previously (Murray et al., 2003; Tsai & Frasch, 1982). To
prepare LPS samples, 1X109 cells were harvested and resuspended in lysing buffer [Buffer B
- 10% (w/v) glycerol, 2% (w/v) SDS, 4% (w/v) !-mercaptoethanol, 0.1% (w/v) bromophenol
blue, 1 M Tris-HCl, pH 7.6] and incubated with 2 µg/ml of proteinase K for approximately 16
h. The LPS samples were then electrophoresed on an SDS-15% PAGE for 16 to 18 h at 12
mA. The gel was stained with silver nitrate and developed with formaldehyde (Murray et al.,
2003).
![Page 112: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/112.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
84
3.3.6 Random mutagenesis
Random mutagenesis of wzySf was undertaken to obtain a wide range of wzySf mutations in a
non-selected manner. For PCR random mutagenesis the wzySf coding region in plasmid
pRMPN1 was mutagenised by an error prone DNA polymerase using the GeneMorp II EZ-
Clone Domain Mutagenesis Kit (Catalogue number 200552, Stratagene) according to the
manufacturer’s instructions with the primers PN1_wzySfKpnF and PN2_wzySfBamHR
(Supplementary Table 3.S1). The mutagenised plasmids were transformed into competent
Escherichia coli cells, XL10-Gold (Agilent Technologies). Plasmid DNA was then isolated
from randomly chosen transformed mutated colonies and transformed into strain PNRM6
(Table 3.1). Colicin swab assays were performed to screen the mutants (See below). Plasmid
DNA was isolated from putative mutants, transformed into XL10-Gold cells, and subjected to
DNA sequencing (AGRF, Adelaide, Australia).
3.3.7 Construction of the strain RMA4437 (!wzy !wzz)
The S. flexneri Y PE638 "wzy "wzz mutant strain was constructed using allelic exchange
mutagenesis (Morona et al., 1995) to inactivate the wzzSf gene in RMM109 (Morona et al.,
1994). Initially, a tetracycline resistance (tetr) cartridge was inserted into the BglII site of
pRMA577 (Morona et al., 1995) to inactivate wzzSf, and the resulting pCACTUS-wzzSf::tet
(Table 3.1) plasmid was transformed into RMM109 via electroporation (Purins et al., 2008).
Allelic exchange mutagenesis was performed as previously described (Morona et al., 1995).
The wzzSf::tetr mutation in the chromosome was confirmed by PCR with primers ET35 and
ET36 (Supplementary Table 3.S1) to give the PE638 "wzy "wzz mutant RMA4337.
![Page 113: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/113.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
85
3.3.8 Detection of WzySf expression in S. flexneri
For the detection of WzySf expression in S. flexneri, cells were harvested from the 50 ml 0.2%
(w/v) L-arabinose induced culture by centrifugation (9800 x g, Beckman J2-21M Induction
Drive Centrifuge, 10 min, 4 °C) and the cell pellet was resuspended in 4 ml sonication buffer
(Buffer C, 20 mM Tris-HCl, 150 mM NaCl, pH 7.5). The mixture was then lysed by
sonication, followed by centrifugation (2200 x g, SIGMA 3K15 table top centrifuge, 10 min,
4 °C) to remove debris. Ultracentrifugation was performed in a Beckman Coulter Optima
MAX-XP bench top ultracentrifuge (126000 x g for 1 h at 4 °C) to isolate the whole
membrane (WM) fraction. The WM fraction was resuspended in PBS and then solubilised in
Buffer A. Solubilised WM fraction from 3 X 108 cells was electrophoresed on an SDS-15%
PAGE. The gel was rinsed with distilled water and In-gel imaging was performed as
described above. Loading was checked by staining the gel with Coomassie Blue R-250. The
intensity of WzySf-GFP expression for mutant and control strains was measured by Fiji image
processing package (http://fiji.sc/Fiji) and the percent relative WzySf-GFP intensity for each
mutant strain was measured by comparing the WzySf-GFP intensity of each mutant strain with
WzySf-GFP intensity in the control strain PNRM13.
3.3.9 Colicin sensitivity assay
For the colicin sensitivity assay a solution of purified His6-ColE2 (ColE2) with an initial
concentration of 1 mg/ml was used (Tran et al., 2014).
3.3.9.1 ColE2 swab assay
A two fold serial dilution of 1 µg/ml ColE2 was swabbed onto antibiotic selective LB agar
plates containing 0.2% (w/v) L-arabinose with a cotton swab. Plates were left to dry for 1 h at
![Page 114: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/114.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
86
room temperature (RT). Individual 0.2% (w/v) L-arabinose induced mutant and control LB
cultures were then swabbed perpendicular to the ColE2 streak and plates were left to dry for
another 1 h at RT. Plates were then incubated for 16 h at 37°C. The susceptibility of the
mutant strains compared to the control strain was recorded and the image was taken using a
Canon scanner (CanoScan 9000F) against a dark background.
3.3.9.2 ColE2 spot assay
The spot assay was performed using the serial dilutions of ColE2. 100 µl of the individual L-
arabinose induced mutant and control strain cultures were spread onto LB agar plates with
appropriate antibiotics and 0.2% (w/v) L-arabinose. The plates were left to dry for 2 h at RT.
A 2-fold serial dilution of 1 µg/ml of ColE2 [denoted as Neat or (N)] was spotted on the dried
plates, and plates were left to dry for another 3 h at RT. The plates were then incubated for 18
h at 37°C. The end point of the killing zones of mutant strains was compared with the
controls. Images were recorded as above.
3.3.10 Bacteriophage sensitivity assay
Procedures of phage propagation and phage stock preparation have been described previously
(Mavris et al., 1997; Morona et al., 1994). The concentration of the bacteriophage Sf6c stock
used was 8.6 x 107 p.f.u./ml. Mutant and control strains were grown and induced with 0.2%
(w/v) L-arabinose. 100 µl of the individual mutant and control LB cultures were spread onto
LB agar plates with appropriate antibiotics and 0.2% (w/v) L-arabinose. The plates were left
to dry for 2 h at RT. Serial dilutions of the bacteriophage Sf6c stock (undiluted bacteriophage
Sf6c stock was denoted as N) were spotted on the dried plates and the plates were dried for a
further 3 h at RT. The plates were incubated for 18 h at 37°C. Phage sensitivity of the test
strains were compared with the controls. Images were recorded as above.
![Page 115: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/115.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
87
3.4 Results
3.4.1 Construction of a WzySf-GFP expression plasmid
A suitable expression system was constructed to express wzySf and to detect WzySf by fusion
to GFP (Drew et al., 2006). S. flexneri 2457T 2a wzySf with three modified codons at postions
4, 9, 23 in pRMCD6 plasmid (Daniels et al., 1998) was PCR amplified and ligated into
pWaldo-TEV-GFP (Table 3.1) (See Materials and Methods). To confirm the construct was
able to express WzySf-GFP-His8 protein, pWaldo-wzySf-TEV-GFP-His8 (denoted as pRMPN1)
was transformed into Lemo21(DE3) cells. Whole cell In-gel fluorescence samples were then
prepared from PNRM15 [Lemo21(DE3), (pRMPN1)] and fluorescent imaging of the gel
detected a fluorescent band at approximately 64 kDa, which corresponded to the predicted
size of the WzySf-GFP protein (Supplementary Fig. 3.S1, lane 1), indicating that the construct
was able to express WzySf-GFP.
3.4.2 Complementation of wzySf deficiency
A complementation assay was performed to confirm the functionality of WzySf-GFP. For this
assay pRMPN1 was co-transformed along with pAC/pBADT7-1 (McKinney et al., 2002) into
a wzySf deficient strain RMM109 (Morona et al., 1994). RMM109 has a frameshift mutation
at position 9214 in the wzySf gene that results in premature termination of WzySf synthesis
(Morona et al., 1994). pAC/pBADT7-1 encodes T7 RNA polymerase, which drives the
expression of wzySf-GFP in pRMPN1. LPS samples were prepared from these control strains.
The silver-stained gel showed that PNRM6 [RMM109 (pAC/pBADT7-1)] had an SR-LPS
profile (Fig. 3.1, lane 3). But the PNRM13 [PNRM6 (pRMPN1)] had an S-LPS profile (Fig.
3.1, lane 5). Hence, pRMPN1 was able to complement the wzySf mutation in RMM109, and
the LPS profile resembled that of the WT strain PE638 (Fig. 3.1, lane 2).
![Page 116: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/116.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
88
Figure 3.1 Complementation of wzySf deficiency by WzySf-GFP LPS samples (equivalent to 1X109 bacterial cells) were prepared from the indicated strains by
proteinase K treatment, electrophoresed on an SDS-15% (w/v) PAGE gel, and silver stained
(see Materials and Methods). The positions of S-LPS, SR-LPS, and R-LPS are indicated. The
numbers on the right indicate the Oag RUs.
![Page 117: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/117.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
89
3.4.3 Random mutagenesis of wzySf
Nothing is known about the residues important for WzySf function, and there is little sequence
identity between Wzy proteins of different bacterial species. Hence, it is difficult to predict
the functional amino acid residues of the S. flexneri WzySf. To obtain insight into the WzySf
residues needed for function, wzySf coding region in plasmid pRMPN1 was subjected to
random mutagenesis using an error-prone DNA polymerase (See Materials and Methods).
The resulting mutagenised plasmid library was transformed into PNRM6. We screened the
transformants to find mutants using ColE2. The basis for this is that the R-LPS strains are
more susceptible to the killing by colicins than the S-LPS strains (van der Ley et al., 1986),
and we recently found that there is a strong correlation between LPS Oag modal chain length
and susceptibility to ColE2 (Tran et al., 2014). A ColE2 swab assay (See Materials and
Methods) was used to screen and detect mutants that had a different sensitivity to ColE2
compared to the positive control strain PNRM13 (Supplementary Table 3.S2). Interestingly,
the WT strain PE638 was slightly more resistant to ColE2 compared to the complemented
positive control strain PNRM13 (Supplementary Table 3.S2) (Table 3.2). The wzySf mutant
RMM109 (SR-LPS) was highly sensitive to ColE2 (Supplementary Table 3.S2) (Table 3.2).
Transformants that were either more resistant or more sensitive to ColE2 than PNRM13 were
selected (Supplementary Table 3.S2), and the plasmids isolated and transformed into the
XL10-Gold strain. Plasmid DNA from these isolates was subjected to DNA sequencing to
identify mutational alterations in wzySf. The wzySf mutants had the following substitutions:
P352H, V92M, Y137H, L214I, G130V, N147K, P165S, L191F, C60F, L49F/T328A, L28V,
N86K, F54C, F52Y, L111I, G82C, and F52C/I242T (Supplementary Table 3.S3). The
mutations were present in PL1, 2, 3, and 6; TM 2, 4, 5, 7, 8, and 9; and Cytoplasmic Loops
(CL) 1 and 5 of the WzySf topology map (summarised in Fig. 3.2 and Table 3.2). After
sequence confirmation, the mutated plasmids were transformed into PNRM6 (Table 3.1) for
detailed characterisation.
![Page 118: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/118.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
90
Figure 3.2 Locations of mutations on the topology map of WzySf Mutational alterations are indicated by arrows on the WzySf topology map [adapted from
Daniels et al. (1998)]. The positions of the periplasmic loops (PL 1-5), transmembrane
regions (TM 1-12), and cytoplasmic loops (CL 1-5) are indicated. Mutations (shaded circles)
are located in PL 1, 2, 3, and 6; TM 2, 4, 5, 7, 8, and 9; and CL 1 and 5.
![Page 119: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/119.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-dependent Wzy mutants
91
Table 3.2 ColE2 and bacteriophage Sf6c sensitivities and WzySf-GFP expression of controls and different classes of mutants Mutant class Sensitivity*
Strain Relevant details
!wzy
background
!wzy/!wzz
background
ColE2 Sf6c Relative WzySf-GFP (%) Topology map
location#
!wzy
background
!wzy/!wzz
background
!wzy
background
!wzy/!wzz
background
!wzy
background
!wzy/!wzz
background
RMM109 wzySf mutants 1/256 - R - - - PE638 WT R - 10-6 - - - PNRM13 Positive control 1/2 - 10-5 - 100 - PNRM6 Negative control 1/256 - R - - - PNRM11 Negative control 1/256 - R - - - RMA4337 wzySf and wzzSf mutant - 1/256 - R - - PNRM126 Negative control - 1/256 - R - - PNRM134 Positive control - R - 10-6 - 17 P352H A B PL6 1/64 1/128 R R 36 38 V92M A E PL2 1/32 1/64 R R 84 76 Y137H A E TM5 1/32 1/64 R R 87 97 L214I B C TM8 1/128 1/128 R R 1.4 0.03 G130V C F TM5 1/512 1/128 R R 1.60 28.50 N147K D E PL3 R 1/16 10-6 R 21 52 P165S D E PL3 1/4 1/64 10-5 N 7 125 L191F D E TM7 R 1/16 10-6 N 162 64 C60F D E TM1 R 1/64 10-6 N 30 66 L49F/T328
A
D E TM2/CL5 R 1/64 10-6 R 65 68 L28V D E PL1 R 1/8 10-6 N 55 80 N86K D E PL2 R 1/64 10-6 R 84 82 F54C D E CL1 R 1/64 10-6 R 42 71 F52Y D E TM2 R 1/64 10-6 R 47 63 L111I D E TM4 R 1/8 10-6 N 41 51 G82C D E PL2 R 1/64 10-6 R 40 47 F52C/I242T D E TM2/TM9 R 1/64 10-6 N 82 81
![Page 120: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/120.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
92
# PL, periplasmic loop; TM, transmembrane region; CL, cytoplasmic loop (Fig. 3.2). *R,
resistant; N, plaques detected with undiluted Sf6c stock. The numbers represent the highest
dilution showing the zone of inhibition or plaques formation.
![Page 121: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/121.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
93
3.4.4 LPS phenotype conferred by WzySf mutants
The effect of mutations on WzySf LPS Oag polymerisation activity was determined by SDS-
PAGE and silver staining. Following comparison of the resulting degree of LPS Oag
polymerisation of the mutant strains with the relevant positive control PNRM13, the mutants
were grouped into four different phenotypic classes: A-D (Fig. 3.3 and Supplementary Fig.
3.S2). Three of the 17 mutants had reduced degrees of polymerisation compared to PNRM13
and were classified as class A. Class A mutants had following alterations in WzySf: P352H,
V92M, Y137H (Fig. 3.3, lanes 2-4). One mutant (with L214I alteration in WzySf) exhibited
LPS banding pattern with only a few Oag RUs and was classified as class B (Fig. 3.3, lane
5). Another mutant had SR-LPS (with a G130V alteration in WzySf) and was categorised into
class C (Fig. 3.3, lane 6). The other 12 mutants conferred a LPS profile nearly similar to the
positive control PNRM13 and were classified as class D. Members of this class had the
following mutations: N147K, P165S, L191F, C60F, L49F/T328A, L28V, N86K, F54C,
F52Y, L111I, G82C, F52C/I242T (Fig. 3.3, lanes 7-10 and Supplementary Fig. 3.S2, Lanes 1-
8). For rest of the paper the mutant WzySf proteins will be referred according to their
conferred LPS classes.
3.4.5 WzzSf dependence
Since the Wzy-dependent model of LPS assembly suggests a potential interaction between
Wzy and Wzz, we investigated if the LPS profile conferred by mutated WzySf proteins was
dependent on the presence of WzzSf. All the plasmids encoding mutated WzySf proteins were
transformed into RMA4337 carrying pAC/pBADT7-1 (strain PNRM126) (Table 3.1).
RMA4337 is a wzySf and wzzSf double mutant. The LPS profiles conferred in the PNRM126
(!wzy !wzz) were directly compared with the LPS profile conferred in the !wzy background
(PNRM6). The control strain PNRM134 [PNRM126 (pRMPN1)] had S-LPS without Oag
modal chain length control (Fig. 3.4, lane 3), as expected, and was classified as class E for the
purpose of comparison. PNRM126 with mutated wzySf plasmids that conferred a class A LPS
![Page 122: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/122.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
94
Figure 3.3 LPS phenotypes conferred by different WzySf mutants expressed in PNRM6
[!wzySf (pAC/pBADT7-1)]
Plasmid-encoded mutated WzySf proteins were expressed in PNRM6. The strains were grown
and induced with arabinose as described in Materials and Methods. LPS samples were
prepared, electrophoresed on SDS-15% (w/v) PAGE gels, and silver stained (see Materials
and Methods). The strains were divided into various mutant classes (A-D) based on their LPS
phenotypes. Lane 1, positive-control strain PNRM13 [PNRM6 (pRMPN1)]; lanes 2 to 10,
"wzy strain (PNRM6) with plasmids encoding mutated WzySf proteins, as indicated. The
position of R-LPS is indicated. The numbers on the left indicate the Oag RUs.
![Page 123: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/123.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
95
Figure 3.4 Comparison of the LPS phenotypes conferred by the WzySf mutants
expressed in the !wzy and !wzy !wzz backgrounds
Plasmids encoding mutated WzySf proteins were expressed in PNRM126 [RMA4337
(pAC/pBADT7-1)] and PNRM6 [RMM109 (pAC/pBADT7-1)]. The strains were grown and
induced as described in Materials and Methods. LPS samples were electrophoresed on SDS-
15% (w/v) PAGE gels and silver stained (see Materials and Methods). Lanes1 to 3 contain the
indicated strains; lanes 4 to 21 contain the "wzy (PNRM6) or "wzy "wzz (PNRM126) strain
with plasmids encoding the indicated mutated WzySf proteins.
![Page 124: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/124.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
96
profile in the !wzy background had a class E LPS profile similar to PNRM134, except
PNRM126 expressing WzyP352H had LPS with few Oag RUs (class B) (Fig. 3.4, lane 5).
PNRM126 expressing WzyL214I had SR-LPS (Fig. 3.4, lane 11). However, in comparison
PNRM6 (!wzy) expressing WzyL214I conferred a class B LPS profile (Fig. 3.4, lane 10).
PNRM126 with a mutated wzySf plasmid that conferred a class C LPS profile in the !wzy
background (PNRM6 expressing G130V), had S-LPS without modal length control and a
reduced degree of polymerisation (designated class F) compared to PNRM134 (Fig. 3.4, lane
13). PNRM126 with mutated wzySf plasmids from the strains with class D LPS profile in the
!wzy background, had class E LPS profile, similar to PNRM134 (Fig. 3.4, lanes 14-21 and
Supplementary Fig. 3.S 3, lanes 1-16). Hence certain WzySf mutants conferred dramatically
different LPS profiles depending on the presence and absence of WzzSf.
3.4.6 ColE2 and bacteriophage Sf6c sensitivities
To confirm the LPS profiles determined above using assays of LPS Oag function, the ColE2
and bacteriophage Sf6c sensitivities of the mutant strains were investigated. ColE2 sensitivity
(summarised in Table 3.2) was determined by spot testing as described in the Materials and
Methods. Strains RMM109, PNRM6, PNRM11, RMA4337, and PNRM126 showed killing
zones at a dilution of 1/256. The WT strain PE638 was resistant to the highest concentration
of ColE2 used. The relevant positive control strain in the !wzy background (PNRM13)
showed a killing zone at a dilution of 1/2 but the relevant positive control strain in the !wzy
!wzz background (PNRM134) was resistant to the tested highest concentration of ColE2.
Strains conferring class A LPS profile in the !wzy background were sensitive to ColE2
(killing zone at 1/32 or 1/64). However, !wzy !wzz strains with mutated wzySf plasmids
conferring the class A LPS profile in the !wzy background were two-fold more sensitive to
ColE2 (killing zone at 1/64 or 1/128) compared to the !wzy background. The !wzy strain
expressing WzyL214I (class B), and the !wzy !wzz strain expressing WzyL214I (class C)
had similar ColE2 sensitivity (1/128). The strain with the class C LPS profile (!wzy
expressing WzyG130V) had the greatest sensitivity to ColE2 (1/512), greater than RMM109
and the negative control strains (PNRM6, PNRM11, PNRM126). However, the !wzy !wzz
strain expressing WzyG130V (class F) was more resistant (1/128) to ColE2 compared to the
![Page 125: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/125.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
97
!wzy background. Strains with a class D LPS profile in the !wzy background were resistant
to the tested highest concentration of ColE2, except !wzy expressing WzyP165S showed
slight sensitivity (1/4). Hence, almost all the strains with class D LPS profile in the !wzy
background were more resistant to ColE2 compared to PNRM13 and were similar to PE638.
The !wzy !wzz strains with mutated wzySf plasmids from the strains with class D LPS profile
in the !wzy background were more sensitive to ColE2 (killing zone at 1/8 to 1/64) than the
control PNRM134 [!wzy !wzz (pRMPN1)], suggesting they have slight defect in Oag
polymerisation in the absence of WzzSf. Hence, ColE2 resistance correlated with degree of
Oag polymerisation and degree of LPS capping with Oag.
The bacteriophage Sf6c sensitivity of the strains (summarised in Table 3.2), carrying
mutated wzySf plasmids, was determined by spot testing as described in the Materials and
Methods. The SR-LPS strains RMM109, PNRM6, PNRM11, RMA4337, and PNRM126
were resistant to bacteriophage Sf6c. The S-LPS strains WT PE638, and the controls,
PNRM13 and PNRM134, were bacteriophage Sf6c sensitive, and plaques were detected at
10-6, 10-5, and 10-6 dilutions, respectively. Strains with class A, B, and C LPS profiles in the
!wzy background were resistant to the highest concentration of bacteriophage Sf6c tested and
were similar to the strains with SR-LPS (RMM109, PNRM6, PNRM11, RMA4337, and
PNRM126). Similarly, the !wzy !wzz strains with mutated wzySf plasmids from the strains
with class A, B, and C LPS profiles in the !wzy background were also resistant to the highest
concentration of bacteriophage Sf6c tested. Strains with a class D LPS profile in the !wzy
!wzz background were bacteriophage Sf6c sensitive (plaques at 10-6), except that the strain
expressing WzyP165S was slightly less sensitive (plaque at 10-5). Hence, the bacteriophage
Sf6c sensitivities of the strains with a class D LPS profile in the !wzy background were
greater than that of PNRM13 and similar to that of PE638. !wzy !wzz strains with mutated
wzySf plasmids from the strains with a class D LPS profile in the !wzy background were more
resistant to bacteriophage Sf6c than the !wzy background. Although they have a class E LPS
profile, similar to PNRM134, they were more resistant to bacteriophage Sf6c than PNRM134.
Hence, bacteriophage Sf6c correlated with degree of Oag polymerisation, and degree of LPS
capping with Oag.
![Page 126: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/126.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
98
3.4.7 WzySf expression level
We determined the level of parental and mutant WzySf-GFP expressed in !wzy and !wzy
!wzz S. flexneri strains. To measure the protein expression level of the mutants, In-gel
fluorescence was performed and the % relative WzySf-GFP expression was calculated (See
Materials and Methods). The expression levels of different WzySf-GFP mutants were
compared with that of WzySf-GFP in PNRM13 (100%). The WzySf-GFP expression level in
PNRM134 was less than PNRM13 (Fig. 3.5A and B, lane 2), with a relative WzySf-GFP level
of 17% (Table 3.2). In the !wzy background, most of the WzySf-GFP mutants were expressed
at a level less than 100% except the mutants L191F (class D) had expression of 162% (Fig.
3.5B, lane 7 and Table 3.2). However, in the !wzy !wzz background, the relative WzySf-GFP
level of L191F was 64% (Fig. 3.5B, lane 8 and Table 3.2), which was less than the control
PNRM13. In the !wzy background, the relative WzySf-GFP levels of P165S, L214I, and
G130V were very low (7%, 1.4%, and 1.6% respectively) (Fig. 3.5B, lane 5; Fig. 3.5A, lanes
9 and 11; and Table 3.2). However, in the !wzy !wzz background, P165S and G130V had
relative WzySf-GFP levels of 125% and 28.50%, respectively (Fig. 3.5B, lane 6; Fig 5A, lane
12; and Table 3.2) but the relative WzySf-GFP level of L214I was almost not detectable at
0.03% (Fig. 3.5A, lane 10 and Table 3.2). In the !wzy !wzz background, the relative WzySf-
GFP level of P165S was higher than the control PNRM13 (100%) (Fig. 3.5B, lane 6 and
Table 3.2). These data indicates that expression of certain WzySf mutants was affected by
WzzSf, but the effect was mutant specific.
3.5 Discussion
In this study, we constructed and characterised a collection of wzySf mutants. We found that
ColE2 screening was an effective method to detect wzySf mutants conferring subtle effects on
LPS structure (Table 3.2). The use of WzySf-GFP allowed comparison of the protein
expression level of different mutants. We also found that bacteriophage Sf6c sensitivity was
dependent on LPS phenotype structure. Strains with mutant WzySf conferring longer Oag
chain and/or a greater degree of Oag polymerisation were more sensitive to bacteriophage
![Page 127: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/127.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
99
Figure 3.5 Protein expression levels of the mutated WzySf-GFP compared to the positive
control
The strains were grown in LB and induced as described in Materials and Methods. In-gel
fluorescence samples were prepared from the mutants in the "wzy and "wzy "wzz
backgrounds and electrophoresed on SDS 15% (w/v) PAGE gels (see Materials and
Methods). (A) Lanes 1 and 2 contain the indicated strains; lanes 3 to 12 contain the "wzy or
"wzy "wzz strain expressing mutated WzySf-GFP, as indicated. (B) Lanes 1 and 2 contain the
indicated strains; lanes 2 to 26 contain the "wzy or "wzy "wzz strain expressing mutated
WzySf-GFP, as indicated.
![Page 128: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/128.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
100
Sf6c; while bacteriophage Sf6c only infected strains with WT (or nearly WT) LPS, both in
degree of Oag polymerisation and apparent level of LPS capping with Oag chains.
Only a few studies have been conducted on Wzy proteins. During characterisation of
Wzy of Francisella tularensis, Kim et al. (2010) reported several amino acid residues
important for Oag polymerisation. Modification of these residues (G176, D177, G323, and
Y324) led to a loss of Oag polymerisation (Kim et al., 2010). Islam et al. (2011) showed that
the PL3 and PL5 of WzyPa have net positive and net negative charges respectively, and they
established their “catch-and-release” model. However, for WzySf, we found that at a
physiological pH both the PL3 and PL5 possess net negative charge (pI of PL3 is 4.65 and
PL5 is 5.09). In Pseudomonas aeruginosa PAO1 there is a uronic acid sugar in the Oag
(Knirel et al., 2006), which is negatively charged. However, the Oag of WzySf is neutral. So,
the charged property of the substrate for WzySf is different from the WzyPa.The RX10G motifs
of the PL3 and PL5 of WzyPa (Islam et al., 2011) are also absent in WzySf. However, both PL3
and PL5 of WzySf contained RX15G motifs (starting from R164 in PL3 and R289 in PL5)
(Fig. 3.2). So, perhaps a modified version of the “catch-and-release” mechanism (Islam et al.,
2011) exists for S. flexneri. Moreover, addition of either glucosyl or O-acetyl groups or PEtN
residue by various linkages to the sugars within the tetrasaccharide repeats of serotype Y
creates 17 different serotypes of the S. flexneri (Allison & Verma, 2000; Sun et al., 2012;
Wang et al., 2010b). As the polymerisation of all these Oags is done by WzySf, and we
conclude that WzySf must be quite flexible for its substrate recruitment. Due to scant
homology between wzy proteins of different bacterial species, we were unable to create any
directly comparable mutation in WzySf with respect to other systems. This led us to perform
random mutagenesis on wzySf followed by screening with ColE2.
The mutations we found are present in a wide region (PL1, 2, 3, and 6; TM 2, 4, 5, 7,
8, and 9; and CL 1 and 5) of the WzySf topological model experimentally determined by
Daniels et al. (1998). We were able to locate a number of mutations in the TM regions and
interestingly the G130V mutation, which resulted in the complete loss of polymerisation
activity of WzySf in the !wzy background, was also located in TM5. Topological models are
not very accurate, but due to a lack of crystal structure we used the WzySf topology model
previously determined by our group to locate the mutational alterations. Furthermore, we
![Page 129: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/129.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
101
reassessed our topological model using 5 different topology prediction programs
(SPOCTOPUS, MEMSAT, HMMTOP, TOPCONS, and TMHMM) (Supplementary Table
S4). The results showed that until TM 6 all the programs are consistent with our topological
model. Three of them also validate TM10-TM11 of our topological model. So, the topological
model of WzySf determined by our group is nearly consistent with the topological models
predicted by the programs. The mutations, which resulted in the partial loss of polymerisation
in the !wzy background, were V92M, Y137H, L214I, and P352H. Among them V92M and
Y137H are present in the PL2 and TM5. These regions were validated by 5 of the programs.
P352H is present in the PL6 and this region was validated by 3 of the programs (MEMSAT,
HMMTOP, and TOPCONS). L214I is present in the TM8 and the region (amino acid 209-
226) was different compared to the computer prediction (amino acid 227-247). However,
G130V is present in the TM5, which was validated by 5 of the programs. Recently, Reddy et
al. (2014) reported that different topology prediction programs are suitable for different
families of proteins. So, non-prediction of TM7--TM9 by some programs does not invalidate
the presence of these regions in our model.
In the !wzy background, strains with the class A LPS profile had S-LPS with reduced
degree of Oag polymerisation (Fig. 3.3, lanes 2-4), mutants with the class B LPS profile had
LPS with few Oag RUs (Fig. 3.3, lane 5), and the mutant with class C LPS profile had SR-
LPS (Fig. 3.3, lane 6). As a result, the class A mutants were more sensitive to ColE2 than
PNRM13 and the class B mutants were even more sensitive to ColE2 than the mutants with
the class A LPS profile. The mutant with class C LPS had the highest ColE2 sensitivity. From
these three classes it is clear that the LPS with shorter Oag chains were more sensitive to
ColE2. Strains with class A, B, and C LPS profiles in the !wzy background were resistant to
bacteriophage Sf6c. The lack of bacteriophage Sf6c sensitivity indicates that bacteriophage
Sf6c only infects if the LPS has WT or close to a WT level of Oag polymerisation. In this
study, we found that the WzySf mutants conferring the class D LPS profile in the !wzy
background had a similar level of Oag polymerisation compared to the positive control strain
PNRM13, as determined by SDS-PAGE and silver staining (Fig. 3.3, lanes 7-10 and
Supplementary Fig. 3.S2, lanes 1-8) but they were more resistant to ColE2 and more sensitive
to bacteriophage Sf6c (Table 3.2) (except !wzy strain with WzyP165S). The ColE2 and
![Page 130: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/130.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
102
bacteriophage Sf6c sensitivities of these strains were similar to WT strain PE638. We
conclude that the Oag polymerisation activity of the mutants with class D LPS profile in the
!wzy background, was similar to the WT strain (PE638). Hence, the WT WzySf-GFP protein
is not 100% active, and the mutant proteins conferring the class D LPS profile are more active
and/or are better exported or folded or assembled to the IM. The level of Oag polymerisation
of the strains with class D LPS profile was more than PNRM13, although this was not
distinguishable by silver staining. Hence, the ColE2 assay was more sensitive than silver
staining and SDS-PAGE in determining the degree of Oag polymerisation.
Mutation in wzz resulted in Oag without modal chain length control in different
organisms (Bastin et al., 1993; Morona et al., 1995). Recently, Kenyon and Reeves (2013)
showed that Wzy of Yersinia pseudotuberculosis also needs Wzz for complete Oag
polymerisation. Here we examined the polymerisation activity of different WzySf mutants in
the absence of WzzSf. In the !wzy !wzz background, the strains with mutated wzySf plasmids
from the strains having class B LPS profiles in the !wzy background had an SR-LPS profile,
and ColE2 and bacteriophage Sf6c sensitivities were similar to the !wzy background.
Interestingly, the !wzy !wzz strain with WzyG130V had S-LPS without modal length control
(class F) where as the !wzy strain with WzyG130V had SR-LPS (class C) and this correlated
with an increased resistance to ColE2. In the !wzy !wzz background, strains with a class E
LPS profile (S-LPS without modal length control) had increased sensitivity to ColE2 and
increased or similar resistance to bacteriophage Sf6c compared to PNRM134 [!wzy !wzz
(pRMPN1)] and when in the !wzy background (strains with class A and class D LPS profiles)
(Table 3.2). We speculate that these strains (strains with a class E LPS profile) had subtle
alterations in the level of Oag polymerisation and/or capping of LPS with Oag, and were
unable to act efficiently as a bacteriophage Sf6c receptor and, correspondingly, were also
more sensitive to ColE2. It is known that phage adsorption to the cells of E. coli K12
increases with increase in density of receptor protein at the cell surface (Schwartz, 1976).
Based on our study, the relationship between ColE2 and Oag density/concentration seems
linear. Deceasing Oag progressively increases sensitivity to ColE2. However, the relationship
between bacteriophage Sf6c and Oag density/concentration seems non-linear. Decreasing Oag
rapidly decreases sensitivity to bacteriophage Sf6c. This may be because bacteriophage Sf6c
![Page 131: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/131.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
103
interaction with its receptor is complex and most likely requires multi-receptor binding to
bacteriophage Sf6c tail spike proteins (TSPs) to achieve irreversible binding and hence
activation of bacteriophage Sf6c.
According to the proposed molecular clock model, Wzz acts as a molecular clock and
regulates Wzy activity between two states: “E” or extension state favors polymerisation and
“T” or transfer state favors the ligation reaction (Bastin et al., 1993). The molecular
chaperone model describes Wzz as a typical molecular chaperone, which regulates the overall
ratio of Wzy and WaaL in a complex, and controls the enzyme kinetics of the ligation reaction
to define the modality (Morona et al., 1995). However, Woodward et al. (2010) suggested
that there is an interaction between Wzy and Wzz and they showed that these proteins are
enough to shape the Oag modal chain length. Islam et al. (2013) suggested that the chain
length of the Oag is determined by the interaction of Wzz and Wzy. Recent work of Taylor et
al. (2013) also suggested the direct interaction of Wzz and Wzy in the Oag biosynthesis
pathway. In this study, for the first time we were able to give an insight in the association of
WzySf and WzzSf in the Oag biosynthesis. We found WzySf mutants where polymerisation
activity was dependent on WzzSf (WzyP352H and WzyL214I), and some other mutants where
polymerisation activity was repressed in the presence of WzzSf (WzyV92M, WzyY137H, and
WzyG130V). The "wzy "wzz strain, with WzyV92M or WzyY137H had S-LPS without
modal length control (class E) but in the "wzy background, they showed class A LPS profile
(a greatly reduced degree of Oag polymerisation) (Fig 4, lanes 6-7 and lanes 8-9). The "wzy
strain with WzyG130V had class C LPS profile (SR-LPS) but remarkably the "wzy "wzz
strain with WzyG130V had S-LPS without modal length control, albeit with a reduced degree
of polymerisation (class F) (Fig 4 lanes 12-13). Oag polymerisation by these WzySf mutants
was repressed by WzzSf, in the "wzySf background; their LPS had shorter Oag chains. The
"wzy strain with WzyP352H had class A LPS profile, and the "wzy strain with WzyL214I had
class B LPS profile but in the "wzy/"wzy background they had shorter Oag chains (class B
and C respectively) compared to the "wzy background (Fig. 3.4, lanes 4-5 and 4 lanes 10-11).
So, these WzySf mutants need WzzSf for their Oag polymerisation activity. These findings
suggest that WzzSf is associated with WzySf not only for Oag modal chain length control but
![Page 132: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/132.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
104
also for polymerisation activity, and amino acids V92, G130, Y137, L214, and P352 have role
in the association of WzySf and WzzSf during the Oag polymerisation mediated by WzySf.
The relative WzySf-GFP level in PNRM134 ("wzy "wzz) was lower than in PNRM13
("wzy) (Fig. 3.5A and B, lanes 1-2), suggesting that the WT WzySf-GFP had better expression
in the presence of WzzSf. WzySf mutants conferring class A LPS profile ("wzy background)
had WzySf-GFP levels less than the WzySf-GFP in PNRM13 (Fig. 3.5A, lanes 3, 5, 7 and
Table 3.2). WzyL214I was not detectable either in the "wzy (class B) or "wzy "wzz (class C)
backgrounds (Fig. 3.5A, lanes 9-10 and Table 3.2). Hence, amino acid L214 is important for
WzySf-GFP production. WzyG130V was not detectable in the "wzy background (class C) but
was detected in the "wzy "wzz background (class F) (Fig. 3.5A, lanes 11-12 and Table 3.2).
Except for the strain "wzy with WzyL191F, all the mutants with class D LPS profile ("wzy
background) had a lower protein expression level than WzySf-GFP in PNRM13 (Fig. 3.5B and
Table 3.2) by some unknown mechanism. However, the mutants with a class D LPS profile
("wzy background) had S-LPS and were more resistant to ColE2 and more sensitive to
bacteriophage Sf6c than PNRM13. In the "wzy "wzz background, WzyL191F had an
expression level less than WzySf-GFP in PNRM13 (Fig. 3.5B, lane 8 and Table 3.2).
WzyP165S was not detectable in PNRM6 ("wzy) but strain PNRM126 ("wzy "wzz) with
WzyP165S present at a higher level than WzySf-GFP in PNRM13 (Fig. 3.5B, lanes 5-6 and
Table 3.2). Apparently, there are more than one underlying mechanism for the class D (!wzy
background) to class E ("wzy "wzz background) LPS profile conversion. Two of the
mutations (P165S and G130V) resulted in decreased WzySf-GFP levels in the presence of
WzzSf. This suggested that the presence of WzzSf destabilises WzyP165S and WzyG130V,
which resulted in lower WzySf-GFP levels. The mutation L191F resulted in decreased WzySf-
GFP level in the absence of WzzSf. Therefore, in this case WzzSf stabilises the protein
WzyL191F resulting in better WzySf-GFP expression. This finding suggests that G130, P165,
and L191 are important for the stabilisation of WzySf through interaction with WzzSf.
In conclusion, our findings identified amino acid residues on the WzySf important for
its polymerisation function and interaction with WzzSf. Residues, which are important for the
polymerisation and interaction of WzzSf and WzySf are present in the PL 2, 6 and TM 5, 8.
These regions may contribute in the interaction of WzySf with substrates and also to the
![Page 133: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/133.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
105
interaction with WzzSf. We identified a number of amino acids (G130, P165, L191), which
are important for the stabilisation of WzySf in association with WzzSf. Hence, our data
suggested that WzzSf also has a role in WzySf stability.
3.6 Acknowledgements
We thank Dr. Daniel O. Daley for the pWaldo-TEV-GFP plasmid. Funding for this work is
provided by a program grant to R.M. from the National Health and Medical Research Council
(NHMRC) of Australia. P.N. is the recipient of an international postgraduate research
scholarship from the University of Adelaide.
![Page 134: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/134.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
106
3.7 Supplementary information
Table 3.S1 Different primers made in this study
Primer* Sequence (5’-3’) Purpose PN1_wzySfKpnF 5’–GGCGGTACC ATGAATAATATTA
ATAAAATTTTTATTACA - 3’ amplification Of wzySf
PN2_wzySfBamHR 5’–GCGGGATCC TTTTGCTCCAGAA GT GAGGTTA - 3’
amplification of wzySf
ET35_F 5’-AGAGTAGAAAATAATAATGTTTC T- 3’
Construction of RMA4337
ET35_R 5’–GGCAAGCTTTTACTTCGCGTTGT AATTACG - 3’
Construction of RMA4337
*F, Forward; R, Reverse.
![Page 135: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/135.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
107
Table 3.S2 Colicin E2 (ColE2) sensitivity (performed by swab assay) of different WzySf mutants during screening
Strain Relevant details ColE2 sensitivity*^ RMM109 Mutant wzySf ++++ PE638 WT R PNRM13 Positive control + PNRM6 Negative control ++++ PNRM11 Negative control ++++ Mutant # Mutant class
ColE2 sensitivity*^ P352H class A ++
V92M class A ++ Y137H class A ++ L214I class B +++ G130V class C ++++ N147K class D R P165S class D R L191F class D R C60F class D R L49F/T328A class D R L28V class D R N86K class D R F54C class D R F52Y class D R L111I class D R G82C class D R F52C/I242T class D R
*R, Resistant; ^Relative sensitivity to ColE2: ++++ > +++ > ++ > +; # Mutants are in
PNRM6.
![Page 136: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/136.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
108
Table 3.S3 Nucleotide base change in the WzySf mutants
Mutations Site of point mutation in the WzySf sequence (5’-3’)
P352H 5’-CTTTTTACACCCATGGGAATTTTT-3’ V92M 5’-CTGTTTGATGTGCAACCATACCTT-3’
Y137H 5’-TATATTTCATACATAATTTTGTTG-3’ L214I 5’-TTTACAACATTATCACTGTTATTA-3’
G130V 5’-GCATTATATGGATCACTGTTATAT-3’
N147K 5’-GGTTTGTTAAATTTTAATTTAATT-3’
P165S 5’-TTTTTTCGTCCCGATGGGGCTTTT-3’ L191F 5’-AAAAAATATTTAAAATGTCTCATA-3’
C60F 5’-ACCCAAAAATGTGTCAGTCTTTTT-3’
L49F/T328A 5’-ATTTTTAATTTAGTTACATTCAAT-3’ 5’-AGTACAAAAACATCATTAATGATG-3’
L28V 5’-CTGGAGCCATTGGGAATATTCCCT-3’ N86K 5’-AATAAAATAAATGATATACTGTTT-3’
F54C 5’-ACATTCAATTTTTCAATCACCCAA-3’
F52Y 5’-TTAGTTACATTCAATTTTTCAATC-3’
L111I 5’-AGATATACTTTAAAAGTATTTTCA-3’ G82C 5’-TTATTAGCTGGTAATAAAATAAAT-3’
F52C/I24T 5’-TTAGTTACATTCAATTTTTCAATC-3’ 5’-CTATTTATAATTATGCTTTACATG-3’
![Page 137: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/137.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
109
Table 3.S4 Verification of the WzySf topological model using topological prediction programs
Models Daniels et al.
1998 SPOCTOPUS MEMSAT HMMTOP TOPCONS TMHMM
Total TM 12 10 12 12 12 11
TM1 4 - 22 5 - 25 7 - 25 7 - 25 5 - 25 7 - 24 TM2 35 - 54 32 - 52 35 - 52 36 - 55 32 - 52 34 - 56
TM3 63 - 81
58 - 78 60 - 82 62 - 81 61 - 81 63 - 82 TM4 95 - 112
94 - 114 95 - 111 96 - 115 87 - 107 92 - 111
TM5 126 - 146
123 -1 43 122 - 146 122 - 146 132 - 152 118 - 140 TM6 168 - 186
170 - 190 169 - 186 167 - 186 167 - 187 167 - 186
TM7 190 - 206
196 - 216 194 - 218 193 - 217 196 - 216 193 - 215 TM8 209 - 226
227 - 247 226 - 247 230 - 248 226 - 246 230 - 249
TM9 230 - 247
298 - 318 269 - 285 269 - 285 270 - 290 262 - 281
TM10 301 - 318
349 - 369 302 - 218 302 - 321 298 - 318 301 - 323
TM11 330 - 349
---- 328 - 344 328 - 345 330 - 350 335 - 368
TM12 353 - 370 ---- 352 - 368 350 - 368 353 - 373
Consistency with current model
----- Nearly consistent
Nearly consistent
Nearly consistent
Nearly consistent
Nearly consistent
![Page 138: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/138.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
110
Figure 3.S1 WzySf expression
Plasmid pRMPN1 (pWaldo-wzySf-TEV-GFP-His8) was transformed into Lemo21(DE3) cells.
Strain was grown and induced as described in the Materials and Methods. To perform In-gel
fluorescence, whole cell In-gel fluorescence samples were prepared and electrophoresed on
SDS 15% (w/v) PAGE gel and the BenchMark protein ladder (Invitrogen) was used as a
molecular mass standard (See Materials and Methods). Samples in each lane are as follows: 1.
PNRM15 [Lemo21(DE3) (pRMPN1)] and 2: Lemo21(DE3).
![Page 139: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/139.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
111
Figure 3.S2 LPS phenotype conferred by the class D WzySf mutants expressed in
PNRM6 ["wzy (pAC/pBADT7-1)]
Strains were grown and induced with arabinose as described in the Materials and Methods.
LPS samples were prepared, electrophoresed on an SDS-15% (w/v) PAGE gel, and silver
stained (See Materials and Methods). The class D WzySf mutants in each lane are: 1.
L49F/T328A, 2. L28V, 3. N86K, 4. F54C, 5. F52Y, 6. L111I, 7. G82C, 8. F52C/I242T.
![Page 140: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/140.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
112
Figure 3.S3 Comparison of the LPS phenotype conferred by the class D WzySf mutants
expressed in the "wzy and "wzy "wzz backgrounds
Plasmids encoded mutated WzySf proteins were expressed in PNRM6 (!wzy) and PNRM126
(!wzy !wzz). Strains were grown and induced as described in the Materials and Methods. LPS
samples were electrophoresed on an SDS-15% (w/v) PAGE gel and silver stained (See
![Page 141: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/141.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
113
Materials and Methods). Lanes 4-36 are the "wzy or "wzy "wzz strains with plasmids
encoding mutated WzySf protein. The class D WzySF mutants in each lane are as follows: 1.
L49F/T328A (!wzy), 2. L49F/T328A ("wzy "wzz), 3. L28V ("wzy), 4. L28V ("wzy "wzz), 5.
N86K ("wzy), 6. N86K ("wzy "wzz), 7. F54C ("wzy), 8. F54C ("wzy "wzz), 9. F52Y ("wzy),
10. F52Y ("wzy "wzz), 11. L111I ("wzy), 12. L111I ("wzy "wzz), 13. G82C ("wzy), 14.
G82C ("wzy "wzz), 15. F52C/I242T ("wzy), 16. F52C/I242T ("wzy "wzz).
![Page 142: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/142.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
114
3.7.1 Construction of pWaldo-wzySf-GFP-His81
Primers PN1_wzySfKpnF and PN2_wzySfBamHR (Table 3.S1) which incorporated the KpnI
and BamHI restriction sites, respectively, were used to amplify the previously mutated S.
flexneri 2457T 2a wzySf coding region in pRMCD6 plasmid (Table 2.2) (Daniels & Morona,
1999). Codons 4, 9, and 23 are rare codons present in the translation initiation regions of WT
WzySf and cause lower expression of WT WzySf (Daniels et al., 1998). Hence, the codons
ATA, ATA, and AGA at 4, 9, and 23 were altered to ATT, ATT, and CGT, respectively, and
result in the increased expression of WzySf (Daniels et al., 1998). The amplified wzySf was
cloned into pGEM-T-Easy vector and generated the plasmid p-GEM-T-Easy-wzySf. Following
digestion of the p-GEM-T-Easy-wzySf with BamHI and KpnI, the generated fragment
containing wzySf was ligated into similarly digested pWaldo-TEV-GFP (Waldo et al., 1999).
pWaldo-TEV-GFP contains T7 promoter, ribosomal binding site, and T7 terminator for the
regulation of gene expression, Km selection marker, GFP moiety for detection of the protein,
C-terminal His8 tag for protein purification, and tobacco etch virus (TEV) protease
recognition site for removal of the GFP-His8 moiety (Drew et al., 2006; Waldo et al., 1999).
The insertion of wzySf in the resulting plasmid pWaldo-wzySf-GFP-His8, (Fig. 3.S4) also
denoted as pRMPN1 (Table 2.2), was confirmed by DNA sequencing. The sequence of the
insert in pWaldo-wzySf-GFP-His8 is shown in Fig. 3.S5.
1 Sections 3.7.1 onwards were not part of the original manuscript and were included as additional information for
the thesis chapter.
![Page 143: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/143.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
115
Figure 3.S4 Construction of pWaldo-wzySf-GFP-His8 (pRMPN1) plasmid The plasmid pWaldo-wzySf-GFP-His8 was constructed as described in section 6.2. Briefly,
forward and reverse primers incorporating KpnI and BamHI restriction sites, respectively,
were used to amplify wzySf (Genbank accession number X71970.1) from plasmid pRMCD6
(Daniels & Morona, 1999) (A). The amplified fragment was then ligated into pGEM-T-Easy
(B), excised from the plasmid with KpnI/BamHI double digest (C), and ligated into the
similarly digested vector pWaldo-TEV-GFP (Waldo et al., 1999) (D).
![Page 144: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/144.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
116
1 atgaataatattaataaaatttttattacatttttatgtattgaactgattattggtggt 1 M N N I N K I F I T F L C I E L I I G G 61 ggtggacgtttactggagccattgggaatattccctttgcgatatttattatttgtattt 21 G G R L L E P L G I F P L R Y L L F V F 121 agttttatacttttaatttttaatttagttacattcaatttttcaatcacccaaaaatgt 41 S F I L L I F N L V T F N F S I T Q K C
181 gtcagtctttttatatggttgcttttatttcctttttatggcttctttgtcggcttatta 61 V S L F I W L L L F P F Y G F F V G L L
241 gctggtaataaaataaatgatatactgtttgatgtgcaaccatacctttttatgctgtca 81 A G N K I N D I L F D V Q P Y L F M L S
301 cttatatatctatttacactaagatatactttaaaagtattttcatgtgagatttttatt 101 L I Y L F T L R Y T L K V F S C E I F I
361 aaaatagttaatgcatttgcattatatggatcactgttatatatttcatacataattttg 121 K I V N A F A L Y G S L L Y I S Y I I L
421 ttgaatttcggtttgttaaattttaatttaatttatgaacacttatcattgactagcgag 141 L N F G L L N F N L I Y E H L S L T S E
481 ttcttttttcgtcccgatggggcttttttttccaaatccttctacttttttggtgtcggt 161 F F F R P D G A F F S K S F Y F F G V G
541 gcgattatcagttttgtcgacaaaaaatatttaaaatgtctcataatagtgcttgcgata 181 A I I S F V D K K Y L K C L I I V L A I
601 ttattgacagaatcaagaggtgtattactttttacaacattatcactgttattagccagt 201 L L T E S R G V L L F T T L S L L L A S
661 tttaaattacataagctatatttaaatactattataataatattgggcagcgttctattt 221 F K L H K L Y L N T I I I I L G S V L F
721 ataattatgctttacatggtcggatcacgcagtgaagattctgactctgttagatttaat 241 I I M L Y M V G S R S E D S D S V R F N
![Page 145: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/145.jpg)
Mutational analysis of the Shigella flexneri O antigen polymerase Wzy; identification of Wzz-
dependent Wzy mutants
117
781 gatttatatttttattataaaaatgttgatttagcgacgttcttgtttggaagaggattt 261 D L Y F Y Y K N V D L A T F L F G R G F
841 ggttcatttatattagatcgattaaggattgaaatagtacctcttgagatacttcagaaa 281 G S F I L D R L R I E I V P L E I L Q K
901 acaggcgttattggtgtatttatatcattagttcctatgttgcttatctttttgaaaggc 301 T G V I G V F I S L V P M L L I F L K G
961 tattttttaaatagtacaaaaacatcattaatgatgtcgttaatactttttttcagtatt 321 Y F L N S T K T S L M M S L I L F F S I
1021 accgtttctataactaatccatttctttttacacccatgggaatttttattataggcgtt 341 T V S I T N P F L F T P M G I F I I G V
1081 gtagttttatgggtattttctatagaaaatatccaaattagtaataacctcacttctgga 361 V V L W V F S I E N I Q I S N N L T S G
1141 gcaaaataaGGATCC 381 A K - BamHI
Figure 3.S5 DNA and predicted amino acid sequence of the inserted WzySf sequence in pWaldo-TEV-GFP plasmid The DNA sequence and the amino acid sequence of the wzySf fragment inserted in pWaldo-
TEV-GFP plasmid are shown. The wzySf (GenBank accession number X71970.1) sequence is
highlighted in yellow, the sart codon is highlighted in green, and the stop codon is highlighted
in pink. The BamHI sequence is shown in grey. The alterations in codons 4, 9 and 23 of wzySf
are indicated in red text.
![Page 146: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/146.jpg)
118
![Page 147: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/147.jpg)
119
Chapter 4
Mutational analysis of the major periplasmic loops of Shigella
flexneri Wzy: identification of the residues affecting O antigen
modal chain length control, and Wzz-dependent polymerisation
activity
![Page 148: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/148.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
120
Mutational analysis of the major periplasmic loops of
Shigella flexneri Wzy: identification of the residues
affecting O antigen modal chain length control, and Wzz-
dependent polymerisation activity
Pratiti Nath and Renato Morona
Discipline of Microbiology and Immunology, School of Molecular and
Biomedical Science, University of Adelaide, Adelaide 5005, Australia
Microbiology. 2015 Apr;161(Pt 4):774-85. doi: 10.1099/mic.0.000042. Epub 2015 Jan 27.
![Page 149: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/149.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
121
Statement of Authorship
Title of Paper Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz dependent polymerisation activity.
Publication Status Published
Publication Details Microbiology. 2015 Apr;161(Pt 4):774-85. doi: 10.1099/mic.0.000042. Epub 2015 Jan 27.
Author Contributions By signing the Statement of Authorship, each author certifies that their stated contribution to the publication is accurate and that permission is granted for the publication to be included in the candidate’s thesis. Name of Principal Author (Candidate)
Pratiti Nath
Contribution to the Paper Performed all experiments, performed analysis on all
samples, interpreted data, and wrote manuscript.
Signature
Date 20.5.15
Name of Co-Author Renato Morona
Contribution to the Paper Supervised development of work, helped in data
interpretation, manuscript evaluation and editing.
Signature
Date
![Page 150: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/150.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
122
Chapter 4: Second paper
4.1 Abstract
The O antigen (Oag) component of LPS is a major Shigella flexneri virulence determinant.
Oag is polymerised by WzySf, and its modal chain length is determined by WzzSf and
WzzpHS2. Site-directed mutagenesis was performed on wzySf in pWaldo-wzySf-TEV-GFP to
alter Arg residues in WzySf’s two large periplasmic loops (PLs) (PL3 and PL5). Analysis of
the LPS profiles conferred by mutated WzySf proteins in the wzySf deficient ("wzy) strain
identified residues that affect WzySf activity. The importance of the guanidium group of the
Arg residues was investigated by altering the Arg residues to Lys and Glu, which generated
WzySf mutants conferring altered LPS Oag modal chain lengths. The dependence of these
WzySf mutants on WzzSf was investigated by expressing them in a wzySf and wzzSf deficient
("wzy "wzz) strain. Comparison of the LPS profiles identified a role for the Arg residues in
the association of WzySf and WzzSf during Oag polymerisation. Colicin E2 and bacteriophage
Sf6c susceptibility supported this conclusion. Comparison of the expression levels of different
mutant WzySf -GFPs with the wild-type WzySf-GFP showed that certain Arg residues affected
production levels of WzySf in a WzzSf -dependent manner. To our knowledge, this is the first
report of S. flexneri WzySf mutants having an effect on LPS Oag modal chain length, and
identified functionally significant Arg residues in WzySf.
4.2 Introduction
Shigella flexneri is the main causative agent for the disease shigellosis or bacterial dysentery.
Approximately, 125 million shigellosis cases occur annually in Asia, with nearly 14000
fatalities (Bardhan et al., 2010). The O antigen (Oag) component of the lipopolysaccharide
(LPS) of Shigella flexneri plays an important role in the pathogenesis of the bacteria. Oag is
composed of oligosaccharide repeat units (RUs) or O units. Oag is linked to the hydrophobic
anchor of the LPS (Lipid A) by the non-repeating oligosaccharide domain known as the core
sugar region (Raetz & Whitfield, 2002; Sperandeo et al., 2009). The complete LPS structure
with Oag chains is termed smooth LPS (S-LPS). However, the LPS structure devoid of Oag is
![Page 151: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/151.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
123
termed rough LPS (R-LPS), and LPS with only one O unit is termed semi-rough LPS (SR-
LPS) (Morona et al., 1994).
Oag is the serotype determinant and also the protective antigen of the bacteria (Jennison
& Verma, 2004; Stagg et al., 2009; Sun et al., 2013b). On the basis of the composition of
Oag, S. flexneri is divided into 17 serotypes (Sun et al., 2013b). Except serotype 6, all the
serotypes share a basic polysaccharide backbone containing three L-rhamnoses (Rha), and
one N-acetylglucosamine (GlcNAc). This basic Oag structure is known as serotype Y. The
differences between the serotypes are conferred by addition of glucosyl, O-acetyl, or
phosphoethanolamine (PEtN) functional groups by various linkages to the sugars of the basic
tetrasaccharide RU (Allison & Verma, 2000; Sun et al., 2012; Wang et al., 2010b). Oag
restricts the accessibility of the colicin to their outer membrane (OM) receptor protein (Tran
et al., 2014; van der Ley et al., 1986). In addition, the bacteriophage Sf6 uses Oag as a
receptor and forms plaques on serotype Y and X strains (Lindberg et al., 1978).
S. flexneri LPS biosynthesis occurs mainly by two separate pathways: 1) lipid A and
core biosynthesis and 2) Oag biosynthesis. Oag biosynthesis occurs on either side of the inner
membrane (IM) and it is mediated by the Wzy-dependent pathway (Allison & Verma, 2000;
Morona et al., 1995). S. flexneri Oag biosynthesis starts by the transfer of GlcNAc phosphate
from an uridine diphosphate-GlcNAc (UDP-GlcNAc) to undecaprenol phosphate (Und-P) at
the cytoplasmic side of the IM by WecA (Guo et al., 2008; Liu et al., 1996; Wang et al.,
2010b). The rhamnosyl transferases (RfbG and RfbF) then add sequential Rha residues to the
GlcNAc to form the O unit (Morona et al., 1994). Translocation of the O unit to the
periplasmic side is mediated by the protein Wzx. At the periplasmic side O units are
polymerised by Wzy to form the Oag. The chain length of the Oag is regulated by Wzz
(Daniels et al., 1998; Morona et al., 1994). Finally, the Oag chains are transferred to the core-
lipid A by the ligase WaaL. The Lpt proteins (Lpt A-G) facilitate the transport of the LPS
from the IM to the OM (Ruiz et al., 2008; Sperandeo et al., 2009).
S. flexneri Wzy (WzySf) is a 43.7 kDa hydrophobic integral membrane protein. It has 12
transmembrane (TM) segments and two large periplasmic (PL) domains (PL3 and PL5)
(Daniels et al., 1998; Morona et al., 1994). Previously we were able to identify some of the
![Page 152: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/152.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
124
key functional amino acid residues of WzySf, providing insight into WzySf structure and
function (Nath et al., 2015). WzySf has an RX15G motif in both of the PL3 and PL5 starting
from R164 in PL3 and from R289 in PL5. There are several Arg residues between these two
motifs. In the Pseudomonas aeruginosa Wzy (WzyPa), it was found that the PL3 and PL5
have RX10G motifs, which are important for Oag polymerisation activity. There are several
Arg residues within these two motifs, which play an important role in the Oag polymerisation
(Islam et al., 2011). However, there is little sequence identity between WzySf and WzyPa.
(Islam et al., 2013) performed extensive work on WzyPa and conducted a “jackhammer”
search to find the homologues of WzyPa. However, their results showed that WzyPa is not
related to Wzy from Enterobacteriaceae.
The modal length of the Oag chain is regulated by Wzz proteins, members of the
polysaccharide co-polymerase (PCP) family (Morona et al., 2000b). S. flexneri 2a has S-LPS
with two types of modal chain length: short (S) type (11-17 Oag RUs) and very long (VL)
type (>90 Oag RUs), and the S-type and VL-type Oag chain lengths are determined by WzzSf
and WzzpHS2, respectively (Morona et al., 2003; Morona & Van Den Bosch, 2003b).
(Woodward et al., 2010) proposed that Wzy and Wzz have an interaction during Oag
biosynthesis and that these two proteins are enough to shape the Oag modal chain length.
Several other research groups have also suggested that Wzz and Wzy interact during Oag
biosynthesis (Islam et al., 2013; Marolda et al., 2006; Taylor et al., 2013; Tocilj et al., 2008).
However, there is a lack of direct evidence on the association of Wzz and Wzy in Oag
polymerisation and chain length control. Recently, we identified the WzzSf dependent WzySf
mutants, and showed that WzzSf has a novel role in the stability of WzySf and also in the Oag
polymerisation activity of WzySf (Nath et al., 2015).
In this study we performed site-directed mutagenesis on Arg residues in the PL3 and
PL5 of WzySf and identified key Arg residues (R164, R250, R258, and R289) important for
WzySf polymerisation activity and Oag modal chain length control. Several Arg residues have
a role in the association of WzzSf and WzySf during Oag biosynthesis and the WzzSf dependent
stability of WzySf.
![Page 153: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/153.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
125
4.3 Materials and Methods
4.3.1 Bacterial strains and plasmids
The strains and plasmids used in this study are detailed in Table 4.1.
4.3.2 Growth media and growth conditions
The growth media used were lysogeny broth (LB) broth (10 g/liter tryptone, 5 g/liter yeast
extract, 5 g/liter NaCl) and LB agar (LB broth, 15 g/liter bacto agar).
Strains were grown in LB broth with aeration for 18 h at 37°C. 18 h cultures were
diluted 1/20 into fresh LB broth and grown to mid-exponential phase (OD600 of 0.4-0.6). To
suppress protein expression, growth medium was supplemented with 0.2% (w/v) glucose
where required. Cells were centrifuged (2200 x g, SIGMA 3K15 table top centrifuge, 10 min,
4°C) and washed twice with LB broth to remove glucose. To induce protein expression, 0.2%
(w/v) L-Arabinose was added to cultures and grown for 20 h at 20°C. Antibiotics were added
as required to the media at the following final concentrations: 50 µg/ml kanamycin (Km) and
25 µg/ml chloramphenicol (Cm).
4.3.3 LPS method
LPS was prepared as described previously (Nath et al., 2015). Cells (1X109) were harvested
and resuspended in lysing buffer and incubated with proteinase K for approximately 16 h. The
LPS samples were then separated by SDS-PAGE on 15% (w/v) gels for 16.5 h at 12 mA.
Silver nitrate was used to stain the gels and finally the gels were developed with
formaldehyde (Murray et al., 2003).
![Page 154: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/154.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
126
Table 4.1 Bacterial strains and plasmids used in this study
Strains or Plasmids Characteristics* Reference Strains S. flexneri PE638 S. flexneri Y rpoB (Rifr) (Morona et al., 1994) RMM109 PE638"wzy, Rifr (Morona et al., 1994) RMA4337 RMM109 "wzz (Rifr, Tetr) (Nath et al., 2015) PNRM6 RMM109 (pAC/pBADT7-1) (Nath et al., 2015) PNRM13 PNRM6 (pRMPN1) (Nath et al., 2015) PNRM16 PNRM6 (pRMPN2) This study PNRM17 PNRM6 (pRMPN3) This study PNRM18 PNRM6 (pRMPN4) This study PNRM19 PNRM6 (pRMPN5) This study PNRM20 PNRM6 (pRMPN6) This study PNRM126 RMA4337 (pAC/pBADT7-1) (Nath et al., 2015) PNRM134 PNRM126 (pRMPN1) (Nath et al., 2015) PMRM127 PNRM126 (pRMPN2) This study PMRM128 PNRM126 (pRMPN3) This study PMRM129 PNRM126 (pRMPN5) This study PMRM130 PNRM126 (pRMPN6) This study PMRM153 PNRM126 (pRMPN4) This study PNRM190 PNRM6 (pRMPN27) This study PNRM192 PNRM6 (pRMPN28) This study PNRM194 PNRM6 (pRMPN29) This study PNRM196 PNRM6 (pRMPN30) This study PNRM198 PNRM6 (pRMPN31) This study PNRM216 PNRM6 (pRMPN32) This study PNRM218 PNRM6 (pRMPN33) This study PNRM220 PNRM6 (pRMPN34) This study PNRM222 PNRM6 (pRMPN36) This study PNRM232 PNRM6 (pRMPN35) This study
![Page 155: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/155.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
127
Table 4.1 continued Strains or Plasmids Characteristics* Reference E. coli XL10-G Tet r"(mcrA)183 "(mcrCB-hsdSMR-
mrr)173 endA1 supE44 thi-1 recA1 gyrA96 relA1 lac [F´ proAB lacIqZ"M15Tn10 (Tetr) Camr]
Stratagene
Plasmids pAC/pBADT7-1 Source of T7 RNA polymerase; Cmr (McKinney et al., 2002)
pWaldo-TEV-GFP Cloning vector with GFP tag; Kmr (Waldo et al., 1999) pRMPN1 pWaldo-wzySF-GFP; Kmr (Nath et al., 2015) pRMPN2 pRMPN1 with WzyR164A This study pRMPN3 pRMPN1 with WzyR250A This study pRMPN4 pRMPN1 with WzyR258A This study pRMPN5 pRMPN1 with WzyR278A This study pRMPN6 pRMPN1 with WzyR289A This study pRMPN27 pRMPN1 with WzyR164K This study pRMPN28 pRMPN1 with WzyR250K This study pRMPN29 pRMPN1 with WzyR258K This study pRMPN30 pRMPN1 with WzyR278K This study pRMPN31 pRMPN1 with WzyR289K This study pRMPN32 pRMPN1 with WzyR164E This study pRMPN33 pRMPN1 with WzyR250E This study pRMPN34 pRMPN1 with WzyR258E This study pRMPN35 pRMPN1 with WzyR278E This study pRMPN36 pRMPN1 with WzyR289E This study
* Rifr, rifampicin resistant; Kmr, kanamycin resistant; Cmr, chloramphenicol resistant; Tetr,
tetracycline resistant.
![Page 156: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/156.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
128
4.3.4 Site-directed mutagenesis
Site-directed mutagenesis on wzySf in plasmid pRMPN1 (Nath et al., 2015; Waldo et al.,
1999) was performed using the QuikChange Lightning Site-Directed Mutagenesis Kit
(Catalogue number 210518, Stratagene) following the manufacturer’s instructions.
Mutagenised plasmids were transformed into XL10-Gold. Plasmids were isolated and the
mutations within the coding region were identified by DNA sequencing (AGRF, Adelaide,
Australia). The oligonucleotide primers used for site-directed mutagenesis are listed in
Supplementary Table 4.S1.
4.3.5 Detection of WzySf expression in S. flexneri
Procedure of WzySf-GFP expression in S. flexneri has been described previously (Nath et al.,
2015). Cells were harvested from the 50 ml L-arabinose induced culture. Then the cell pellet
was resuspended in 4 ml sonication buffer (20 mM Tris-HCl, 150 mM NaCl, pH 7.5) and
lysed by sonication. Cell debris was removed by centrifugation (2200 x g, SIGMA 3K15 table
top centrifuge, 10 min, 4 °C). The whole membrane (WM) fraction was isolated by
ultracentrifugation (Beckman Coulter Optima L-100 XP bench top ultracentrifuge, 126 000 X
g, 1 h, 4 °C). The WM fraction was resuspended in PBS and then solubilised in Buffer A [200
mM Tris-HCl (pH 8.8), 20% (v/v) glycerol, 5 mM EDTA (pH 8.0), 0.02% (w/v)
bromophenol blue, 4% (w/v) SDS, and 0.05 M DTT]. Solubilised WM fractions (from 3 X
108 cells) were electrophoresed on SDS-15% (w/v) PAGE gels. Gels were rinsed with
distilled water, and fluorescent imaging of the gels was performed to detect wild type (WT)
and mutant WzySf-GFP protein expression with a Bio-Rad Gel Doc XR + System using Image
Lab software (excitation at 485 nm and emission at 512 nm). Loading was checked by
staining the gels with Coomassie Blue R-250. The intensity of WT and mutant WzySf-GFP
expression in control and mutant strains was measured by Fiji image processing package
(http://fiji.sc/Fiji) and the percent relative WzySf-GFP intensity for each mutant was measured
by comparing with WT WzySf-GFP intensity in the control strain PNRM13.
![Page 157: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/157.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
129
4.3.6 Colicin sensitivity assay
For the colicin sensitivity assay, His6-colicin E2 (ColE2) with an initial concentration of 1
mg/ml was used (Tran et al., 2014). The procedure of ColE2 spot assay has been described
previously (Nath et al., 2015). The ColE2 spot assay was performed for all strains expressing
WT and mutant WzySf-GFP and the other control strains. The end point of the killing zones of
mutant strains was compared with the controls.
4.3.7 Bacteriophage sensitivity assay
The procedures used for phage propagation and phage stock preparation have been described
previously (Mavris et al., 1997; Morona et al., 1994), and the bacteriophage Sf6c sensitivity
assay was as described previously (Nath et al., 2015). Phage sensitivity of all strains
expressing mutant WzySf-GFP was compared with the strains expressing WT WzySf-GFP and
the other controls.
4.4 Results
4.4.1 Site-directed mutagenesis of Arg residues in PL3 and PL5 of WzySf
In a previous study on WzySf, random mutagenesis failed to detect any functional residue in
PL5 (Nath et al., 2015). However, Islam et al. (2011) found that the Arg residues in the two
principal PLs (PL3 and PL5) of WzyPa are important for Oag polymerisation activity. The
RX10G motifs of the PL3 and PL5 of WzyPa (Islam et al., 2011) are absent in WzySf.
However, both PL3 and PL5 of WzySf contained RX15G motifs (starting from R164 in PL3
and R289 in PL5) (Fig. 4.1) (Table 4.S2), and there are also several Arg residues between
these two motifs. So, site-directed mutagenesis on wzySf in the pRMPN1 was performed to
change the basic polar and positively charged Arg residues (R164, R250, R258, R278, and
R289) to Ala (no-npolar and neutral substitution), Lys (basic polar and positively charged
substitution), and Glu (acidic polar and negatively charged substitution) (Fig. 4.1) (See
![Page 158: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/158.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
130
Figure 4.1 Location of the mutations constructed in this study on the topology map of WzySf Mutational alterations were indicated by arrows on the WzySf topology map [adapted from
Daniels et al. (1998)]. The positions of PL1-5, TM1-12, and cytoplasmic loops (CL) 1-5 are
indicated. The residues mutated in this study (dark grey circles) are located in PL3 and 5. The
position of RX15G motifs (light grey circles) in PL3 and PL5 of WzySf, starting from R164 and
R289 respectively, are indicated.
![Page 159: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/159.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
131
Materials and Methods). Mutated plasmids were transformed into PNRM6 [RMM109
(pAC/pBADT7-1)] (!wzy) (Table 4.1) for phenotypic analysis (Nath et al., 2015).
4.4.2 LPS phenotype conferred by the WzySf mutants
LPS profiling by SDS-PAGE and silver staining were used to detect the effect of the WzySf
mutations on the LPS Oag polymerisation. Mutants were initially grouped into five different
phenotypic classes (A, B, C, D, and F) (Fig. 4.2 and Table 4.2) by comparing the LPS profiles
of the mutant strains with the WT positive control PNRM13. Based on the number of Oag
RUs in the Oag modal chain length (WzzSf regulated S-type) the class A mutants were further
subdivided into subclasses A1, A2, and A3 (Table 4.2). The mutational alteration R164A
resulted in complete loss of Oag polymerisation activity (SR-LPS or class C) (Fig. 4.2, lane
3), R164K resulted in an S-LPS with reduced Oag polymerisation (<30 Oag RUs) and lacking
modal chain length control (class F LPS) (Fig. 4.2, lane 5; and Table 4.2), and R164E resulted
in complete loss of polymerisation activity (SR-LPS or class C) (Fig. 4.2, lane 7), similar to
R164A. Mutational alterations R250A and R250E resulted in decreased Oag polymerisation
activity (LPS with <11 Oag RUs or class B) (Fig. 4.2, lanes 9 and 13). However, the
mutational alteration R250K resulted in an S-LPS with reduced Oag polymerisation, and the
modal chain length was reduced to 8-11 RUs (subclass A1) (Fig. 4.2, lane 11; and Table 4.2)
and was just detectable compared to the positive control (PNRM13). Similar to mutational
alterations of R164, both R258A and R258E resulted in an SR-LPS (class C) (Fig. 4.2, lanes
15 and 19). The mutational alteration R258K resulted in an S-LPS with reduced
polymerisation and the modal chain length was reduced to 9-14 RUs (subclass A2) (Fig. 4.2,
lane 17; and Table 4.2). For residue R278, the mutational alterations investigated had no
detectable effect on the LPS profiles, and all strains had LPS profiles (class D) similar to the
relevant WT control (PNRM13) (Fig. 4.2, lanes 21, 23, and 25). For residue R289, mutational
alteration R289A resulted in a class A LPS profile and the LPS Oag modal chain length of
![Page 160: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/160.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
132
Figure 4.2 Comparison of the LPS phenotype conferred by the WzySf mutants expressed in the "wzy and "wzy "wzz backgrounds The plasmids encoded mutant and WT WzySf proteins were expressed in PNRM6 [RMM109
(pAC/pBADT7-1)] and PNRM126 [RMA4337 (pAC/pBADT7-1)]. Strains were grown and
induced as described in the Materials and Methods. LPS samples were electrophoresed on a
SDS-15% (w/v) PAGE gel and silver stained (See Materials and Methods). Strains were
grouped into various mutant classes (A-F) and subclasses (A1-3) based on their LPS profiles
as described in the text (Table 4.2). Lanes 1-2 are: 1. PNRM13 [PNRM6 (pRMPN1)]; 2.
PNRM134 [PNRM126 (pRMPN1)]. Lanes 3-32 are the "wzy or "wzy "wzz strains with
plasmids encoding mutated WzySf proteins. The WzySf mutants in each lane are as follows: 3.
R164A ("wzy), 4. R164A ("wzy "wzz), 5. R164K ("wzy), 6. R164K ("wzy "wzz), 7. R164E
("wzy), 8. R164E ("wzy "wzz), 9. R250A ("wzy), 10. R250A ("wzy "wzz), 11. R250K
("wzy), 12. R250K ("wzy "wzz), 13. R250E ("wzy), 14. R250E ("wzy "wzz), 15. R258A
("wzy), 16. R258A ("wzy "wzz), 17. R258K ("wzy), 18. R258K ("wzy "wzz), 19. R258E
![Page 161: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/161.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
133
("wzy), 20. R258E ("wzy "wzz), 21. R278A ("wzy), 22. R278A ("wzy "wzz), 23. R278K
("wzy), 24. R278K ("wzy "wzz), 25. R278E ("wzy), 26. R278E ("wzy "wzz), 27. R289A
("wzy), 28. R289A ("wzy "wzz), 29. R289K ("wzy), 30. R289K ("wzy "wzz), 31. R289E
("wzy), 32. R289E ("wzy "wzz). The position of R-LPS is indicated. The numbers on the left
and right indicate the Oag RUs. Letters (A1-3, B-F) at the bottom indicate the mutant class
(Table 4.2).
![Page 162: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/162.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
134
Table 4.2 LPS profiles of different WzySf mutant phenotypic classes
WzySf mutant Class LPS profile A1 S-LPS with reduced Oag polymerisation, and the modal
chain length was reduced to 8-11 RUs A2 S-LPS with reduced polymerisation and the modal chain
length was reduced to 9-14 or 8-14 Oag RUs A3 S-LPS with reduced polymerisation (<22 Oag RUs) and
the modal chain length was similar to the WT control (PNRM13)
B LPS with few Oag RUs (<11 Oag RUs) C SR-LPS D LPS profile similar to the WT control PNRM13 E S-LPS lacking Oag modal chain length control F S-LPS with reduced Oag polymerisation and lacking Oag
modal chain length control (<30 Oag RUs)
![Page 163: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/163.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
135
this strain was similar to PNRM13 (Fig. 4.2, lane 27; and Table 4.2) but lacked S-LPS with
Oag >22 RUs; the LPS profile of this strain was further classified as subclass A3. The
mutational alteration R289E resulted in a class A LPS profile with an Oag modal length of 8-
14 RUs (Subclass A2) (Fig. 4.2, lane 31; and Table 4.2) that was shorter than that seen in the
positive control (PNRM13). The mutational alteration R289K resulted in a class D LPS
profile (Fig. 4.2, lane 29). So, except R278 the other Arg residues (R164, R250, R258, and
R289) were found to be important for WzySf Oag polymerisation activity. For the positions
R164, R1250, and R258 the guanidium functional group of Arg is important as Lys
substitution resulted in partial WzySf activity. In particular, certain substitutions [R164K (no
modal chain length), R250K (8-11 RUs), R258K (9-14 RUs), and R289E (8-14 RUs)] (Table
4.2) resulted in an S-LPS with a decreased Oag modal chain length.
4.4.3 WzzSf dependence and polymerisation activity
Previously we found an effect of WzzSf on WzySf Oag polymerisation activity (Nath et al.,
2015). We investigated the dependence of the mutant WzySf proteins generated above on
WzzSf for their Oag polymerisation activity. All the plasmids encoding the mutated WzySf
proteins were transformed into the strain PNRNM126 [RMA4337 (pAC/pBADT7)], which
has both wzySf and wzzSf genes inactivated. LPS profiles conferred in the PNRM126
background (!wzy !wzz) were directly compared with the LPS profiles conferred in the
PNRM6 background (!wzy). The positive control strain in the !wzy !wzz background,
PNRM134 [PNRM126 (pRMPN1)] (Table 4.1) had a class E LPS profile (S-LPS without
Oag modal length control) (Fig. 4.2, lane 2; and Table 4.2). WzySf with Ala, Lys, and Glu
substitutions of R164 resulted in similar LPS profiles both in the !wzy and !wzy !wzz
backgrounds (Fig. 4.2, lanes 3-4, 5-6, and 7-8). The WzySf mutations R250A, R250E, and
R258A resulted in similar LPS profiles both in the !wzy and !wzy !wzz backgrounds (Fig.
4.2, lanes 9-10, 13-14, and 15-16). Interestingly, WzyR250K resulted in LPS with greatly
reduced Oag polymerisation (class B) in the !wzy !wzz background (Fig. 4.2, lane 12)
compared to the !wzy background (class A1) (Fig. 4.2, lane 11). In contrast, WzyR258E
![Page 164: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/164.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and Wzz-dependent polymerisation activity
136
resulted in dramatic increase in Oag polymerisation in the !wzy !wzz background (class E)
compared to the !wzy background (Class C) (Fig. 4.2, lanes 19-20). However, WzyR258K
resulted in a class F LPS profile (Fig. 4.2, lane 18) in the !wzy !wzz background. For residue
R278, all changes resulted in class E LPS profiles (Fig. 4.2, lanes 22, 24, and 26) in the !wzy
!wzz backgrounds, as expected. WzyR289A and WzyR289E resulted in class F LPS profiles
(Fig. 4.2, lanes 28 and 32) in the !wzy !wzz background. In contrast, the !wzy !wzz strain
with WzyR289K resulted in an S-LPS lacking Oag modal chain length control (class E LPS
profile) (Fig. 4.2, lane 30) and was similar to the control PNRM134 (Fig. 4.2, lane 2). Hence,
some of the WzySf mutants showed remarkably different LPS profiles in the absence of
WzzSf, indicating WzzSf dependence of their Oag polymerisation activity as previously
reported for other WzySf mutants (Nath et al., 2015).
4.4.4 ColE2 sensitivity of strains with WzySf mutants
The ColE2 sensitivity of the strains expressing WzySf mutants was investigated to verify the
LPS profiles determined by SDS-PAGE and silver staining. The ColE2 sensitivity
(summarised in Table 4.3) was determined by spot testing as described in the Materials and
Methods.
As expected, the negative control strains RMM109, PNRM6, PNRM11, RMA4337,
and PNRM126 had the highest sensitivity to ColE2 (killing zone at a dilution of 1/256) (Table
4.3). The WT strain PE638 and the positive control with WzySf-GFP in the !wzy !wzz
background (PNRM134) were resistant to the highest concentration of ColE2 used. However,
the positive control with WzySf-GFP in the !wzy background (PNRM13) showed a killing
zone at a dilution of 1/2 (Table 4.3), as previously reported (Nath et al., 2015). Strains with a
class A LPS profile in the !wzy background was sensitive to ColE2. Among them, strains
with decreased Oag modal chain length (subclass A1) were relatively more sensitive to ColE2
(killing zone at 1/64). However, the strains with more Oag (subclass A2 and A3) showed a
![Page 165: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/165.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation
137
Table 4.3 ColE2 and bacteriophage Sf6c sensitivities, and WzySf-GFP expression levels Sensitivity* Mutant class ColE2
Sf6c Relative WzySf-GFP (%)
Strain or mutants
Relevant details !wzy background
!wzy !wzz background
Topology map location#
!wzy background
!wzy !wzz background
!wzy background
!wzy !wzz background
!wzy background
!wzy !wzz background
Strains RMM109 wzySf mutant 1/256 - R - - - PE638 Wild type R - 10-6 - - - PNRM13 Positive control 1/2 - 10-5 - 100 - PNRM6 Negative control 1/256 - R - - - PNRM11 Negative control 1/256 - R - - - RMA4337 wzySf and wzzSf
mutant - 1/256 - R - -
PNRM126 Negative control - 1/256 - R - - PNRM134 Positive control - R - 10-6 - 17 Mutants R164A C C PL3 1/256 1/256 R R 132 87 R250A B B PL5 1/128 1/128 R R 81 55 R258A C C PL5 1/256 1/256 R R 62 200 R278A D E PL5 R 1/16 10-6 N 18 14 R289A A3 F PL5 1/32 1/128 R R 14 82 R164K F F PL3 1/64 1/128 R R 120 125 R250K A1 B PL5 1/64 1/128 R R 142 11 R258K A2 F PL5 1/32 1/64 N R 104 0.02 R278K D E PL5 1/2 1/16 10-5 10-1 46 36 R289K D E PL5 1/4 1/64 10-5 N 60 38 R164E C C PL3 1/256 1/256 R R 80 99 R250E B B PL5 1/128 1/128 R R 133 143 R258E C E PL5 1/256 1/64 R R 16 38 R278E D E PL5 R 1/64 10-6 R 135 28 R289E A2 F PL5 1/32 1/64 N R 21 140
![Page 166: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/166.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
138
# PL - Periplasmic loop (See Fig. 4.1).
* R, Resistant; N, plaques detected with undiluted Sf6c stock; the numbers represent the highest
dilution showing the zone of inhibition or plaques formation.
![Page 167: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/167.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
139
killing zone at 1/32. Strains with a class B LPS profiles (both !wzy and !wzy !wzz backgrounds)
showed a killing zone at 1/128. As expected, the strains with class C LPS profiles (SR-LPS) (both
!wzy and !wzy !wzz backgrounds) showed the highest sensitivity to ColE2 (killing zone at 1/256),
and their sensitivity to ColE2 was similar to the negative control strains. Strains with WT like class
D LPS profiles (!wzy background) were more resistant to ColE2 (killing zone R-1/4). Among them
the !wzy strains with WzyR278A and WzyR289E showed ColE2 sensitivity similar to the WT strain
PE638, greater than the relevant positive control PNRM13. Strains with a class E LPS profile (!wzy
!wzz background) showed greater sensitivity to ColE2 (killing zone 1/16-1/64) compared to the
relevant positive control PNRM134, suggesting that they had a decreased level of Oag
polymerisation. Strains with a class F LPS profile in the !wzy and !wzy !wzz backgrounds were also
very sensitive to ColE2, and showed a killing zone at 1/64 or 1/128. Hence, as reported previously
(Nath et al., 2015), the ColE2 assay detects subtle differences in LPS Oag chain length and density,
which are consequences of difference in Oag polymerisation.
4.4.5 Bacteriophage Sf6c sensitivity of strains with WzySf mutants
The bacteriophage Sf6c sensitivity of the strains expressing WzySf mutants was investigated to
further verify the LPS profiles determined by SDS-PAGE and silver staining. The bacteriophage
Sf6c sensitivity of the strains (summarised in Table 4.3), carrying mutated wzySf plasmids were
determined by spot testing (see Materials and Methods).
The negative control strains (with an SR-LPS profile) RMM109, PNRM6, PNRM11,
RMA4337, and PNRM126 were all resistant to the highest concentration of bacteriophage Sf6c
tested, as expected. The WT strain PE638 and the positive control with WzySf-GFP in the !wzy !wzz
background (PNRM134) showed the highest sensitivity to bacteriophage Sf6c and showed plaques at
10-6 dilution. However, for the positive control with WzySf-GFP in the !wzy background (PNRM13)
the phage showed plaques at 10-5 (Table 4.3) (Nath et al., 2015). Strains with class A, B, C, and F
LPS profiles in the !wzy and !wzy !wzz backgrounds were resistant to the highest concentration of
![Page 168: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/168.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
140
bacteriophage Sf6c tested, similar to the negative control strains, except !wzy strain with
WzyR258K and WzyR289E showed plaques for undiluted Sf6c stock. However, the strains with
class D LPS profiles were very sensitive to bacteriophage Sf6c (plaques at 10-5 or 10-6). Among them
the !wzy !wzz strain with WzyR278A and WzyR278E showed the highest sensitivity to Sf6c and
their sensitivity to bacteriophage Sf6c was greater than the relevant positive control PNRM13, and
similar to the positive control with WzySf-GFP in the !wzy !wzz background (PNRM134). The
strains with class E LPS profile were relatively more resistant to bacteriophage Sf6c (resistant or
plaques at 10-1 or N) compared to the relevant positive control PNRM134, indicating a difference in
Oag density. Similar to our previous data (Nath et al., 2015), the bacteriophage Sf6c assays above
indicated that the degree of Oag polymerisation and density is correlated with bacteriophage Sf6c
sensitivity.
4.4.6 Protein expression levels of the WzySf mutants
We measured parental and mutant WzySf-GFP expression in the !wzy and !wzy !wzz backgrounds
by in-gel fluorescence and then calculated the % relative WzySf-GFP expression of all the mutant
strains by comparing expression levels of different WzySf-GFP mutants with the WzySf-GFP in
PNRM13 (100%) (See Materials and Methods). The positive control in the !wzy !wzz background
(PNRM134) had WzySf-GFP expression level (relative WzySf-GFP level 17%) less than the positive
control in the !wzy background (PNRM13) (Fig. 4.3A, B, and C, lanes 1 and 2, Table 4.3).
In both the !wzy and !wzy !wzz backgrounds, with some exceptions, most of the WzySf
mutants were expressed at a level less than 100%. The !wzy strain with WzyR164A had expression
of 132% (Fig. 4.3A, lane 3; and Table 4.3) but the !wzy !wzz strain with WzyR164A had a relative
WzySf-GFP level of 87% (Fig. 4.3A, lane 4; and Table 4.3). Both of these strains had an SR-LPS
profile. The !wzy !wzz strain with WzyR258A had an SR-LPS but the relative WzySf-GFP level was
![Page 169: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/169.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
141
Figure 4.3 Protein expression level of the WzySf-GFP mutants The strains were grown in LB and induced as described in the Materials and Methods. In-gel
fluorescence samples were prepared from the mutants in the "wzy and "wzy "wzz backgrounds,
and electrophoresed on SDS 15% (w/v) PAGE gels (See Materials and Methods). (A) Strains in
lane 1 and 2 are as follows: 1. PNRM13 [PNRM6 (pRMPN1)]; 2. PNRM134 [PNRM126
(pRMPN1)]. Lanes 3-12 are the "wzy or "wzy "wzz strains expressing mutated WzySf-GFP
![Page 170: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/170.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
142
proteins. The WzySf mutants in each lane are as follows: 3. R164A ("wzy), 4. R164A ("wzy
"wzz), 5. R250 ("wzy), 6. R250 ("wzy "wzz), 7. R258A ("wzy), 8. R258A ("wzy "wzz), 9.
R278A ("wzy), 10. R278A ("wzy "wzz), 11. R289A ("wzy), 12. R289A ("wzy "wzz). (B) Strains
in lane 1 and 2 are as follows: 1. PNRM13; 2. PNRM134. Lanes 3-10 are the "wzy or "wzy "wzz
strains expressing mutated WzySf-GFP proteins. The WzySf mutants in each lane are as follows:
3. R164K ("wzy), 4. R164K ("wzy "wzz), 5. R164E ("wzy), 6. R164E ("wzy "wzz), 7. R250K
("wzy), 8. R250K ("wzy "wzz), 9. R250E ("wzy), 10. R250E ("wzy "wzz). (C) Strains in lane 1
and 2 are as follows: 1. PNRM13; 2. PNRM134. Lanes 3-14 are the "wzy or "wzy "wzz strains
expressing mutated WzySf-GFP proteins. The WzySf mutants in each lane are as follows: 3.
R258K ("wzy), 4. R258K ("wzy "wzz), 5. R258E ("wzy), 6. R258E ("wzy "wzz), 7. R278K
("wzy), 8. R278K ("wzy "wzz), 9. R278E ("wzy), 10. R278E ("wzy "wzz), 11. R289K ("wzy),
12. R289K ("wzy "wzz), 13. R298E ("wzy), 14. R289E ("wzy "wzz). In each panel, the relative
WzySf-GFP level of all the mutants were measured by considering the WzySf-GFP in PNRM13 in
lane 1 as 100%. Letters (A1-3, B-F) at the bottom indicate the mutant class (Table 4.2).
![Page 171: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/171.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
143
200% (Fig. 4.3A, lane 8; and Table 4.3), which is double than the WzySf-GFP level in PNRM13.
The !wzy strain with WzyR258A had a relative WzySf-GFP level of 62% (Fig. 4.3A, lane 7; and
Table 4.3). Both the !wzy and !wzy !wzz strains with WzyR164K expressed at a level more than
100% (120% and 125%, respectively) (Fig. 4.3B, lanes 3 and 4; and Table 4.3). In the !wzy !wzz
background both WzyR250K and WzyR258K were expressed at a very low level (11% and
0.02%, respectively) (Fig. 4.3B, lane 8; Fig. 4.3C lane 4; and Table 4.3). However, in the !wzy
strain, WzyR250K and WzyR258K were expressed at high levels (142% and 104%, respectively)
(Fig. 4.3B, lane 7; Fig. 4.3C, lane 3; and Table 4.3). Interestingly, the !wzy and !wzy !wzz
strains with WzyR250E had class B LPS profile but their relative WzySf-GFP levels were 133%
and 143%, respectively (Fig. 4.3B, lanes 9 and 10; and Table 4.3). The !wzy strain with
WzyR278E and the !wzy !wzz strain with WzyR289E had very high relative WzySf-GFP levels
(135% and 140%, respectively) (Fig. 4.3C, lanes 9 and 14; and Table 4.3). However, the !wzy
!wzz strain with WzyR278E and the !wzy strain with WzyR289E had low relative WzySf-GFP
levels (28% and 21% respectively) (Fig. 4.3C, lanes 10 and 13; and Table 4.3). Comparison of %
WzySf-GFP expression levels of different mutants in the !wzy and !wzy !wzz backgrounds
indicates that the expression of certain WzySf mutant proteins was affected by WzzSf.
4.5 Discussion
Wzy proteins are essential for the synthesis of many Oags that are virulence determinants of the
Gram-negative bacteria. WzySf has two large PLs (PL3 and PL5) (Daniels et al., 1998). During
mutational characterisation of WzySf we found that the amino acid P165 in PL3 is important for
the stabilisation of WzySf through interaction with WzzSf (Nath et al., 2015). However, through
random mutagenesis we were unable to identify any other amino acid residues in PL3 and PL5
important for the Oag polymerisation activity and association with WzzSf. In this study site-
directed mutagenesis of these two loops generated mutants that were then characterised based on
![Page 172: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/172.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
144
their LPS profiles, ColE2 and bacteriophage Sf6c sensitivities, and WzySf-GFP expression to
reveal novel mutant phenotypes.
Islam et al. (2011) showed that the mutational alteration of Arg to Ala in the WzyPa PL3
and PL5 within the two RX10G motifs resulted in either complete or partial loss of Oag
polymerisation activity and alterations of some of the Arg residues to Lys resulted in LPS
profiles similar to their Ala substitution. In S. flexneri, site-directed mutation of R164, R250,
R258, and R289 to Ala also resulted in the complete or partial loss of Oag polymerisation activity
in the "wzy background. The Arg residues in PL3 and PL5 were changed to Ala, Lys, and Glu to
determine the importance of the guanidium functional group of Arg at these positions. In the
!wzy background, Ala, Lys, and Glu substitutions of R164, R250, and R258 resulted in complete
or partial loss of polymerisation (Fig. 4.2). Lys substitutions at these three positions resulted in S-
LPS with reduced degree of Oag polymerisation (class F or class A) but with different Oag modal
chain lengths [Class F (without modal chain), class A1 (8-11 RUs), class A2 (9-14 RUs)] (Fig.
4.2) compared to the relevant positive control PNRM13. These WzySf mutants (WzyR164K,
WzyR250K, and WzyR258K) resulted in LPS with different Oag modal chain lengths. So,
guanidium functional group of Arg residues at these positions had a position-specific effect on
Oag polymerisation and modal chain length control. This effect has not been reported previously
for S. flexneri wzySf mutations.
Previously, we found Wzz-dependent WzySf mutants (Nath et al., 2015). In this study, we
found several new examples of WzzSf-dependent WzySf mutants. The !wzy !wzz strain with
WzyR250K had decreased Oag polymerisation in the absence of WzzSf and the !wzy !wzz strain
with WzyR258E had increased Oag polymerisation in the absence of WzzSf, even though
WzyR258E was inactive in the !wzy background (Fig. 4.2). Hence, residues R250 and R258
have roles in the association of WzySf and WzzSf during the WzySf mediated Oag polymerisation.
These and our previous results (Nath et al., 2015) suggest that the interactions between WzySf
and WzzSf are complex.
![Page 173: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/173.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
145
The ColE2 and bacteriophage Sf6c sensitivity assays supported the LPS profiles of the
WzySf mutants. We found that the WzySf mutants with shorter Oag chains in the LPS were more
sensitive to ColE2 (Table 4.3), consistent with our previous results (Nath et al., 2015). Here we
found that in the !wzy background the strains with different Oag modal chain lengths showed
different sensitivities to ColE2, with an increase in resistance correlated with an increase in Oag
RUs in the LPS Oag modal chain. Strains with class A-C LPS profiles in the !wzy background
were resistant to bacteriophage Sf6c (Table 4.3). This result was consistent with our previous
findings (Nath et al., 2015) that bacteriophage Sf6c only infects if the S-LPS has WT or nearly
WT level of Oag polymerisation. In our previous study we found that while the strains with class
D LPS had S-LPS profiles very similar to the relevant positive control strain (PNRM13), they
were more resistant to ColE2 and more sensitive to bacteriophage Sf6c compared to PNRM13
(Nath et al., 2015). Here the !wzy strain with WzyR278A and WzyR278E showed a similar
phenotype (Fig. 4.3, and Table 4.3).
Previously, we found that WzzSf is not only associated with Oag modal chain length
control but also affects the level of WzySf (Nath et al., 2015). In the !wzy and !wzy !wzz
backgrounds most of the mutant WzySf-GFP proteins had expression levels less than the WzySf-
GFP in PNRM13 (Table 4.3). However, in the !wzy background the expression level of
WzyR164A and in the !wzy !wzz background the expression level of WzyR258A were greater
than the WzySf-GFP in PNRM13 (Table 4.3). We speculate that residues R164 and R258 are
important for the stabilisation of WzySf through a potential interaction with WzzSf. The !wzy
strain with WzyR164A and the !wzy !wzz strain with WzyR258A had SR-LPS profiles (Fig.
4.2). So, the absence of Oag polymerisation activity is not due to a lack of protein expression.
The !wzy and !wzy !wzz strains with WzyR164K and WzyR250E had a higher level of
expression compared to WzySf-GFP in PNRM13 but the LPS profiles of these strains indicated
that the mutant proteins had decreased Oag polymerisation activity compared to the relevant
positive controls (Table 4.3 and Fig. 4.3). So, these mutations in some way stabilised the protein,
both in the presence and absence of WzzSf.
![Page 174: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/174.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
146
The !wzy strain with WzyR250K and WzyR258K had high levels of expression but !wzy
!wzz strain with WzyR250K and WzyR258K had very low levels of expression (Fig. 4.3 and
Table 4.3), suggesting that the presence of WzzSf stabilises these WzySf mutants. The !wzy strain
with WzyR250K had LPS with an increased degree of Oag polymerisation compared to !wzy
!wzz strain with WzyR250K, and the !wzy and the !wzy !wzz strains with WzyR258K had
nearly similar LPS profiles (class A2 and class F), but the !wzy strain with WzyR258K had LPS
with an Oag modal chain length of 9-14 RUs (Fig. 4.2). However, all these strains had LPS with
a decreased level of Oag polymerisation compared to the relevant positive controls. These results
again suggest that Oag polymerisation activity of WzySf is not correlated with the expression
level of the protein. The !wzy strain with WzyR278E and the !wzy !wzz strain with WzyR289E
(Fig. 4.3 and Table 4.3) had higher levels of expression compared to the WzySf-GFP in PNRM13.
Hence, residues R278 and R289 are also important for the stabilisation of WzySf through a
potential interaction with WzzSf.
According to the model proposed by Islam et al. (2011), at physiological pH, WzyPa PL3
and PL5 possess a net positive charge and a net negative charge, respectively. PL3, the “capture
arm”, catches incoming negatively charged Oag subunit for subsequent transfer to PL5, which
acts as a “retention arm”. It involves a relatively transient interaction with the Oag and is
responsible for the constant binding and release of growing Oag chain. They proposed that these
characteristics of PLs support their roles in the “catch- and-release” mechanism during Oag
polymerisation by Wzy (Islam et al., 2011). Zhao et al. (2014) found that Escherichia coli O86
Wzy (WzyEc) has a different number of TM and different amino acid sequence compared to
WzyPa but the pI values of PL3 and PL4 (the two largest PLs) of WzyEc are equivalent to PL3 and
PL5 of WzyPa. At physiological pH, PL3 and PL4 of WzyEc possess a net positive charge and a
net negative charge, respectively, which led them to conclude that WzyEc follows a similar
catalytic mechanism to WzyPa (Zhao et al., 2014). For WzySf, we found that the pI values of PL3
and Pl5 were 4.65 and 5.09, respectively, using the ExPASy pI calculator
(http://web.expasy.org/compute_pi/). Hence, at physiological pH both the PL3 and PL5 of WzySf
![Page 175: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/175.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
147
possess net negative charge. While the P. aeruginosa PAO1 Oag contains negatively charged
uronic acid (Knirel et al., 2006), S. flexneri Oag is neutral. So, the charge property of the substrate
for WzySf is different from the WzyPa. Polymerisation of the Oag of all the serotypes of S. flexneri
is conducted by a single type of WzySf, which defines the flexibility of substrate recruitment of
WzySf. The RX10G motifs of WzyPa contain several other Arg residues within the motifs (R176,
R180 in PL3 and R291 in PL5) (Islam et al., 2011; Islam et al., 2013) but the WzySf had no Arg
residues within the RX15G motifs of PL3 and PL5 (Fig. 4.1). The RX10G motifs of WzyPa starts in
the PL and ends in the PL (Islam et al., 2011; Islam et al., 2013) but the RX15G motifs of WzySf
start in the PL and end in the TM (Fig. 4.1). Nevertheless, we found that the Arg residues in the
PL3 and PL5 have roles in Oag polymerisation, association with WzzSf, and WzySf expression
level. Hence, a modified version of “catch-and-release” mechanism (Islam et al., 2011) may
exist for S. flexneri Oag synthesis.
In conclusion, we identified key Arg residues in PL3 and PL5 of WzySf that are important
for the polymerisation activity, association with WzzSf during polymerisation, and WzzSf
dependent stabilisation of the protein. The WzySf mutants that confer altered Oag modal chain
length suggest that WzzSf functions to alter the activity of WzySf and this is mimicked by certain
mutational alterations, leading to change in the Oag modal chain length. The current findings
extended the previous finding (Nath et al., 2015), and we conclude that a wider region (PL 2, 3,
5, 6 and TM 5, 8) is involved in the Oag polymerisation activity and potential interaction with
WzzSf. We hypothesize that these regions may contribute to the catalytic site of WzySf.
![Page 176: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/176.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
148
4.6 Acknowledgements
Funding for this work is provided by a Program Grant to R.M. from the National Health and
Medical Research Council (NHMRC) (Grant number: 565526) of Australia. P.N. is the recipient
of an international postgraduate research scholarship (Adelaide Scholarship International) from
the University of Adelaide.
![Page 177: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/177.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
149
4.7 Supplementary information
Table 4.S1 Primers used in this study
Primer *
Sequence (5’-3’) # Mutation Arg to Ala mutation
PN5_R164A_F AGCGAGTTCTTTTTTGCCCCCGATGGGGC R164A PN6_R164A_R GCCCCATCGGGGGCAAAAAAGAACTCGCT R164A PN9_R250A_F ATGCTTTACATGGTCGGATCAGCCAGTGAAGAT
TCTGAC R250A
PN10_R250A_R GTCAGAATCTTCACTGGCTGATCCGACCATGTAAAGCAT
R250A
PN11_R258A_F GTGAAGATTCTGACTCTGTTGCCTTTAATGATTTATATTTTTATTATAAAAATGTTG
R258A
PN12_R258A_R CAACATTTTTATAATAAAAATATAAATCATTAAAGGCAACAGAGTCAGAATCTTCAC
R258A
PN13_R278A_F GCGACGTTCTTGTTTGGAGCCGGATTTGGTTCATTTATATTAG
R278A
PN14_R278A_R CTAATATAAATGAACCAAATCCGGCTCCAAACAAGAACGTCGC
R278A
PN15_R289A_F TCATTTATATTAGATCGATTAGCCATTGAAATAGTACCTCTTGAG
R289A
PN16_R289A_R CTCAAGAGGTACTATTTCAATGGCTAATCGATCTAATATAAATGA
R289A
Arg to Lys mutation PN27_R164K_F GACTAGCGAGTTCTTTTTTAAACCCGATGGGGC R164K PN28_R164K_R GCCCCATCGGGTTTAAAAAAGAACTCGCTAGTC R164K PN29_R250K_F ATGCTTTACATGGTCGGATCAAAAAGTGAAGAT
TCTGAC R250K
PN30_R250K_R GTCAGAATCTTCACTTTTTGATCCGACCATGTAAAGCAT
R250K
PN31_R258K_F CGGATCACGCAGTGAAGATTCTGACTCTGTTAAATTTAATGATT
R258K
PN32_R258K_R AATCATTAAATTTAACAGAGTCAGAATCTTCACTGCGTGATCCG
R258K
PN33_R278K_F GCGACGTTCTTGTTTGGAAAAGGATTTGGTTCATTTATATTAG
R278K
![Page 178: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/178.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
150
Table 4.S1 continued Primer *
Sequence (5’-3’) # Mutation Arg to Lys mutation PN34_R278K_R CTAATATAAATGAACCAAATCCTTTTCCAAACA
AGAACGTCGC R278K
PN35_R289K_F GGTTCATTTATATTAGATCGATTAAAAATTGAAATAGTACCTCTTGAG
R289K
PN36_R289K_R CTCAAGAGGTACTATTTCAATTTTTAATCGATCTAATATAAATGAACC
R289K
Arg to Glu mutation PN41_R164E_F GACTAGCGAGTTCTTTTTTGAGCCCGATGGGGC R164E PN42_R164E_R GCCCCATCGGGCTCAAAAAAGAACTCGCTAGTC R164E PN43_R250E_F ATGCTTTACATGGTCGGATCAGAGAGTGAAGAT
TCTGAC R250E
PN44_R250E_R GTCAGAATCTTCACTCTCTGATCCGACCATGTAAAGCAT
R250E
PN45_R258E_F CGGATCACGCAGTGAAGATTCTGACTCTGTTGAGTTTAATGATT
R258E
PN46_R258E_R AATCATTAAACTCAACAGAGTCAGAATCTTCACTGCGTGATCCG
R258E
PN47_R278E_F GCGACGTTCTTGTTTGGAGAGGGATTTGGTTCATTTATATTAG
R278E
PN48_R278E_R CTAATATAAATGAACCAAATCCCTCTCCAAACAAGAACGTCGC
R278E
PN49_R289E_F GGTTCATTTATATTAGATCGATTAGAGATTGAAATAGTACCTCTTGAG
R289E
PN50_R289E_R CTCAAGAGGTACTATTTCAATCTCTAATCGATCTAATATAAATGAACC
R289E
*F, Forward; R, Reverse; # Bold - changed codon.
![Page 179: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/179.jpg)
Mutational analysis of the major periplasmic loops of Shigella flexneri Wzy: identification of residues affecting O antigen modal chain length control and Wzz-dependent polymerisation activity
151
Table 4.S2 Periplasmic loop (PL)3 and PL5 of WzySf
PL Sequence of the PL (5’-3’) pI of the PL Sequence of the RX15G motif (5’-3’)
PL3 LNFNLIYEHLSLTSEFFFRPDGA
4.65 RPDGAFFSKSFYFFGVG
PL5 VGSRSEDSDSVRFNDLYFYYKNVDLATFLFGRGFGSFILDRLRIEIVPLEILQKT
5.09 RIEIVPLEILQKTGVIG
![Page 180: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/180.jpg)
152
![Page 181: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/181.jpg)
!!!!!!
153
Chapter 5
Detection of Wzy/Wzz interaction in Shigella flexneri
![Page 182: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/182.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
154
Detection of Wzy/Wzz interaction in Shigella flexneri
Pratiti Nath and Renato Morona
Department of Molecular and Cellular Biology, School of Biological
Sciences, University of Adelaide, Adelaide 5005, Australia
Microbiology (In Press) Published online 09 July, 2015, doi:10.1099/mic.0.000132
![Page 183: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/183.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
155
Statement of Authorship
Title of Paper Detection of Wzy/Wzz interaction in Shigella flexneri
Publication Status Submitted for publication
Publication Details Microbiology (In Press) Published online 09 July, 2015,
doi:10.1099/mic.0.000132
Author Contributions By signing the Statement of Authorship, each author certifies that their stated contribution to the publication is accurate and that permission is granted for the publication to be included in the candidate’s thesis. Name of Principal Author (Candidate)
Pratiti Nath
Contribution to the Paper Performed all experiments, performed analysis on all
samples, interpreted data, and wrote manuscript.
Signature
Date 20.5.15
Name of Co-Author Renato Morona
Contribution to the Paper Supervised development of work, helped in data
interpretation, manuscript evaluation and editing.
Signature
Date
![Page 184: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/184.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
156
Chapter 5: Third paper
5.1 Abstract
The O antigen (Oag) component of Shigella flexneri lipopolysaccharide (LPS) is important for
virulence and a protective antigen. It is synthesised by the Wzy-dependent mechanism. S. flexneri
Wzy has 12 transmembrane (TM) segments and two large periplasmic loops (PL). The modal
chain length of the Oag is determined by Wzz. Experimental evidence supports multi-protein
interactions in the Wzy-dependent pathway. However, evidence for direct interaction of Wzy
with the other proteins of the Wzy-dependent pathway is limited. Initially, we purified Wzy-
GFP-His8 and detected the presence of a dimeric form. Then in vivo crosslinking was performed
in a S. flexneri wzy mutant strain carrying plasmids encoding Wzy-GFP-His8 and untagged Wzz.
Following solubilisation with n-dodecyl-"-D-maltopyranoside (DDM) and affinity purification of
Wzy-GFP-His8, immunoblotting with Wzz antibody detected co-purification of Wzz; this was
supported by mass spectrometry (MS) analysis. This is the first reported isolation of a complex
between Wzy and Wzz. Wzy mutants (WzyR164A, WzyV92M, WzyY137H, and WzyR250K)
whose properties are affected by Wzz were able to form complexes with Wzz. Their mutational
alterations do not affect the interaction of Wzy with Wzz. Thus the interaction may involve many
regions of Wzy.
5.2 Introduction
The lipopolysaccharide (LPS) of S. flexneri plays an important role in the pathogenesis of the
bacteria (Jennison & Verma, 2004). LPS is composed of three domains - 1) Lipid A - the
hydrophobic anchor of the LPS, 2) Core oligosaccharides - a non-repeating oligosaccharide
domain, and 3) O antigen (Oag) chains - an oligosaccharide repeat domain. Oag tetrasaccharide
repeat units (RUs) are linked to the Lipid A via the Core (Raetz & Whitfield, 2002).
Oag is the most variable domain, serotype determinant, and also the protective antigen of
the bacteria (Jennison & Verma, 2004; Stagg et al., 2009; Sun et al., 2013b). S. flexneri Oag is
synthesised by the Wzy-dependent pathway (Allison & Verma, 2000; Morona et al., 1995). Oag
![Page 185: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/185.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
157
biosynthesis starts by the transfer of N-acetylglucosamine phosphate (GlcNAc-1-P) from an
UDP-GlcNAc to undecaprenol phosphate at the cytoplasmic side of the inner membrane (IM) by
WecA (Guo et al., 2008; Liu et al., 1996; Wang et al., 2010b). Then the rhamnosyl transferases
RfbG and RfbF add sequential rhamnose residues to the GlcNAc to form the RU (Morona et al.,
1994). The flippase protein Wzx translocates the RU to the periplasmic side where the RUs are
polymerised by Wzy to form the Oag. The Oag chain length is determined by Wzz, a
polysaccharide co-polymerase (PCP) type1 protein (Daniels & Morona, 1999; Morona et al.,
1995; Morona et al., 2009). Finally, the ligase WaaL ligates Oag chains to the core-lipid A to
form LPS. The Lpt proteins (Lpt A-G) transport LPS from the IM to the outer membrane (Ruiz et
al., 2008; Sperandeo et al., 2009).
The S. flexneri Oag polymerase protein Wzy (WzySf)2 is a 43.7 kDa hydrophobic integral
membrane protein. It has 12 transmembrane (TM) segments and two large periplasmic (PL)
domains (Daniels et al., 1998; Morona et al., 1994). In S. flexneri 2a Wzy activity is affected by
two types of Wzz - chromosomally encoded WzzSf 3
and pHS-2 plasmid encoded WzzpHS2
(Papadopoulos & Morona, 2010; Purins et al., 2008). This results in LPS with two types of Oag
modal chain lengths: the predominant short (S) type (11 - 17 Oag RUs) determined by Wzz, and
the minor very long (VL) type (>90 Oag RUs) determined by WzzpHS2 (Morona et al., 2003;
Morona & Van Den Bosch, 2003b). The S-type Oag chains are responsible for IcsA mediated
actin-based motility (Van den Bosch & Morona, 2003) and affects virulence (Van den Bosch et
al., 1997), and the VL-type Oag chains are responsible for resistance to complement (Hong &
Payne, 1997). Wzz and WzzpHS2 compete for the available Wzy (Carter et al., 2009).
Recent research supports the presence of multi-protein interactions in the Wzy-dependent
pathway (Marczak et al., 2013; Marczak et al., 2014; Marolda et al., 2006). Woodward et al.
purified Escherichia coli O86 Wzy (WzyEc) and showed using an in vitro assay that Wzz and
Wzy are sufficient to determine the Oag modal chain length (Woodward et al., 2010). Daniels
and Morona (1999) showed that Wzz forms a dimer in vivo and may oligomerise up to a
2 In rest of the paper we refer to WzySf as Wzy. 3 In rest of the paper we refer to WzzSf as Wzz.
![Page 186: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/186.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
158
hexamer. Tocilj et al. (2008) found PCP oligomers in the crystal structures, and suggested that
Wzz may form a scaffold and recruit Wzy. Marolda et al. (2006) provided genetic data
supporting the interaction of Wzx, Wzz, and Wzy in the Oag biosynthesis pathway but Carter et
al. (2009) failed to detect a physical interaction between Wzy and Wzz. Marczak et al. (2013)
showed by using a bacterial two-hybrid system that the Rhizobium leguminosarum PssP, which is
a PCP, interacts with PssL and PssT, which are Wzx and Wzy proteins, respectively. Recently,
they again showed that the PssP2 protein, which is also a PCP, interacts with PssT using a
bacterial two-hybrid system (Marczak et al., 2014). However, to date there is a lack of evidence
on the interaction of Wzy with other proteins of the Wzy-dependent Oag biosynthesis pathway
using more direct approaches.
In this study our aim was to detect the interaction of Wzy and Wzz by use of chemical
cross-linking of intact cells, and purification of tagged Wzy. Our western immunoblotting and
MS data support the first isolation of a Wzy and Wzz complex. Hetero-oligomeric complex
formation between Wzy mutants whose properties are Wzz-dependent and Wzz were then
investigated by cross-linking. The data indicated that these Wzy mutants could be cross-linked to
Wzz, however, there was no consistent correlation with an effect on Wzy mutant properties.
5.3 Materials and Methods
5.3.1 Ethics Statement
The Wzz antibody was produced under the National Health and Medical Research Council
(NHMRC) Australian Code of Practice for the Care and Use of Animals for Scientific Purposes
and was approved by the University of Adelaide Animal Ethics Committee.
5.3.2 Bacterial strains, growth media and growth conditions
The strains used in this study are shown in Table 5.1.
![Page 187: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/187.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
159
The growth media used were LB broth (10 g/liter tryptone, 5 g/liter yeast extract, 5 g/liter
NaCl) and LB agar (LB broth, 15 g/liter bacto agar).
Strains to be induced were initially grown in LB broth with aeration for 18 h at 37°C.
Cultures were then diluted 1/20 into fresh LB broth and grown to mid-exponential phase (OD600
of 0.4 - 0.6). To suppress Wzy-GFP-His8 expression, growth medium was supplemented with
0.2% (w/v) glucose where required. Cells were collected by centrifuged (9600 x g, Beckman
Coulter Avanti J-26XP centrifuge, 8 min, 4°C) and washed twice with LB broth to remove
glucose. To induce protein expression either 0.4 mM IPTG or 0.2% (w/v) L-Arabinose was
added and cultures grown for 20 h at 20°C. Strain PNRM271 did not require induction and was
grown in LB broth with aeration for 18 h at 37°C. Antibiotics were added as required to the
media at the following final concentrations: kanamycin (Km), 50 µg/ml; chloramphenicol (Cm)
25 µg/ml; and ampicillin (Amp), 100 µg/ml.
5.3.3 Plasmids and DNA methods
The plasmids used in this study are shown in Table 5.1. Plasmid constructs were prepared from
E. coli DH5# strains using the QIAprep Spin Miniprep kit (QIAGEN). Preparation of
electrocompetent cells and the electroporation method was described previously (Morona et al.,
2003).
![Page 188: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/188.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
160
Table 5.1 Bacterial strains and plasmids used in this study
Strains or Plasmids Characteristics* Reference Strains S. flexneri RMM109 PE638"wzy, Rifr (Morona et al., 1994) RMA4337 RMM109 "wzz (Rifr, Tetr) (Nath et al., 2015) PNRM6 RMM109 (pAC/pBADT7-1) (Nath et al., 2015) PNRM13 PNRM6 (pRMPN1) (Nath et al., 2015) PNRM16 PNRM6 (pRMPN2) (Nath & Morona, 2015) PNRM85 PNRM6 (pRMPN17) (Nath et al., 2015) PNRM122 PNRM6 (pRMPN23) (Nath et al., 2015) PNRM126 RMA4337 (pAC/pBADT7-1) (Nath et al., 2015) PNRM134 PNRM126 (pRMPN1) (Nath et al., 2015) PNRM159 PNRM13 (pWSK29-wzz) This study PNRM192 PNRM6 (pRMPN28) (Nath & Morona, 2015) PNRM271 RMM109 (pWSK29-wzz) This study PNRM289 PNRM16 (pWSK29-wzz) This study PNRM293 PNRM122 (pWSK29-wzz) This study PNRM299 PNRM85 (pWSK29-wzz) This study PNRM301 PNRM192 (pWSK29-wzz) This study E. coli Lemo21(DE3) fhuA2 (lon) ompT gal ($ DE3)
(dcm) !hsdS/ pLemo (Cmr) New England Biolabs
PNRM15 Lemo21 (DE3) (pRMPN1) This study Plasmids pAC/pBADT7-1 Source of T7 RNA polymerase; Cmr (McKinney et al., 2002) pRMPN1 pWaldo-wzy-GFPe; Kmr (Nath et al., 2015) pWSK29-wzz pWSK29 with S. flexneri 2a wzz (Murray et al., 2006) pRMPN2 pRMPN1 with WzyR164A (Nath & Morona, 2015) pRMPN17 pRMPN1 with WzyV92M (Nath et al., 2015) pRMPN23 pRMPN1 with WzyY137H (Nath et al., 2015) pRMPN28 pRMPN1 with WzyR250K (Nath & Morona, 2015)
*Rifr, rifampicin; Kmr, kanamycin resistant; Cmr, chloramphenicol resistant; Tetr, tetracycline-
resistant. $ DE3 is # sBamHIo !EcoRI-B int:(lacI::PlacUV5::T7 gene1)i21!nin5. pLemo is
pACYC184-PrhaBAD-lysY.
![Page 189: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/189.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
161
5.3.4 Purification of Wzy from Lemo21(DE3) strain
Wzy-GFP-His8 was purified from PNRM15 [Lemo21(DE3) (pRMPN1)] strain following the
method of Woodward et al. (2010) with some modifications. Cells were harvested from 200 ml
induced culture by centrifugation (9600 x g, Beckman Coulter Avanti J-26XP centrifuge, 8 min,
4°C) and the cell pellet was washed with sonication buffer (20 mM Tris-HCl, 150 mM NaCl, pH
7.5) followed by disruption of the cell by sonication (Branson B15). Cell debris was removed by
centrifugation (2200 X g, SIGMA 3K15 table top centrifuge, 10 min, 4°C), then the whole
membrane (WM) fraction was collected by ultracentrifugation (Beckman Coulter Optima L-100
XP ultracentrifuge, 250,000 X g, 1 h, 4 °C), resuspended in 500 µl Milli Q water, and 500 µl 2X
solubilisation buffer [40 mM Tris-HCl, 300 mM NaCl, 10% (w/v) sodium dodecanoyl sarcosine
(SDDS) (Anatrace), pH 7.5] added, and left 16 h at 4°C. Unsolubilised material was removed by
ultracentrifugation (Beckman Coulter Optima Max-XP tabletop ultracentrifuge, 160,000 X g, 1 h,
4°C) and the solubilised supernatant was incubated with 100 µl IMAC Ni-Charged Resin (Bio-
Rad) pre-equilibrated with equilibration buffer [20 mM Tris-HCl, 150 mM NaCl, 5 mM
imidazole, 0.1% (w/v) n-dodecyl-"-D-maltopyranoside (DDM) (Anatrace), 10% (v/v) glycerol,
pH 7.5] for 1 h at room temperature (RT). The Ni-NTA resin was washed with wash buffers [20
mM Tris-HCl, 150 mM NaCl, 0.1% (w/v) DDM, 10% (v/v) glycerol, pH 7.5] with different
imidazole concentrations (10 mM, 20 mM, and 50 mM). Finally, Wzy-GFP-His8 was eluted in
200 µl elution buffer [20 mM Tris-HCl, 150 mM NaCl, 250 mM imidazole, 0.1% (w/v) DDM,
10% (v/v) glycerol, pH 7.5].
5.3.5 In vivo protein cross-linking
In vivo cross-linking with dithiobis(succinimidyl propionate) (DSP) was performed as described
by Daniels and Morona (1999) with some modifications. Cells were harvested from 200 ml
induced cultures by centrifugation as above and the pellets were washed with DSP cross-linking
buffer [150 mM NaCl, 20 mM sodium phosphate buffer (Na2PO4/NaH2PO4), pH 7.2]. The pellets
were then resuspended in 200 ml of DSP cross-linking buffer followed by incubation with 0.2
![Page 190: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/190.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
162
mM DSP (Thermo Fischer Scientific) for 45 min at 37°C [Treated (T) samples]. A duplicate of
each sample was incubated without DSP [Untreated (UT) samples]. Excess DSP was quenched
with 20 mM Tris-HCl, pH 7.5, and the cells were washed again with DSP cross-linking buffer.
Harvested cells were then either stored at -20°C or immediately disrupted by sonication as
described below.
5.3.6 Isolation of Wzy from S. flexneri strains
Following DSP cross-linking, sonication, and isolation of WM as above; the WM fraction was
solubilised in 1 ml 1X solubilisation buffer but with 0.5 M NaCl, 20 mM imidazole, 4% (w/v)
DDM, and 10% (v/v) glycerol. After separating the unsolubilised material as above, the soluble
material was then incubated with 200 µl of Ni-NTA resin (QIAGEN) pre-equilibrated with
equilibration buffer but with 500 mM NaCl and 20 mM imidazole. The Ni-NTA resin was
washed with wash buffers with 500 mM NaCl and different imidazole concentrations (20 mM, 30
mM, 50 mM, and 80 mM). Finally, the proteins were eluted from the resin with 200 µl of elution
buffer but with 500 mM NaCl.
5.3.7 SDS-PAGE and Western Immunoblotting
Purified proteins samples were mixed 1:1 with 2X sample buffer (Lugtenberg et al., 1975)
without "-mercaptoethanol ("-ME) and heated for 5 mins at 37°C prior to electrophoresis on SDS
15% (w/v) polyacrylamide gels (SDS-15% PAGE). Protein gels were either stained with
Coomassie R-250, or subjected to western immunoblotting on nitrocellulose membrane with
either rabbit polyclonal Wzz (Daniels & Morona, 1999) at 1:750 dilution or mouse monoclonal
His6 antibodies (Genscript) at 1:50000 dilution in 2.5% (w/v) skim milk. Goat anti-rabbit
horseradish-peroxidase (HRP)-conjugate or a goat anti-mouse HRP-conjugate (KPL) was used as
secondary antibody. Blots were developed using chemiluminescence reagents (Sigma) as
described by the manufacturer (Tran et al., 2014). BenchMark protein ladder (Invitrogen) was
used as molecular mass standard.
![Page 191: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/191.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
163
5.3.8 In-gel fluorescence
In-gel fluorescence was performed as previously described with some modifications (Nath et al.,
2015). Purified proteins samples were mixed 1:1 with Buffer A [200 mM Tris-HCl (pH 8.8), 20%
(v/v) glycerol, 5 mM EDTA (pH 8.0), 0.02% (w/v) bromophenol Blue, 4% (w/v) SDS, and 0.05
M dithiothreitol (DTT)]. Then the samples were heated for 5 mins at 37°C prior to
electrophoresis on SDS-15% PAGE gels and BenchMark Fluorescent Protein Standard
(Invitrogen) was used as a molecular mass standard. Gels were rinsed with distilled water and
fluorescent imaging of the gel was performed to detect Wzy-GFP-His8 protein expression with a
Bio-Rad Gel Doc XR + System using Image Lab software (excitation at 485 nm and emission at
512 nm).
5.3.9 Liquid chromatography-electrospray ionisation tandem mass spectrometry (LC-ESI-
MS/MS)
LC-ESI-MS/MS was performed at the Adelaide Proteomics Centre. Protein samples were
electrophoresed on 4-12% (w/v) SDS PAGE gels (Invitrogen no. NPO322BOX) followed by
staining with Brilliant Blue G (Sigma). Novex sharp unstained protein standard (Thermo Fisher
Scientific) was used as molecular mass standard. Regions and bands of interest were excised and
destained with 100 mM ammonium bicarbonate (NH4HCO3) in 30% (v/v) acetonitrile (ACN).
Samples were then washed with 50 mM NH4HCO3, reduced with 0.5 µmol DTT in 50 mM
NH4HCO3, and alkylated with 2.75 µmol iodoacetamide in 100 mM NH4HCO3 followed by
digestion with 100 ng trypsin (Promega) in 5 mM NH4HCO3 in 10% (v/v) ACN. Resulting
peptides were extracted using three washes of 1% (v/v) formic acid (FA) in water, 1% (v/v) FA
in 50% (v/v) ACN, and 100% (v/v) ACN respectively. The volumes of the resulting peptide
extracts were reduced by vacuum centrifugation to approximately 1 µl and resuspended with
0.1% (v/v) formic acid in 2% (v/v) ACN to a total volume of 10 µl prior to LC-ESI-MS/MS
analysis. LC-ESI-MS/MS was performed using an Ultimate 3000 nano-flow system (Dionex)
coupled to an Impact II QTOFmass spectrometer (Bruker Daltonics) via an Advance
![Page 192: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/192.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
164
CaptiveSpray source (Bruker Daltonics). Post acquisition, acquired spectra were subjected to
peak detection and de-convolution using Compass Data Analysis for OTOF (Version 1.7, Bruker
Daltonics). Processed MS/MS spectra were then exported to Mascot generic format and
submitted to Mascot (Version 2.3.02) for identification.
5.4 Results
5.4.1 Purification of Wzy-GFP-His8 from Lemo21(DE3)
Several studies provided evidence for complex formation between proteins of the Wzy-dependent
Oag biosynthesis pathway and previously we identified an association of Wzz and Wzy by
finding Wzy mutants whose properties were Wzz dependent (Nath et al., 2015). Prior to
performing experiments to investigate the interaction of Wzy and Wzz in S. flexneri, we initially
optimised the purification of Wzy-GFP-His8 from Lemo21(DE3) strain carrying pRMPN1
(denoted as PNRM15) as described in the Materials and Methods. The purified protein from
PNRM15 was separated on an SDS-15% PAGE gels followed by Coomassie Blue staining and
in-gel fluorescence. Both the Coomassie Blue stained gel and in-gel fluorescence image showed a
band at ~64 kDa corresponding to the monomer of Wzy-GFP-His8 (Fig. 5.1A and B, lane 1). The
Coomassie Blue stained gel and in-gel fluorescence image also showed a band with an apparent
molecular weight of ~115 kDa (Fig. 5.1A and B, lane 1), which is potentially a Wzy-GFP-His8
dimer. The concentration of purified Wzy-GFP-His8 was 1 mg/ml and the purified protein was
approximately 90% pure.
![Page 193: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/193.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
165
Figure 5.1 Purification of Wzy-GFP-His8 Wzy-GFP-His8 was purified from PNRM15 [Lemo21(DE3) (pRMPN1)] as described in the
Materials and Methods. Purified protein and solubilised whole membrane fraction (WM) from
PNRM15 were electrophoresed on SDS 15% polyacrylamide gels followed by in-gel
fluorescence (A) and Coomassie Blue staining (B) (See Materials and Methods). The migration
positions of the molecular mass standards (in kDa) are indicated on the LHS.
![Page 194: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/194.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
166
5.4.2 Detection of complex formation between Wzy and Wzz by immunoblotting
After establishing a method to purify a high level of Wzy-GFP-His8, we modified this method for
S. flexneri by using different detergent, salt, and imidazole concentrations, and a different Ni-
NTA resin, to investigate the potential interaction in S. flexneri of Wzy and Wzz by in vivo
chemical cross-linking with DSP, which reacts with the lysine residues and is a fixed arm length
(12 Å), mercaptoethanol cleavable cross-linking reagent (See Materials and Methods).
The S. flexneri strains used for this cross-linking study were: 1) PNRM159 which is a wzy
mutant ("wzy) strain with plasmids pRMPN1 (encodes Wzy-GFP-His8) (Nath et al., 2015) and
pWSK29-wzz (encodes untagged Wzz) (Murray et al., 2006), 2) PNRM134 which is a wzy and
wzz double mutant ("wzy "wzz) strain with plasmid pRMPN1, and 3) PNRM271 which is a wzy
mutant strain with plasmid pWSK29-wzz. After in vivo cross-linking and affinity purification,
samples were analysed by SDS-PAGE, western immunoblotting, and in-gel fluorescence (See
Materials and Methods). The protein sample from cross-linked PNRM159 ["wzy + Wzz + Wzy-
GFP-His8] cells when subjected to western immunoblotting with anti-Wzz showed bands ranging
from ~82 kDa to above ~180 kDa (Fig. 5.2A, lane 2). However, there was no detectable band in
the equivalent regions for the protein sample from the non-cross-linked PNRM159 cells (Fig.
5.2A, lane 1). There were no detectable bands for the protein samples from non-cross-linked and
cross-linked PNRM134 ["wzy "wzz + Wzy-GFP-His8] cells (Fig. 5.2A, lanes 3 and 4).
Furthermore, the protein samples from non-cross-linked and cross-linked PNRM271 ["wzy +
Wzz] cells also had no detectable bands in the region ~82 kDa to ~180 kDa (Fig. 5.2A, lanes 5
and 6). The presence of bands ranging from ~82 kDa to above ~180 kDa in protein sample from
the cross-linked PNRM159 cells (Fig. 5.2A, lane 2) suggested that a Wzy and Wzz complex
could only be detected when DSP cross-linking was performed, and when both Wzy and Wzz
were present.
Western immunoblotting of protein samples from the cross-linked PNRM159 and
PNRM134 cells with anti-His to detect Wzy-GFP-His8 detected bands ranging from ~64 kDa to
above ~180 KDa (Fig. 5.2B, lanes 2 and 4). The bands for the protein sample from the cross-
![Page 195: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/195.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
167
Figure 5.2 In vivo cross-linking with DSP In vivo cross-linking was performed using DSP as described in the Materials and Methods.
Proteins were purified from DSP treated (T) and untreated (UT) PNRM159 ["wzy + Wzz + Wzy-
GFP-His8], PNRM134 ["wzy "wzz + Wzy-GFP-His8], and PNRM271 ["wzy + Wzz] cells.
Samples were electrophoresed on SDS 15% (w/v) polyacrylamide gels followed by western
immunoblotting with Wzz antibody (A) and His tag antibody (B), and in-gel fluorescence (C)
(See Materials and Methods). Purified Wzy-GFP-His8 from PNRM15 [Lemo21(DE3)
(pRMPN1)] was used as a positive control (lane 7) for the anti-His Western blot. The migration
![Page 196: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/196.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
168
positions of the molecular mass standards (in kDa) are indicated on the LHS. The symbols in the
figure are as follows:
Cross-linked Wzy-GFP-His8 + Wzz
Cross-linked Wzy-GFP-His8 + Wzz
Wzy-GFP-His8 monomer
Wzy-GFP-His8 dimer
![Page 197: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/197.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
169
linked PNRM134 cells (Fig. 5.2B, lane 4) were absent for the same sample probed with anti-Wzz
(Fig. 5.2A, lane 4). The bands ranging from ~82 kDa to above ~180 kDa for the protein sample
from the cross-linked PNRM159 cells detected with anti-Wzz (Fig 2A, lane 2) were also detected
with anti-His (Fig. 5.2B, lane 2). The band at ~ 64 kDa in Fig. 5.2B, lanes 1 and 3 is the Wzy-
GFP-His8 monomer, as seen for the positive control (purified Wzy-GFP-His8 from PNRM15)
(Fig. 5.2b, lane 7 and Fig. 5.1, lane 1). A band at ~115 kDa in Fig. 5.2B, lanes 1 and 3 is likely to
be a Wzy-GFP-His8 dimer, as seenas seen for the positive control (purified Wzy-GFP-His8 from
PNRM15) (Fig. 5.2B, lane 7 and Fig. 5.1, lane 1). As expected the protein samples from cross-
linked and non-cross-linked PNRM271 cells had no detectable bands when probed with anti-His
(Fig. 5.2B, lanes 5 and 6). In-gel fluorescence band profiles were similar to that detected in the
anti-His western blot (Fig. 5.2C).
5.4.3 MS analysis of protein samples following DSP cross-linking
Our western immunoblotting detected the oligomer formation between Wzz and Wzy, and to
confirm this observation MS analysis was performed on the protein bands. For MS analysis in
vivo cross-linking with DSP of the S. flexneri strains PNRM159 ["wzy + Wzz + Wzy-GFP-His8],
PNRM134 ["wzy "wzz + Wzy-GFP-His8], and PNRM271 ["wzy + Wzz] was performed
followed by purification of Wzy-GFP-His8 by affinity chromatography (a mock purification was
performed for the control strain PNRM271). The protein samples were then separated on SDS 4-
12% gels followed by Coomassie Blue staining. The bands and regions of interest were excised
from the Coomassie Blue stained gels for MS analysis (See Materials and Methods).
A section of the gel equivalent to the region (~82 kDa to above ~180 kDa) we detected
above in protein sample from the cross-linked PNRM159 cells (Fig. 5.2A, lane 2) was excised
from the Coomassie Blue stained gel (region 2 of Fig. 5.3B, lane 2), and after MS analysis the
presence of peptides from Wzy and Wzz were detected (Table 5.2). However, in the equivalent
region of the protein sample from the non-cross-linked PNRM159 cells (region 1 of Fig. 5.3B,
lane 1) had peptides from Wzy but no peptides from Wzz were detected (Table 5.2). The
![Page 198: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/198.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
170
![Page 199: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/199.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
171
Figure 5.3 Analysis of protein bands by MS Strains were grown as described in the Materials and Methods. In vivo cross-linking was
performed using DSP. Samples were prepared and were subjected to SDS-PAGE as described in
the Materials and Methods. Proteins were purified from DSP treated (T) and untreated (UT)
PNRM159 ["wzy + Wzz + Wzy-GFP-His8], PNRM134 ["wzy "wzz + Wzy-GFP-His8], and
PNRM271 ["wzy + Wzz] cells. Protein samples were solubilised and electrophoresed on SDS
15% (w/v) polyacrylamide gels (A) and on SDS 4-12% (w/v) gels (B) followed by Coomassie
Blue staining. Bands and regions of interest were excised from the Coomassie Blue stained SDS
4-12% (w/v) gel (B) for MS analysis. The excised regions were marked by numbers (1-8) in the
boxes on the figure. A section of the bands between ~82 kDa to above ~180 kDa corresponding
to the region showing the oligomer formation in Fig. 5.2A was excised from the Coomassie Blue
stained gel (region 2). Equivalent regions were excised for the other samples from the Coomassie
Blue stained gel (regions 1, 3, 4, 5, and 6). The ~50 kDa band (monomeric Wzy) and ~90 kDa
band (dimeric Wzy) were excised (regions 8 and 7, respectively). The migration positions of the
molecular mass standards (in kDa) are indicated on the LHS.
![Page 200: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/200.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
172
Table 5.2 Detected peptides by MS analysis
Excised region ¶
Detected Wzz peptides Detected Wzy peptides Location of Wzy peptides on the topology map* #
1 No Wzz peptide GFGSFILDR PL5 NVDLATFLFGR PL5 LLEPLGIFPLR PL1 FNDLYFYYK PL5 IEIVPLEILQK PL5 LRIEIVPLEILQK PL5
2 QNLLDIEK GFGSFILDR PL5 VSDLQETLIGR NVDLATFLFGR PL5 NQQLPLTVSYVGQTAEGAQMK LLEPLGIFPLR PL1 FSSAFSALAETLDNQEEPEKLTIEPSVK FNDLYFYYK PL5 IEIVPLEILQK PL5 LRIEIVPLEILQK PL5
3 No Wzz peptide GFGSFILDR PL5 NVDLATFLFGR PL5
4 No Wzz peptide NVDLATFLFGR PL5 IEIVPLEILQK PL5 LRIEIVPLEILQK PL5
5 No Wzz peptide No Wzy peptide 6 No Wzz peptide No Wzy peptide 7 No Wzz peptide GFGSFILDR PL5
VFSCEIFIK CL2 NVDLATFLFGR PL5 LLEPLGIFPLR PL1 FNDLYFYYK PL5 IEIVPLEILQK PL5 LRIEIVPLEILQK PL5 SEDSDSVRFNDLYFYYK PL5
8 No Wzz peptide GFGSFILDR PL5 NVDLATFLFGR PL5 LLEPLGIFPLR PL1 FNDLYFYYK PL5 IEIVPLEILQK PL5 LRIEIVPLEILQK PL5 SEDSDSVRFNDLYFYYK PL5
¶ Regions refer to Fig. 5.3; * Wzy topology map is provided as Supplementary Fig. 5.S1;
# PL, periplasmic loop; CL, cytoplasmic loop.
![Page 201: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/201.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
173
equivalent regions of the protein samples from the non-cross-linked and cross-linked PNRM134
cells (region 3 of Fig. 5.3B, lane 3 and region 4 of Fig. 5.3B, lane 4) had peptides from Wzy but
no Wzz peptides were detected (Table 5.2). As expected, the equivalent regions of the protein
samples from the non-cross-linked and cross-linked PNRM271 cells (region 5 of Fig. 5.3B, lane
5 and region 6 of Fig. 5.3B, lane 6) had only a few non-relevant peptides (data not shown).
MS identification was carried out on the band corresponding to the monomeric Wzy (Fig.
5.1, lane 1 and Fig. 5.2B, lanes 1, 3, and 7). The Wzy-GFP-His8 migrated as a triplet at ~50 kDa
in the SDS 4-12% gels and was denoted as region 8 (Fig. 5.3B, lane 1). MS analysis of region 8
detected Wzy as the predominant protein (Table 5.2). The ~115 kDa band (Fig. 5.1, lane 1 and
Fig. 5.2B, lanes 1, 3, and 7) proposed to be a Wzy-GFP-His8 dimer migrated as a doublet at ~90
kDa in the SDS 4-12% gels, and was denoted as region 7 (Fig. 5.3B, lane 1). MS analysis of
region 7 also detected Wzy as the predominant protein (Table 5.2). No Wzz peptides were
detected in these bands. Hence, the MS analysis confirmed the result observed by western
immunoblotting and in-gel fluorescence.
It is important to mention that in the bands excised above from protein samples obtained
from cross-linked and non-cross-linked S. flexneri strains expressing Wzy-GFP-His8 (PNRM159
and PNRM 134), no other protein known to be involved in Wzy-dependent Oag biosynthesis was
detected by MS analysis.
5.4.4 Analysis of the Wzy mutants with Wzz dependent properties
Previously we identified a number of Wzz-dependent Wzy mutants (Nath & Morona, 2015; Nath
et al., 2015). These Wzy mutants had either partial or null polymerisation activity and their
activity or expression was altered by the presence or absence of Wzz. The Wzy mutants that
expressed mutant Wzy-GFP-His8 at a level comparable to the WT Wzy-GFP-His8 in the positive
control strain (PNRM13) were selected for in vivo cross-linking assay. Plasmid pWSK29-wzz
was transformed into PNRM6 ("wzy) with pWaldo-TEV-GFP plasmids encoding WzyR164A-
GFP-His8, WzyV92M-GFP-His8, WzyY137H-GFP-His8, and WzyR250K-GFP-His8 (Table 5.1).
![Page 202: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/202.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
174
Figure 5.4 Chemical cross-linking of WzySf mutants In vivo cross-linking was performed using DSP as described in the Materials and Methods.
Proteins were purified from DSP treated (T) and untreated (UT) PNRM159 ["wzy + Wzz + Wzy-
GFP-His8], and PNRM6 ("wzy) with pWSK29-wzz and expressing mutated Wzy proteins as
indicated. WT and Wzy-GFP-His8 mutant proteins were purified and electrophoresed on SDS
15% (w/v) polyacrylamide gels followed by western immunoblotting with Wzz antibody. The
migration positions of the molecular mass standards (in kDa) are indicated on the LHS.
![Page 203: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/203.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
175
Then in vivo crosslinking was performed followed by purification of mutant Wzy-GFP-His8 (See
Materials and Methods). The proteins were analysed by SDS-PAGE followed by western blotting
with Wzz antibody. The protein samples of the cross-linked Wzy mutants showed bands from
~82 kDa to above ~180 kDa (Fig. 5.4, lanes 3, 5, 7, and 9) similar to the protein sample from
cross-linked PNRM159 ["wzy + Wzz + Wzy-GFP-His8] cells (Fig. 5.4, lane 1). There were no
detectable bands for the protein samples from the non-cross-linked mutant Wzy strains (Fig. 5.4,
lanes 4, 6, 8, and 10). Hence, all Wzy mutants could be cross-linked to Wzz.
5.5 Discussion
The Wzy-dependent pathway is one of the most widely distributed polysaccharide biosynthesis
pathway in the nature. Oag is one of the important virulence determinants for a number of
bacteria including S. flexneri. S. flexneri Oag polymerisation protein Wzy was identified more
than 20 years ago (Morona et al., 1994) but its low expression and detectability (Daniels et al.,
1998) impeded its purification and characterisation. Recently, we were able to identify functional
amino acid residues of Wzy (Nath & Morona, 2015; Nath et al., 2015) but further understanding
of Wzy and its interaction with other Oag biosynthesis proteins require a method to purify and
isolate Wzy. In this work we were consistently able to purify high levels of S. flexneri Wzy
protein. For a long time, multi-protein complex formation among the proteins of the Wzy
dependent Oag biosynthesis pathway has been suggested (Marolda et al., 2006; Whitfield, 2006;
Whitfield, 2010; Woodward et al., 2010).
However, here for the first time we were able to isolate a complex between Wzz and Wzy,
and found that the Wzy mutants with Wzz dependent properties can also form complexes with
Wzz following chemical cross-linking.Wzy is a membrane spanning protein, and in common
with many membrane proteins this made purification of Wzy difficult. Woodward et al. (2010)
for the first time were able to purify a Wzy protein, WzyEc. They detected a band (36 kDa)
corresponding to the WzyEc monomer and they also detected a band at a higher molecular weight
(58 kDa) which they proposed to be the dimer of WzyEc (Woodward et al., 2010). We were able
![Page 204: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/204.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
176
to obtain high yield of ~90% pure monomeric Wzy-GFP-His8 which migrated as band at ~64 kDa
(Fig. 5.1A and B, lane 1). Previously, Daniels et al. (1998) showed by western immunoblotting
using anti-PhoA serum that Wzy::PhoA fusion protein was able to form a dimer. Our purified
protein also showed a band ~115 kDa (Fig. 5.1A and B, lane 1) which we proposed was the
dimer of Wzy. Both the monomeric and proposed dimeric forms of Wzy showed positive signals
in the anti-His western blot (Fig. 5.2b, lane 7). The MS analysis for this proposed dimeric Wzy
confirmed the prevalence of Wzy peptides. So, Wzy may form dimers but the in vivo correlation
of the dimeric form with the polymerisation activity is yet unknown.
In a previous study to detect Wzy and Wzz complex Carter et al. (2009) inserted a 3xFLAG
tag at the 3’ end of the chromosomal wzy and wzz, resulting in cells expressing C-terminal
3xFLAG fusion Wzy and Wzz proteins. Then they performed in vivo cross-linking with DSP and
disuccinimidyl glutarate (DSG) followed by sonication to obtain WM fractions. The WM
fractions were separated on 4-12% Tris-Glycine gels and then probed by western immunoblotting
followed by infrared imaging to detect the protein complex. However, they were unable to detect
interaction between Wzy and Wzz and they suggested that Wzy and Wzz may not physically
interact (Carter et al., 2009). Wzy is expressed at a very low level in S. flexneri. So, the detection
of the interaction of this protein with the other proteins of the Wzy-dependent pathway may be
difficult. In our study we used a high level of Wzy and Wzz. The MS analysis of the ~82 kDa to
~180 kDa bands detected peptides for Wzy and Wzz (region 2, Fig. 5.3B, lane 2) (Table 5.2), and
hence supported the detection of Wzy and Wzz complex formation by western immunoblotting.
Our MS analysis of the ~82 kDa to ~180 kDa region of the gel (region 2, Fig. 5.3B, lane 2),
detected peptides of Wzz and Wzy but we were unable to detect peptides from the other proteins
of the Wzy-dependent Oag biosynthesis pathway. Furthermore, except for one peptide, the Wzy
peptides we detected were from the periplasmic regions of Wzy (Table 5.2) (Fig. 5.S1, in the
Supplemental Material). So, the standard trypsin digestion and associated methods used for MS
analysis (See Materials and Methods) may be limited in their applicability to detect the
membrane spanning proteins of the Wzy-dependent Oag biosynthesis pathway.
Previously we found that Wzy needs Wzz both for its activity and expression level /stability
![Page 205: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/205.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
177
and we identified a number of Wzy mutants where either the polymerisation activity or the
expression of these mutants was influenced by Wzz. These Wzy mutants had partial or null
polymerisation activity (Nath & Morona, 2015; Nath et al., 2015). Many of these Wzz-dependent
Wzy mutants had a very low-level of expression. Hence, purification of these mutant proteins
was not possible. We selected some of these Wzy mutants with a better expression level and
assessed their ability to form complexes with Wzz. Following DSP crosslinking all the mutants
formed complexes with Wzz similar to the control (Fig. 5.4). Hence, for these Wzy mutants no
correlation between complex formation and the Wzz dependence could be detected. Wzy
interaction may involve many regions of Wzy and single point mutation may not be enough to
interrupt the interactions.
This study for the first time provides direct evidence of complex formation between Wzy
and Wzz, proteins of the Wzy-dependent Oag biosynthesis pathway. The molecular details
regarding the interaction of these proteins still need to be revealed including, the nature of the
interaction sites, and how this contributes to Oag biosynthesis. This study provides the
foundation to investigate this interaction.
5.6 Acknowledgements
Funding for this work is provided by a program grant to R.M. from the National Health and
Medical Research Council (NHMRC) (Grant number: 565526) of Australia. P.N. is the recipient
of an international postgraduate research scholarship (Adelaide scholarship International) from
the University of Adelaide. The University of Adelaide Research Centre for Infectious Disease
provided travel funding support for P.N.
![Page 206: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/206.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
178
5.7 Supplementary information
Figure 5.S1 Topology map of WzySf S. flexneri Wzy has 12 TMs and two large PLs. The positions of PL1 to 5, TM 1 to 12, and
cytoplasmic loops (CL 1 to 5) are indicated on the Wzy topology map [adapted from Daniels et
al. (1998)].
![Page 207: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/207.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
179
5.7.1 Optimisation of WzySf-GFP-His8 purification 4
Purification of WzySf-GFP-His8 was performed after confirming that the construct pRMPN1 was
able to express WzySf-GFP-His8 and was able to complement the wzySf deficiency in a wzySf
deficient strain (RMM109).
5.7.1.1 Cell fractionation
Strain PNRM15 was grown and induced with IPTG for 20 h at 20°C. Cells were harvested from
200 ml induced culture by centrifugation (9600 x g, Beckman Coulter Avanti J-26XP centrifuge,
8 min, 4°C). The harvested cell pellets was washed with sonication buffer (20 mM Tris-HCl, 150
mM NaCl, pH 7.5) and was disrupted by sonication (Branson B15) followed by centrifugation
(2200 X g, SIGMA 3K15 table top centrifuge, 10 min, 4°C) to remove cell debris. Then the
whole membrane (WM) fraction was isolated by ultracentrifugation (Beckman Coulter Optima L-
100 XP ultracentrifuge, 250,000 X g, 1 h, 4 °C) and was used for the purification of WzySf-GFP-
His8.
5.7.1.2 Optimisation of whole membrane fraction solubilisation
To optimise the solubilisation of WM, the WM fractions were resuspended in 500 µl Milli Q
water and then solubilised in 500 µl 2X solubilisation buffer (40 mM Tris-HCl, 300 mM NaCl,
pH 7.5) containing different detergents [2% (w/v) DDM, 2% (w/v) Lauryldimethylamine-oxide
(LDAO), 2% (w/v) SDS, 5% (w/v) Zwittergent 3-14, 2% (w/v) Sodium lauroyl sarcosine
(Sarkosyl), and 10% (w/v) SDDS] at different temperatures (RT or 4°C). Unsolubilised material
was separated by ultra centrifugation (Beckman Coulter Optima Max-XP tabletop ultracentrifuge,
4 Section 5.7.1 onwards were not part of the original manuscript and were added as additional information for the
thesis chapter.
![Page 208: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/208.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
180
Figure 5.S2 Optimisation of the whole membrane solubilisation Whole membrane fractions of PNRM15 were solubilised in 2x solubilisation buffer containing
2% (w/v) SDS, 2% (w/v) LDAO, 2% (w/v) sarkosyl, 5% (w/v) Zwittergent 3-14, 2% (w/v) DDM
for 1h at room temperature (RT); and 10% (w/v) SDDS for overnight at 4°C as described in
section 5.7.1.2. Unsolubilised material was separated by ultra centrifugation. Supernatants and
unsolubilised pellets were collected. In-gel fluorescence was performed to assess the amount of
WzySf-GFP-His8 in the supernatants (A) and pellets (B).
![Page 209: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/209.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
181
160,000 X g, 1 h, 4°C). Supernatants and unsolubilised pellets were collected. In-gel fluorescence
was performed to check the amount of WzySf-GFP- His8 in the supernatants and pellets (Fig.
5.S2). In the in-gel fluorescence image the WM solubilised with SDDS showed the highest
WzySf-GFP-His8 expression for the supernatant (Fig. 5.S2A, lane 6) and the lowest WzySf-GFP-
His8 expression for the unsolubilised pellet (Fig. 5.S2B, lane 6). Hence, the detergent SDDS was
selected for WM solubilisation and the WM was resuspended in 500 µl of Mili Q water followed
by solubilisation with 500 µl of 2X solubilisation buffer [40 mM Tris-HCl, 300 mM NaCl, 10%
(w/v) SDDS, pH 7.5] at 4°C for overnight. The solubilised supernatant was used for eltuion of
WzySf-GFP-His8.
5.7.1.3 Metal affinity purification of WzySf-GFP-His8
100 µl IMAC Ni-Charged Resin (Bio-Rad) was equilibrated with equilibration buffer [20 mM
Tris-HCl, 150 mM NaCl, 5 mM imidazole, 0.1% (w/v) DDM, 10% (v/v) glycerol, pH 7.5] and
incubated with solubilised supernatant in a 10 ml Falcon tube for 1 h at RT with gentle shaking.
The mixture was centrifuged (Labofuge 400R Heraeus Instrument, 3000 rpm, 10 min), the
supernatant was discarded, and the Ni-NTA beads were washed with 5 ml wash buffer [20 mM
Tris-HCl, 150 mM NaCl, 0.1% (w/v) DDM, 10% (v/v) glycerol, pH 7.5] with different imidazole
concentrations (10 mM, 20 mM, and 50 mM). The beads were incubated at RT for 5 min with
gentle rotation for each wash. Finally, the His8 tagged WzySf-GFP protein was eluted in 200 µl
elution buffer [20 mM Tris-HCl, 150 mM NaCl, 250 mM imidazole, 0.1% (w/v) DDM, 10%
(v/v) glycerol, pH 7.5] at RT for 1 h with gentle rotation.
5.7.2 Negative dominance
To check the importance of the dimerisation for the functioning of WzySf the negative dominance
study was performed. For this study the WzySf mutants (WzyR164A, WzyR250A, WzyR278A, WzyR289A, WzyG130V, WzyL11I, WzyL214I, WzyP352H) (See Chapter 3 and 4) were co-
![Page 210: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/210.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
182
![Page 211: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/211.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
183
Figure 5.S3 Negative dominance Plasmids pRMPN1 with mutations in the wzySf gene were transformed into WT S. flexneri strain
PE638 as described in section 1.7.2. Strains were grown and LPS samples were prepared
followed by electrophoresis on an SDS-15% PAGE gel. The gel was stained with silver nitrate
and developed with formaldehyde. Lane 1, PE638; Lane 2, Strain PNRM12 [PE638 (pWaldo-
TEV-GFP) (pAC/pBADT7-1)]; Lane 3, Strain PNRM14 [PE638 (pRMPN1) (pAC/pBADT7-1)];
Lanes 4 to 11, PE638 strain with pAC/pBADT7-1 and plasmids encoding mutated WzySf
proteins, as indicated.
![Page 212: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/212.jpg)
Detection of Wzy/Wzz interaction in Shigella flexneri
184
-expressed with WT WzySf. If the dimerisation is important for functioning then the formation of
mixed oligomer of the mutant WzySf and WT WzySf might cause the inactivation of WT WzySf
protein due to the presence of compromised WzySf protein in the oligomer.
Plasmid pRMPN1 having mutations in the wzySf gene expressing mutated WzySf proteins
(WzyR164A, WzyR250A, WzyR278A, WzyR289A, WzyP352H, WzyL214I, WzyL111I, and
WzyG130V) (Table 2.2) was co-transformed with pAC/pBADT7-1 into the WT S. flexneri strain
PE638 (Table 2.1). pAC/pBADT7-1 encodes T7 RNA polymerase, which drives the expression
of wzySf-gfp in pRMPN1. Strains were grown in LB broth with aeration for 18 h at 37°C and
diluted 1/20 into fresh LB broth and grown to mid-exponential phase (OD600, 0.4 to 0.6). To
suppress protein expression growth medium was supplemented with 0.2% (w/v) glucose. Cells
were centrifuged (2,200 X g; Sigma 3K15 tabletop centrifuge; 10 min; 4°C) and washed twice
with LB broth to remove glucose. To induce protein expression 0.2% (w/v) L-Arabinose was
added to the cultures and grown for 20 h at 20°C. Antibiotics Km (50 µg/ml) and Cm (25 µg /ml)
was added to the medium. LPS samples were prepared as described previously (Chapter 2). The
LPS samples were then electrophoresed on an SDS-15% PAGE gel for 16 to 18 h at 12 mA. The
gel was stained with silver nitrate and developed with formaldehyde.
Strain PE638 had S-LPS profile. After transformation of the plasmids expressing mutated
WzySf proteins into PE638, the generated strains also had S-LPS profiles similar to the WT
PE638 (Fig. 5.S3). Interestingly, some of theses mutated WzySf proteins had partial (WzyR289A,
WzyP352H, and WzyL214I) and some had null (WzyR164A, WzyR250A, and WzyG130V)
activity. Hence, the dimer formation of WzySf may be not essential for the functioning of WzySf.
![Page 213: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/213.jpg)
185
Chapter 6
Conclusion
![Page 214: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/214.jpg)
Conclusion
186
Chapter 6: onclusion
6.1 Introduction
According to a review of literature from 1966-1997, annually ~164.7 million shigellosis cases
occurred worldwide, of which 163.2 million cases were in developing countries with 1.1 million
deaths (Kotloff et al., 1999). However, a current review of literature from 1990-2009 suggested
that ~125 million shigellosis cases occur annually in Asia with 14,000 fatalities (Bardhan et al.,
2010). The later author suggested that the number of deaths by shigellosis was reduced by 98%
possibly due to improved nutrition, vitamin A supplementation, less virulent strains, and
availability of antimicrobial drugs (Bardhan et al., 2010; Kotloff et al., 1999). Due to
antimicrobial resistance, load of disease, and clinical severity, Shigella is a significant target of
vaccine development (Livio et al., 2014), however there is no available vaccine for shigellosis
(Stagg et al., 2009).
The immunity against S. flexneri is serotype specific and different serotypes of S. flexneri are
generated due to different chemical structure of the LPS Oag RUs (Jennison & Verma, 2004;
Stagg et al., 2009) (detailed in Chapter 1). However, the Oags of all the S. flexneri serotypes are
polymerised by a single type of Oag polymerase WzySf (Daniels et al., 1998; Morona et al.,
1994). Hence, the characterisation and purification of WzySf is potentially useful for in vitro
synthesise of Oag, which will be a great resource for S. flexneri vaccine development in future.
Several proteins are involved in the Wzy-dependent Oag biosynthesis pathway. For a long
time, researchers speculated that these Oag biosynthesis proteins are associated with each other
and may form a multi-protein complex (Marolda et al., 2006; Whitfield, 2006; Whitfield, 2010;
Woodward et al., 2010) (detailed in Chapter 1 and 5). Hence, identification of these associations
will help to understand the Wzy-dependent Oag biosynthesis pathway.
Below is an overview of the outcomes of this thesis. The results characterised WzySf,
identified the association of WzySf and WzzSf during Oag biosynthesis pathway; and established a
foundation to understand the Wzy-dependent Oag biosynthesis pathway.
![Page 215: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/215.jpg)
Conclusion
187
6.2 Residues important for polymerisation function of WzySf
Only a few studies have been conducted to characterise the Wzy proteins of different bacterial
species. Kim et al. (2010) characterised WzyFt and predicted it has 11 TM segments. Islam et al.
(2010) created a topology map of WzyPa, which had 14 TM segments. Previous experimental data
on WzySf topological mapping identified 12 TM segments (Daniels et al., 1998) which is
different to that found in WzyFt and WzyPa. There is also little sequence identity between wzy
genes and Wzy proteins of different bacterial species (Morona et al., 1994). Hence, random
mutagenesis (Chapter 3) was performed on the wzySf and identified a number of residues (V92,
G130, L214, and P352) important for the polymerisation function of WzySf. These residues are
present in the PL2, TM5, TM8, and PL6. Previous characterisation of the Wzy from the other
bacteria identified important functional residues only in the PLs (Islam et al., 2013; Kim et al.,
2010). However, this study for the first time was able to identify functional residues in the TMs
of WzySf. In Chapter 3, the ColE2 sensitivity assay was used for screening of mutants, and also to
verify the LPS profiles of the mutant strains. This method was found to be an effective method to
identify subtle differences in the LPS profiles of the mutant strains. The bacteriophage Sf6c
sensitivity assay was also used for the first time as an effective method to characterise the WzySf
mutants based on their LPS profiles. Significantly, this approach found mutations in WzySf that
resulted in different LPS phenotypes (SR LPS, LPS with few Oag RUs, and reduced
polymerisation) and also generated strains (Class D) which had LPS profiles nearly similar to the
positive control strain but their Oag density was more than that of the positive control strain.
Other than this study on WzySf, the most characterised Wzy is WzyPa. In WzyPa the Arg
residues (R175, R176, R180, R290, and R291) in the PL3 and PL5 are important for the function
(Islam et al., 2011). Site-directed mutagenesis of the Arg residues in the PL3 and PL5 of WzySf
also identified several functionally important Arg residues (R164, R250, R258, and R289). The
PL3 and PL5 of WzyPa has RX10G motifs which are important for the “catch-and-release”
mechanism (Islam et al., 2011). Zhao et al. (2014) found that WzyEc has a different number of
TM and different amino acid sequence compared to WzyPa but the pI values of PL3 and PL4 (the
two largest PLs) of WzyEc are equivalent to PL3 and PL5 of WzyPa, which led them to conclude
![Page 216: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/216.jpg)
Conclusion
188
that WzyEc follows a similar catalytic mechanism to WzyPa. Marczak et al. (2013) found that
PssT has RX10G motifs in the two PLs similar to WzyPa. They proposed that these RX10G motifs
might be associated with the polymerisation activity (Marczak et al., 2013).
Comparison of WzySf with WzyPa shows a number of striking differences: comparatively
different pI values for PL3, different number of TMs, and absence of RX10G motifs and instead
the presence of RX15G motifs in the PL3 and PL5; different arrangement of the Arg residues in
the motifs; and different substrate specificity of WzySf compared to WzyPa (Table 6.1). The
unique characteristics of WzySf also suggest that it follows a different or a modified mechanism
for its polymerisation function compared to WzyPa and other Wzy proteins (including WzyEc and
PssT).
6.3 Purification of WzySf
Due to the transmembrane nature, the purification of Wzy was always challenging (Woodward et
al., 2010). WzySf is a hydrophobic protein with a low percentage of G + C content in the coding
region (Daniels et al., 1998; Morona et al., 1994). The first evidence of the purification of Wzy
protein was the work of Woodward et al. (2010) (detailed in Chapter 1 and 5). WzySf was
purified using the Woodward et al. protocol with some modifications (Chapter 5), that include
using a different cloning vector, overexpression system [Lemo21(DE3)], Ni-beads, centrifugation
speed, and avoiding the concentration and desalting steps, FPLC, and gradient elution. The
method purified 1 mg/ml of ~90% pure monomeric WzySf (Fig. 5.1). This is the first evidence of
purification of S. flexneri WzySf. Woodward et al. (2010) used further purification steps and
concentrated their purified protein but the yield of WzyEc was almost undetectable in a
Coomassie Blue stained gel [see Supplementary Fig. 2.b of Woodward et al. (2010)]. Without
![Page 217: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/217.jpg)
Conclusion
189
Table 6.1 Comparison of WzySf and WzyPa
Characteristics WzySf WzyPa
Number of TM 12 14 pI value of PL3 4.65 8.59
Charge property of PL3 at pH 7.4 Negatively charged Positively charged Motifs in PL3 and PL5 RX15G RX10G
Arrangement of the Arg residues in the motifs
No Arg residue within the RX15G motif
Arg residue within the RX10G motif
Charge property of substrate Neutral Negative
![Page 218: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/218.jpg)
Conclusion
190
further purification [see Supplementary Fig. 2.a of Woodward et al. (2010)] their purified protein
was highly contaminated and the yield was also less compared to purified WzySf although
minimum steps were used during WzySf purification. Woodward et al. (2010) suggested that
WzyEc is able to form a dimer; and previously Daniels et al. (1998) showed by Western
immunoblotting using anti-PhoA serum that Wzy::PhoA fusion protein was able to form a dimer.
The data in Chapter 5 shows that WzySf is able to form a dimer, which also supported by
proteomics analysis. However, the experiments to determine negative dominance (Chapter 5)
suggest that the dimer formation has no correlation with the functioning of the protein. Further
investigation is needed to identify the connection of dimer formation with the functioning of
WzySf.
6.4 Understanding the association of the Oag biosynthesis proteins
The data in Chapters 3 and 4 for the first time provide the insight into the association of WzzSf
and WzySf in the Oag biosynthesis pathway. Seven WzySf amino acid residues (V92, Y137,
G130, L214, R250, R258, and P352) were identified that are important for the polymerisation
function of WzySf through the interaction with WzzSf (Table 6.2). For four of the WzySf mutants
(WzyV92M, WzyG130V, WzyY137H, and WzyR258E) the presence of WzzSf repressed WzySf
polymerisation activity and for three of the WzySf mutants (WzyL214I, WzyR250K, and
WzyP352H) the presence of WzzSf increased WzySf polymerisation activity. WzzSf also has role
in the stability of the WzySf protein. Eight amino acid residues (G130, R164, P165, L191, R250,
R258, R278, and R289) were identified which are important for the WzzSf dependent stabilisation
of WzySf (Table 6.2). For five WzySf mutants (WzyR164A, WzyL191F, WzyR250K,
WzyR258K, and WzyR278E) the presence of WzzSf stabilises WzySf but for four WzySf mutants
(WzyG130V, WzyP165S, WzyR258A, and WzyR289E) the absence of WzzSf stabilises the
protein. Residue R258 is important for stabilisation of WzySf but exhibited opposite effects
depending on the nature of the amino acid substitutions. The amino acid residues important for
![Page 219: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/219.jpg)
Conclusion
191
Table 6.2 LPS profiles of the Wzz-dependent WzySf mutants in the presence and absence of
WzzSf
Mutation LPS profile WzzSf present WzzSf absent
R164A C (SR-LPS) C R164K F [S-LPS with reduced Oag polymerisation
and lacking Oag modal chain length control (<30 Oag RUs)]
F
R164E C C R250A B [LPS with few Oag RUs (<11)] B R250K A1 [S-LPS with reduced Oag polymerisation,
and modal chain length reduced to 8-11 RUs] B
R250E B B R258A C C R258K A2 [S-LPS with reduced polymerisation and
modal chain length reduced to 9-14 or 8-14 Oag RUs]
F
R258E C E [S-LPS lacking Oag modal chain length control] R278A D [LPS profile similar to the WT control
PNRM13] E
R278K D E R278E D E R289A A3 [S-LPS with reduced polymerisation (<22
Oag RUs) and modal chain length similar to the WT control (PNRM13)]
F
R289K D E R289E A2 F P352H A [S-LPS with reduced polymerisation (<20
Oag RUs)] B
V92M A E Y137H A E L214I B C G130V C F N147K D E P165S D E L191F D E
![Page 220: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/220.jpg)
Conclusion
192
the association with WzzSf are not only present in the PL (PL2, 3, 5, and 6) but also present in the
TM (TM 5, 7, and 8). Noticeably, the amino acid G130 present in the TM5 has roles both in the
polymerisation activity of WzySf and association with WzzSf. WzzSf has both negative and
positive effects on the polymerisation ability and stability of WzySf.
Although several authors had suggested the complex formation by the proteins of the
Wzy-dependent Oag biosynthesis pathway, only Marolda et al. (2006) provided genetic evidence
about the association of Wzx, Wzy, and Wzz; and Marczak et al. showed by using a bacterial
two-hybrid system, that the R. leguminosarum PssP interacts with PssL and PssT (Marczak et al.,
2013; Marczak et al., 2014). However, there is no evidence about the direct physical interactions
of these proteins. In vivo chemical cross-linking followed by purification of WzySf identified
WzySf and WzzSf complex formation. Proteomics analysis also supported this data (Chapter 5).
The detected WzySf and WzzSf complex formation provides the first evidence of a close physical
interaction of the proteins of the Wzy-dependent Oag biosynthesis pathway. Although the
mutational data indicate that PL2, 3, 5, 6, and TM 5, 7, and 8 are involved in the association of
WzySf and WzzSf, the complex formation ability of the Wzz-dependent WzySf mutants with WzzSf
suggests that more extensive interactions between WzySf and WzzSf also occur.
6.5 Mechanism of the association of Wzz and Wzy during the O antigen
polymerisation in S. flexneri
There are several proposed models on the interaction of Wzy and Wzz, and on the Wzy-
dependent Oag polymerisation (described in Chapter 1). Some of them considered the direct
interaction of Wzz and Wzy. However, some models described the association of these proteins
through the interaction with the Oag polymer. Considering the merits and limitations of all the
proposed models and the result of this thesis I propose an “activation and inactivation”
mechanism (Fig. 6.1) to explain the polymerisation of Oag by WzySf and the association of WzzSf
and WzySf during the Oag biosynthesis process.
![Page 221: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/221.jpg)
Conclusion
193
It is known that certain Wzy proteins such as Yersinia pseudotuberculosis (WzyYp), have
an absolute requirement for Wzz for polymerisation activity (Kenyon & Reeves, 2013). However,
WzySf has activity without WzzSf but the Oag lacks modal chain length control. In this model,
WzySf has two forms: activated (or stabilised) and inactivated (or destabilised). These two forms
switch spontaneously. WzzSf acts as a molecular chaperone protein and promotes a certain
frequency of switching likely controlling the polymerisation activity of WzySf and the modal
chain length of the growing Oag chain. For WzyYp and the other Wzy proteins that need Wzz
strictly for polymerisation activity, there is no spontaneous switching and Wzz is essential to
control the switching between the activated and inactivated forms of Wzy. Previously, Morona et
al. (1995) also proposed that Wzz acts as a molecular chaperone to facilitate the interaction of
WaaL, Wzy, and lipid-linked Oag chain (Morona et al., 1995).
Data generated from the mutational study suggests that in S. flexneri WzzSf binds at
different regions of WzySf during the Oag polymerisation process. Some of the regions can be
speculated through this mutational study but a number of other regions may be involved. The
presence of WzzSf stabilises WzyR164A, WzyL191F, WzyR250K, WzyR258, and WzyR278E;
and increased polymerisation activity of WzyL214I, WzyR250K, and WzyP352H. However,
presence of WzzSf destabilises WzyG130V, WzyP165S, WzyR258A, and WzyR289E and
repressed polymerisation activity of WzyV92M, WzyG130V, WzyY137H, and WzyR258E.
Hence, initially, WzzSf binds at a region (including R164, L191, R250, R258, and R278) of WzySf
which facilitates the switching towards the “activated” (or stabilised) form of WzySf, and the
activation of WzySf turns on the rapid polymerisation and WzySf starts to synthesise the nascent
Oag chain (the spontaneous polymerisation of WzySf is a slow process). Then WzzSf binds to
other regions (including L214 and P352) of WzySf as well. Mechanical feedback of this binding
facilitates the Oag synthesis and WzzSf controls the Oag modal chain length by interacting with
it. The WzzSf binding regions (denoted as “activation region”) that have roles in activating WzySf
and polymerisation are present in close proximity within the WzySf quaternary structure.
![Page 222: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/222.jpg)
Conclusion
194
Figure 6.1 “Activation and inactivation” mechanism The activated or stabilised, and inactivated or destabilised forms of WzySf interconvert/switch
spontaneously. However, WzzSf acts as a molecular chaperone protein and promotes a certain
frequency of switching which controls the polymerisation activity of WzySf at certain level and
also determines the modal chain length of the growing Oag. Activated WzySf synthesises Oag,
and finally binding of WzzSf at certain regions of WzySf generates mechanical feedback which
releases the synthesised Oag from the substrate binding site of WzySf. Residues in PL2, 3, 5, 6
and TM5, 7, 8 of WzySf are involved in the switching between the two forms by possible
interactions with WzzSf.
![Page 223: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/223.jpg)
Conclusion
195
Next, WzzSf moves to bind to the other regions (including G130, P165, and R289) of WzySf
which facilitates the switching towards the “inactivated” (or destabilised) form of WzySf, and the
inactivated WzySf turns off polymerisation. Then WzzSf binds to the other regions of WzySf
(including V92 and Y137) as well. Mechanical feedback of this binding releases the Oag chain
from the substrate binding domain of WzySf. WzzSf binding regions (denoted as “inactivation
region”) that have roles in inactivating WzySf and releasing the growing Oag chain may be
present in close proximity within the WzySf quaternary structure.
The mutational study showed that amino acid R258 of WzySf has a role in the WzzSf-
dependent stabilisation and destabilisation of WzySf, and R258 also has role in the WzzSf
dependent repression of polymerisation activity of WzySf depending on the mutational
substitutions (R258A, R258K, and R258E). Residue R258 is critical for interaction with WzzSf
and exhibits allele specific effects on Wzz-dependence, polymerisation activity, and protein
stability. The activation and inactivation regions are present on the PL2, 3, 5, 6, and TM5, 7, and
8. The residue R258 may be present in the middle of the activation and inactivation regions
within the WzySf quaternary structure.
6.6 Conclusion and future work
Collectively, this thesis identified and characterised functionally important amino acid
residues of WzySf, identified several novel LPS phenotypes conferred by the WzySf mutants, and
found that WzzSf affects the functioning and stability of WzySf, both positively and negatively.
The work also first time identified direct physical interaction of WzzSf and WzySf, and developed
a purification method for WzySf. We speculate that the PL2, 3, 5, 6 and TM5, 7, 8 may form the
catalytic site of the protein. However, the interaction of WzzSf and WzySf may be conducted on a
wider region of WzySf.
WzySf mutants were generated by mutagenesis on wzySf in pRMPN1. Hence, the effect of
mutations was measured for the overexpressed protein. Repetition of the mutagenesis on
![Page 224: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/224.jpg)
Conclusion
196
chromosomal wzySf can be performed to understand if there is any effect of the overexpression on
the functioning of WzySf mutants.
During characterisation of WzySf and identification of the association of WzzSf and WzySf
(Chapter 3 and 4) all the mutational studies were conducted in S. flexneri Y serotype. However,
for all the S. flexneri serotypes the Oag polymerisation is conducted by a single type of WzySf.
Although the WT WzySf protein is identical in all serotypes, it will be meaningful to investigate
the effect of the mutation on WzySf functioning and association with WzzSf in different serotypes
to know if these mutations have any serotype specific effects.
Woodward et al. (2010) performed the first in vitro polymerisation assay and showed that
WzySf and WzzSf are sufficient to shape Oag. The purified WT WzySf protein can be used in an in
vitro polymerisation assay. Purified WzzSf can also be added to the in vitro system to control the
chain length. After optimisation of the protocol, different purified mutated WzySf proteins can be
used instead of the WT protein to understand the actual mechanism of Oag polymerisation and
association with WzzSf.
Preparing a safe and efficient vaccine against S. flexneri infection is the only way to control
the disease. As the S. flexneri infection is serotype specific, the conjugated vaccines using
detoxified LPS can be used as a vaccine. However, the conjugated vaccines have deficiencies
including accurate control of the detoxification step (Phalipon et al., 2006). Hence, purified
WzySf and WzzSf may be useful to produce Oag in vitro for vaccine development against S.
flexneri infection.
WzzSf determines the S-type (11-17 Oag RUs) Oag and previous study indicated that S-type
Oag is required for maintaining the polar localisation of IcsA for efficient actin-based motility
and cell-to-cell spreading (Morona & Van Den Bosch, 2003b; Van den Bosch & Morona, 2003).
Control over the functioning of WzySf and WzzSf can stop the infection caused by S. flexneri and
these two proteins are potential targets for anti-infection drug development.
![Page 225: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/225.jpg)
197
Bibliography
![Page 226: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/226.jpg)
Bibliography
198
Bibliography
Abeyrathne, P. D. & Lam, J. S. (2007). Conditions that allow for effective transfer of
membrane proteins onto nitrocellulose membrane in Western blots. Can J Microbiol 53, 526-532.
Adams, M. M., Allison, G. E. & Verma, N. K. (2001). Type IV O antigen modification genes
in the genome of Shigella flexneri NCTC 8296. Microbiology 147, 851-860.
Adhikari, P., Allison, G., Whittle, B. & Verma, N. K. (1999). Serotype 1a O-antigen
modification: molecular characterization of the genes involved and their novel organization in the
Shigella flexneri chromosome. J Bacteriol 181, 4711-4718.
Al Mamun, A. A., Tominaga, A. & Enomoto, M. (1996). Detection and characterization of the
flagellar master operon in the four Shigella subgroups. J Bacteriol 178, 3722-3726.
Allaoui, A., Sansonetti, P. J. & Parsot, C. (1992). MxiJ, a lipoprotein involved in secretion of
Shigella Ipa invasins, is homologous to YscJ, a secretion factor of the Yersinia Yop proteins. J
Bacteriol 174, 7661-7669.
Allaoui, A., Sansonetti, P. J. & Parsot, C. (1993). MxiD, an outer membrane protein necessary
for the secretion of the Shigella flexneri Ipa invasins. Mol Microbiol 7, 59-68.
![Page 227: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/227.jpg)
Bibliography
199
Allison, G. E. & Verma, N. K. (2000). Serotype-converting bacteriophages and O-antigen
modification in Shigella flexneri. Trends Microbiol 8, 17-23.
Allison, G. E., Angeles, D., Tran-Dinh, N. & Verma, N. K. (2002). Complete genomic
sequence of SfV, a serotype-converting temperate bacteriophage of Shigella flexneri. J Bacteriol
184, 1974-1987.
Anderson, M. S., Bulawa, C. E. & Raetz, C. R. (1985). The biosynthesis of gram-negative
endotoxin. Formation of lipid A precursors from UDP-GlcNAc in extracts of Escherichia coli. J
Biol Chem 260, 15536-15541.
Anderson, M. S. & Raetz, C. R. (1987). Biosynthesis of lipid A precursors in Escherichia coli.
A cytoplasmic acyltransferase that converts UDP-N-acetylglucosamine to UDP-3-O-(R-3-
hydroxymyristoyl)-N-acetylglucosamine. J Biol Chem 262, 5159-5169.
Anderson, M. S., Bull, H. G., Galloway, S. M., Kelly, T. M., Mohan, S., Radika, K. & Raetz,
C. R. (1993). UDP-N-acetylglucosamine acyltransferase of Escherichia coli. The first step of
endotoxin biosynthesis is thermodynamically unfavorable. J Biol Chem 268, 19858-19865.
![Page 228: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/228.jpg)
Bibliography
200
Ashida, H., Toyotome, T., Nagai, T. & Sasakawa, C. (2007). Shigella chromosomal IpaH
proteins are secreted via the type III secretion system and act as effectors. Mol Microbiol 63, 680-
693.
Ashkenazi, S., Cleary, K. R., Pickering, L. K., Murray, B. E. & Cleary, T. G. (1990). The
association of Shiga toxin and other cytotoxins with the neurologic manifestations of shigellosis.
J Infect Dis 161, 961-965.
Bardhan, P., Faruque, A. S., Naheed, A. & Sack, D. A. (2010). Decrease in shigellosis-related
deaths without Shigella spp.-specific interventions, Asia. Emerg Infect Dis 16, 1718-1723.
Bastin, D. A., Stevenson, G., Brown, P. K., Haase, A. & Reeves, P. R. (1993). Repeat unit
polysaccharides of bacteria: a model for polymerization resembling that of ribosomes and fatty
acid synthetase, with a novel mechanism for determining chain length. Mol Microbiol 7, 725-
734.
Batchelor, R. A., Haraguchi, G. E., Hull, R. A. & Hull, S. I. (1991). Regulation by a novel
protein of the bimodal distribution of lipopolysaccharide in the outer membrane of Escherichia
coli. J Bacteriol 173, 5699-5704.
![Page 229: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/229.jpg)
Bibliography
201
Baudry, B., Maurelli, A. T., Clerc, P., Sadoff, J. C. & Sansonetti, P. J. (1987). Localization of
plasmid loci necessary for the entry of Shigella flexneri into HeLa cells, and characterization of
one locus encoding four immunogenic polypeptides. J Gen Microbiol 133, 3403-3413.
Bennish, M. L. (1991). Potentially lethal complications of shigellosis. Rev Infect Dis 13 Suppl 4,
S319-324.
Bergey, D. H. & Breed, R. S. (1957). Bergey's manual of determinative bacteriology, Seventh
Edition edn: Baltimore, Williams & Wilkins Co.
Bernardini, M. L., Mounier, J., d'Hauteville, H., Coquis-Rondon, M. & Sansonetti, P. J.
(1989). Identification of icsA, a plasmid locus of Shigella flexneri that governs bacterial intra-
and intercellular spread through interaction with F-actin. Proc Natl Acad Sci U S A 86, 3867-
3871.
Bishop, R. E. (2014). Structural biology: Lipopolysaccharide rolls out the barrel. Nature 511, 37-
38.
Blocker, A., Gounon, P., Larquet, E., Niebuhr, K., Cabiaux, V., Parsot, C. & Sansonetti, P.
(1999). The tripartite type III secreton of Shigella flexneri inserts IpaB and IpaC into host
membranes. J Cell Biol 147, 683-693.
![Page 230: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/230.jpg)
Bibliography
202
Blocker, A., Jouihri, N., Larquet, E., Gounon, P., Ebel, F., Parsot, C., Sansonetti, P. &
Allaoui, A. (2001). Structure and composition of the Shigella flexneri "needle complex", a part of
its type III secreton. Mol Microbiol 39, 652-663.
Bone, R. C. (1993). Gram-negative sepsis: a dilemma of modern medicine. Clin Microbiol Rev 6,
57-68.
Brahmbhatt, H. N., Lindberg, A. A. & Timmis, K. N. (1992). Shigella lipopolysaccharide:
structure, genetics, and vaccine development. Curr Top Microbiol Immunol 180, 45-64.
Brandon, L. D. & Goldberg, M. B. (2001). Periplasmic transit and disulfide bond formation of
the autotransported Shigella protein IcsA. J Bacteriol 183, 951-958.
Brandon, L. D., Goehring, N., Janakiraman, A., Yan, A. W., Wu, T., Beckwith, J. &
Goldberg, M. B. (2003). IcsA, a polarly localized autotransporter with an atypical signal peptide,
uses the Sec apparatus for secretion, although the Sec apparatus is circumferentially distributed.
Mol Microbiol 50, 45-60.
Buchrieser, C., Glaser, P., Rusniok, C., Nedjari, H., D'Hauteville, H., Kunst, F., Sansonetti,
P. & Parsot, C. (2000). The virulence plasmid pWR100 and the repertoire of proteins secreted
by the type III secretion apparatus of Shigella flexneri. Mol Microbiol 38, 760-771.
![Page 231: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/231.jpg)
Bibliography
203
Carter, J. A., Jimenez, J. C., Zaldivar, M., Alvarez, S. A., Marolda, C. L., Valvano, M. A. &
Contreras, I. (2009). The cellular level of O-antigen polymerase Wzy determines chain length
regulation by WzzB and WzzpHS-2 in Shigella flexneri 2a. Microbiology 155, 3260-3269.
Casjens, S., Winn-Stapley, D. A., Gilcrease, E. B., Morona, R., Kuhlewein, C., Chua, J. E.,
Manning, P. A., Inwood, W. & Clark, A. J. (2004). The chromosome of Shigella flexneri
bacteriophage Sf6: complete nucleotide sequence, genetic mosaicism, and DNA packaging. J
Mol Biol 339, 379-394.
Charles, M., Perez, M., Kobil, J. H. & Goldberg, M. B. (2001). Polar targeting of Shigella
virulence factor IcsA in Enterobacteriacae and Vibrio. Proc Natl Acad Sci U S A 98, 9871-9876.
Chng, S. S., Gronenberg, L. S. & Kahne, D. (2010). Proteins required for lipopolysaccharide
assembly in Escherichia coli form a transenvelope complex. Biochemistry 49, 4565-4567.
Clark, C. A., Beltrame, J. & Manning, P. A. (1991). The oac gene encoding a
lipopolysaccharide O-antigen acetylase maps adjacent to the integrase-encoding gene on the
genome of Shigella flexneri bacteriophage Sf6. Gene 107, 43-52.
Clements, A., Tull, D., Jenney, A. W., Farn, J. L., Kim, S. H., Bishop, R. E., McPhee, J. B.,
Hancock, R. E., Hartland, E. L., Pearse, M. J., Wijburg, O. L., Jackson, D. C., McConville,
![Page 232: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/232.jpg)
Bibliography
204
M. J. & Strugnell, R. A. (2007). Secondary acylation of Klebsiella pneumoniae
lipopolysaccharide contributes to sensitivity to antibacterial peptides. J Biol Chem 282, 15569-
15577.
Cohen, D., Green, M. S., Block, C., Rouach, T. & Ofek, I. (1988). Serum antibodies to
lipopolysaccharide and natural immunity to shigellosis in an Israeli military population. J Infect
Dis 157, 1068-1071.
Collins, L. V. & Hackett, J. (1991). Molecular cloning, characterization, and nucleotide
sequence of the rfc gene, which encodes an O-antigen polymerase of Salmonella typhimurium. J
Bacteriol 173, 2521-2529.
Cornelis, G. R. (2006). The type III secretion injectisome. Nat Rev Microbiol 4, 811-825.
Cossart, P. (2000). Actin-based motility of pathogens: the Arp2/3 complex is a central player.
Cell Microbiol 2, 195-205.
Cossart, P. & Sansonetti, P. J. (2004). Bacterial invasion: the paradigms of enteroinvasive
pathogens. Science 304, 242-248.
![Page 233: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/233.jpg)
Bibliography
205
Crowell, D. N., Reznikoff, W. S. & Raetz, C. R. (1987). Nucleotide sequence of the
Escherichia coli gene for lipid A disaccharide synthase. J Bacteriol 169, 5727-5734.
Cunliffe, R. N. & Mahida, Y. R. (2004). Expression and regulation of antimicrobial peptides in
the gastrointestinal tract. J Leukoc Biol 75, 49-58.
D'Hauteville, H., Khan, S., Maskell, D. J., Kussak, A., Weintraub, A., Mathison, J.,
Ulevitch, R. J., Wuscher, N., Parsot, C. & Sansonetti, P. J. (2002). Two msbB genes encoding
maximal acylation of lipid A are required for invasive Shigella flexneri to mediate inflammatory
rupture and destruction of the intestinal epithelium. J Immunol 168, 5240-5251.
Daniels, C., Vindurampulle, C. & Morona, R. (1998). Overexpression and topology of the
Shigella flexneri O-antigen polymerase (Rfc/Wzy). Mol Microbiol 28, 1211-1222.
Daniels, C. & Morona, R. (1999). Analysis of Shigella flexneri Wzz (Rol) function by
mutagenesis and cross-linking: wzz is able to oligomerize. Mol Microbiol 34, 181-194.
Davis, J., Wang, J., Tropea, J. E., Zhang, D., Dauter, Z., Waugh, D. S. & Wlodawer, A.
(2008). Novel fold of VirA, a type III secretion system effector protein from Shigella flexneri.
Protein Sci 17, 2167-2173.
![Page 234: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/234.jpg)
Bibliography
206
Dong, H., Xiang, Q., Gu, Y., Wang, Z., Paterson, N. G., Stansfeld, P. J., He, C., Zhang, Y.,
Wang, W. & Dong, C. (2014). Structural basis for outer membrane lipopolysaccharide insertion.
Nature 511, 52-56.
Drew, D., Lerch, M., Kunji, E., Slotboom, D. J. & de Gier, J. W. (2006). Optimization of
membrane protein overexpression and purification using GFP fusions. Nat Methods 3, 303-313.
DuPont, H. L., Levine, M. M., Hornick, R. B. & Formal, S. B. (1989). Inoculum size in
shigellosis and implications for expected mode of transmission. J Infect Dis 159, 1126-1128.
Egile, C., d'Hauteville, H., Parsot, C. & Sansonetti, P. J. (1997). SopA, the outer membrane
protease responsible for polar localization of IcsA in Shigella flexneri. Mol Microbiol 23, 1063-
1073.
Egile, C., Loisel, T. P., Laurent, V., Li, R., Pantaloni, D., Sansonetti, P. J. & Carlier, M. F.
(1999). Activation of the CDC42 effector N-WASP by the Shigella flexneri IcsA protein
promotes actin nucleation by Arp2/3 complex and bacterial actin-based motility. J Cell Biol 146,
1319-1332.
![Page 235: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/235.jpg)
Bibliography
207
Fixen, K. R., Janakiraman, A., Garrity, S., Slade, D. J., Gray, A. N., Karahan, N.,
Hochschild, A. & Goldberg, M. B. (2012). Genetic reporter system for positioning of proteins at
the bacterial pole. MBio 3.
Formal, S. B., Oaks, E. V., Olsen, R. E., Wingfield-Eggleston, M., Snoy, P. J. & Cogan, J. P.
(1991). Effect of prior infection with virulent Shigella flexneri 2a on the resistance of monkeys to
subsequent infection with Shigella sonnei. J Infect Dis 164, 533-537.
Fulla, N., Prado, V., Duran, C., Lagos, R. & Levine, M. M. (2005). Surveillance for
antimicrobial resistance profiles among Shigella species isolated from a semirural community in
the northern administrative area of santiago, chile. Am J Trop Med Hyg 72, 851-854.
Galan, J. E. & Collmer, A. (1999). Type III secretion machines: bacterial devices for protein
delivery into host cells. Science 284, 1322-1328.
Galloway, S. M. & Raetz, C. R. (1990). A mutant of Escherichia coli defective in the first step
of endotoxin biosynthesis. J Biol Chem 265, 6394-6402.
Goldberg, M. B., Barzu, O., Parsot, C. & Sansonetti, P. J. (1993). Unipolar localization and
ATPase activity of IcsA, a Shigella flexneri protein involved in intracellular movement. Infect
Agents Dis 2, 210-211.
![Page 236: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/236.jpg)
Bibliography
208
Goldberg, M. B. & Theriot, J. A. (1995). Shigella flexneri surface protein IcsA is sufficient to
direct actin-based motility. Proc Natl Acad Sci U S A 92, 6572-6576.
Goldberg, M. B. (2001). Actin-based motility of intracellular microbial pathogens. Microbiol
Mol Biol Rev 65, 595-626.
Goldman, S. R., Tu, Y. & Goldberg, M. B. (2008). Differential regulation by magnesium of the
two MsbB paralogs of Shigella flexneri. J Bacteriol 190, 3526-3537.
Gray, A. N., Li, Z., Henderson-Frost, J. & Goldberg, M. B. (2014). Biogenesis of YidC
cytoplasmic membrane substrates is required for positioning of autotransporter IcsA at future
poles. J Bacteriol 196, 624-632.
Guan, S. & Verma, N. K. (1998). Serotype conversion of a Shigella flexneri candidate vaccine
strain via a novel site-specific chromosome-integration system. FEMS Microbiol Lett 166, 79-87.
Guan, S., Bastin, D. A. & Verma, N. K. (1999). Functional analysis of the O antigen
glucosylation gene cluster of Shigella flexneri bacteriophage SfX. Microbiology 145 1263-1273.
Guo, H., Yi, W., Song, J. K. & Wang, P. G. (2008). Current understanding on biosynthesis of
microbial polysaccharides. Curr Top Med Chem 8, 141-151.
![Page 237: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/237.jpg)
Bibliography
209
Hale, T. L., Oaks, E. V. & Formal, S. B. (1985). Identification and antigenic characterization of
virulence-associated, plasmid-coded proteins of Shigella spp. and enteroinvasive Escherichia
coli. Infect Immun 50, 620-629.
Hale, T. L. (1991). Genetic basis of virulence in Shigella species. Microbiol Rev 55, 206-224.
Hale, T. L. & Keren, D. F. (1992). Pathogenesis and immunology in shigellosis: applications for
vaccine development. Curr Top Microbiol Immunol 180, 117-137.
Heinrichs, D. E., Yethon, J. A., Amor, P. A. & Whitfield, C. (1998). The assembly system for
the outer core portion of R1- and R4-type lipopolysaccharides of Escherichia coli. The R1 core-
specific beta-glucosyltransferase provides a novel attachment site for O-polysaccharides. J Biol
Chem 273, 29497-29505.
Hitchcock, P. J. & Brown, T. M. (1983). Morphological heterogeneity among Salmonella
lipopolysaccharide chemotypes in silver-stained polyacrylamide gels. J Bacteriol 154, 269-277.
Hong, M. & Payne, S. M. (1997). Effect of mutations in Shigella flexneri chromosomal and
plasmid-encoded lipopolysaccharide genes on invasion and serum resistance. Mol Microbiol 24,
779-791.
![Page 238: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/238.jpg)
Bibliography
210
Hong, S., Cha, I., Kim, N. O., Kim, S. H., Jung, K. T., Lee, J. H., Kim, D. W., Park, M. S. &
Kang, Y. H. (2012). Enhanced Type III Secretion System Expression of Atypical Shigella
flexneri II:(3)4,7(8). Osong Public Health Res Perspect 3, 222-228.
Ingersoll, M., Groisman, E. A. & Zychlinsky, A. (2002). Pathogenicity islands of Shigella.
Curr Top Microbiol Immunol 264, 49-65.
Islam, S. T., Taylor, V. L., Qi, M. & Lam, J. S. (2010). Membrane topology mapping of the O-
antigen flippase (Wzx), polymerase (Wzy), and ligase (WaaL) from Pseudomonas aeruginosa
PAO1 reveals novel domain architectures. MBio 1.
Islam, S. T., Gold, A. C., Taylor, V. L., Anderson, E. M., Ford, R. C. & Lam, J. S. (2011).
Dual conserved periplasmic loops possess essential charge characteristics that support a catch-
and-release mechanism of O-antigen polymerization by Wzy in Pseudomonas aeruginosa PAO1.
J Biol Chem 286, 20600-20605.
Islam, S. T., Huszczynski, S. M., Nugent, T., Gold, A. C. & Lam, J. S. (2013). Conserved-
residue mutations in Wzy affect O-antigen polymerization and Wzz-mediated chain-length
regulation in Pseudomonas aeruginosa PAO1. Sci Rep 3, 3441.
![Page 239: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/239.jpg)
Bibliography
211
Islam, S. T. & Lam, J. S. (2014). Synthesis of bacterial polysaccharides via the Wzx/Wzy-
dependent pathway. Can J Microbiol 60, 697-716.
Jain, S. & Goldberg, M. B. (2007). Requirement for YaeT in the outer membrane assembly of
autotransporter proteins. J Bacteriol 189, 5393-5398.
Jakhetia, R., Marri, A., Stahle, J., Widmalm, G. & Verma, N. K. (2014). Serotype-conversion
in Shigella flexneri: identification of a novel bacteriophage, Sf101, from a serotype 7a strain.
BMC Genomics 15, 742.
Jennison, A. V. & Verma, N. K. (2004). Shigella flexneri infection: pathogenesis and vaccine
development. FEMS Microbiol Rev 28, 43-58.
Jin, Q., Yuan, Z., Xu, J., Wang, Y., Shen, Y., Lu, W., Wang, J., Liu, H., Yang, J., Yang, F.,
Zhang, X., Zhang, J., Yang, G., Wu, H., Qu, D., Dong, J., Sun, L., Xue, Y., Zhao, A., Gao,
Y., Zhu, J., Kan, B., Ding, K., Chen, S., Cheng, H., Yao, Z., He, B., Chen, R., Ma, D., Qiang,
B., Wen, Y., Hou, Y. & Yu, J. (2002). Genome sequence of Shigella flexneri 2a: insights into
pathogenicity through comparison with genomes of Escherichia coli K12 and O157. Nucleic
Acids Res 30, 4432-4441.
![Page 240: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/240.jpg)
Bibliography
212
Jouihri, N., Sory, M. P., Page, A. L., Gounon, P., Parsot, C. & Allaoui, A. (2003). MxiK and
MxiN interact with the Spa47 ATPase and are required for transit of the needle components
MxiH and MxiI, but not of Ipa proteins, through the type III secretion apparatus of Shigella
flexneri. Mol Microbiol 49, 755-767.
Kalynych, S., Ruan, X., Valvano, M. A. & Cygler, M. (2011). Structure-guided investigation
of lipopolysaccharide O-antigen chain length regulators reveals regions critical for modal length
control. J Bacteriol 193, 3710-3721.
Kalynych, S., Valvano, M. A. & Cygler, M. (2012a). Polysaccharide co-polymerases: the
enigmatic conductors of the O-antigen assembly orchestra. Protein Eng Des Sel 25, 797-802.
Kalynych, S., Yao, D., Magee, J. & Cygler, M. (2012b). Structural characterization of closely
related O-antigen lipopolysaccharide (LPS) chain length regulators. J Biol Chem 287, 15696-
15705.
Kanegasaki, S. & Wright, A. (1973). Studies on the mechanism of phage adsorption: interaction
between phage epsilon15 and its cellular receptor. Virology 52, 160-173.
![Page 241: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/241.jpg)
Bibliography
213
Kaniuk, N. A., Vinogradov, E., Li, J., Monteiro, M. A. & Whitfield, C. (2004). Chromosomal
and plasmid-encoded enzymes are required for assembly of the R3-type core oligosaccharide in
the lipopolysaccharide of Escherichia coli O157:H7. J Biol Chem 279, 31237-31250.
Kenyon, J. J. & Reeves, P. R. (2013). The Wzy O-antigen polymerase of Yersinia
pseudotuberculosis O:2a has a dependence on the Wzz chain-length determinant for efficient
polymerization. FEMS Microbiol Lett 349, 163-170.
Kim, D. W., Lenzen, G., Page, A. L., Legrain, P., Sansonetti, P. J. & Parsot, C. (2005). The
Shigella flexneri effector OspG interferes with innate immune responses by targeting ubiquitin-
conjugating enzymes. Proc Natl Acad Sci U S A 102, 14046-14051.
Kim, T. H., Sebastian, S., Pinkham, J. T., Ross, R. A., Blalock, L. T. & Kasper, D. L. (2010).
Characterization of the O-antigen polymerase (Wzy) of Francisella tularensis. J Biol Chem 285,
27839-27849.
Kim, T. H., Pinkham, J. T., Heninger, S. J., Chalabaev, S. & Kasper, D. L. (2012). Genetic
modification of the O-polysaccharide of Francisella tularensis results in an avirulent live
attenuated vaccine. J Infect Dis 205, 1056-1065.
![Page 242: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/242.jpg)
Bibliography
214
Kintz, E. N. & Goldberg, J. B. (2011). Site-directed mutagenesis reveals key residue for O
antigen chain length regulation and protein stability in Pseudomonas aeruginosa Wzz2. J Biol
Chem 286, 44277-44284.
Klee, S. R., Tzschaschel, B. D., Timmis, K. N. & Guzman, C. A. (1997). Influence of different
rol gene products on the chain length of Shigella dysenteriae type 1 lipopolysaccharide O antigen
expressed by Shigella flexneri carrier strains. J Bacteriol 179, 2421-2425.
Knirel, Y. A., Bystrova, O. V., Kocharova, N. A., Zahringer, U. & Pier, G. B. (2006).
Conserved and variable structural features in the lipopolysaccharide of Pseudomonas aeruginosa.
J Endotoxin Res 12, 324-336.
Knirel, Y. A., Kondakova, A. N., Vinogradov, E., Lindner, B., Perepelov, A. V. & Shashkov,
A. S. (2011). Lipopolysaccharide core structures and their correlation with genetic groupings of
Shigella strains. A novel core variant in Shigella boydii type 16. Glycobiology 21, 1362-1372.
Kocks, C., Marchand, J. B., Gouin, E., d'Hauteville, H., Sansonetti, P. J., Carlier, M. F. &
Cossart, P. (1995). The unrelated surface proteins ActA of Listeria monocytogenes and IcsA of
Shigella flexneri are sufficient to confer actin-based motility on Listeria innocua and Escherichia
coli respectively. Mol Microbiol 18, 413-423.
![Page 243: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/243.jpg)
Bibliography
215
Kondakova, A. N., Vinogradov, E. V., Shekht, M. E., Markina, A. A., Lindner, B., L'Vov V,
L., Aparin, P. G. & Knirel' Iu, A. (2010). Structure of the oligosaccharide region (core) of the
lipopolysaccharides of Shigella flexneri types 2a and 5b. Bioorg Khim 36, 429-432.
Koster, F., Levin, J., Walker, L., Tung, K. S., Gilman, R. H., Rahaman, M. M., Majid, M.
A., Islam, S. & Williams, R. C., Jr. (1978). Hemolytic-uremic syndrome after shigellosis.
Relation to endotoxemia and circulating immune complexes. N Engl J Med 298, 927-933.
Kotloff, K. L., Winickoff, J. P., Ivanoff, B., Clemens, J. D., Swerdlow, D. L., Sansonetti, P.
J., Adak, G. K. & Levine, M. M. (1999). Global burden of Shigella infections: implications for
vaccine development and implementation of control strategies. Bull World Health Organ 77,
651-666.
Kovach, M. E., Phillips, R. W., Elzer, P. H., Roop, R. M., 2nd & Peterson, K. M. (1994).
pBBR1MCS: a broad-host-range cloning vector. Biotechniques 16, 800-802.
Kraehenbuhl, J. P. & Neutra, M. R. (2000). Epithelial M cells: differentiation and function.
Annu Rev Cell Dev Biol 16, 301-332.
Kubler-Kielb, J., Vinogradov, E., Mocca, C., Pozsgay, V., Coxon, B., Robbins, J. B. &
Schneerson, R. (2010). Immunochemical studies of Shigella flexneri 2a and 6, and Shigella
![Page 244: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/244.jpg)
Bibliography
216
dysenteriae type 1 O-specific polysaccharide-core fragments and their protein conjugates as
vaccine candidates. Carbohydr Res 345, 1600-1608.
Labrec, E. H., Schneider, H., Magnani, T. J. & Formal, S. B. (1964). Epithelial Cell
Penetration as an Essential Step in the Pathogenesis of Bacillary Dysentery. J Bacteriol 88, 1503-
1518.
Lan, R., Lumb, B., Ryan, D. & Reeves, P. R. (2001). Molecular evolution of large virulence
plasmid in Shigella clones and enteroinvasive Escherichia coli. Infect Immun 69, 6303-6309.
Lan, R. & Reeves, P. R. (2002). Escherichia coli in disguise: molecular origins of Shigella.
Microbes Infect 4, 1125-1132.
Larue, K., Kimber, M. S., Ford, R. & Whitfield, C. (2009). Biochemical and structural
analysis of bacterial O-antigen chain length regulator proteins reveals a conserved quaternary
structure. J Biol Chem 284, 7395-7403.
Lett, M. C., Sasakawa, C., Okada, N., Sakai, T., Makino, S., Yamada, M., Komatsu, K. &
Yoshikawa, M. (1989). virG, a plasmid-coded virulence gene of Shigella flexneri: identification
of the virG protein and determination of the complete coding sequence. J Bacteriol 171, 353-359.
![Page 245: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/245.jpg)
Bibliography
217
Levine, M. M., Kotloff, K. L., Barry, E. M., Pasetti, M. F. & Sztein, M. B. (2007). Clinical
trials of Shigella vaccines: two steps forward and one step back on a long, hard road. Nat Rev
Microbiol 5, 540-553.
Lindberg, A. A., Wollin, R., Gemski, P. & Wohlhieter, J. A. (1978). Interaction between
bacteriophage Sf6 and Shigella flexneri. J Virol 27, 38-44.
Lindberg, A. A., Karnell, A. & Weintraub, A. (1991). The lipopolysaccharide of Shigella
bacteria as a virulence factor. Rev Infect Dis 13 Suppl 4, S279-284.
Lindberg, A. A. & Pal, T. (1993). Strategies for development of potential candidate Shigella
vaccines. Vaccine 11, 168-179.
Liu, B., Knirel, Y. A., Feng, L., Perepelov, A. V., Senchenkova, S. N., Wang, Q., Reeves, P.
R. & Wang, L. (2008). Structure and genetics of Shigella O antigens. FEMS Microbiol Rev 32,
627-653.
Liu, D., Cole, R. A. & Reeves, P. R. (1996). An O-antigen processing function for Wzx (RfbX):
a promising candidate for O-unit flippase. J Bacteriol 178, 2102-2107.
![Page 246: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/246.jpg)
Bibliography
218
Livio, S., Strockbine, N. A., Panchalingam, S., Tennant, S. M., Barry, E. M., Marohn, M.
E., Antonio, M., Hossain, A., Mandomando, I., Ochieng, J. B., Oundo, J. O., Qureshi, S.,
Ramamurthy, T., Tamboura, B., Adegbola, R. A., Hossain, M. J., Saha, D., Sen, S.,
Faruque, A. S., Alonso, P. L., Breiman, R. F., Zaidi, A. K., Sur, D., Sow, S. O., Berkeley, L.
Y., O'Reilly, C. E., Mintz, E. D., Biswas, K., Cohen, D., Farag, T. H., Nasrin, D., Wu, Y.,
Blackwelder, W. C., Kotloff, K. L., Nataro, J. P. & Levine, M. M. (2014). Shigella isolates
from the global enteric multicenter study inform vaccine development. Clin Infect Dis 59, 933-
941.
Loisel, T. P., Boujemaa, R., Pantaloni, D. & Carlier, M. F. (1999). Reconstitution of actin-
based motility of Listeria and Shigella using pure proteins. Nature 401, 613-616.
Lugtenberg, B., Meijers, J., Peters, R., van der Hoek, P. & van Alphen, L. (1975).
Electrophoretic resolution of the "major outer membrane protein" of Escherichia coli K12 into
four bands. FEBS Lett 58, 254-258.
Lupas, A. (1996). Coiled coils: new structures and new functions. Trends Biochem Sci 21, 375-
382.
![Page 247: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/247.jpg)
Bibliography
219
Macpherson, D. F., Morona, R., Beger, D. W., Cheah, K. C. & Manning, P. A. (1991).
Genetic analysis of the rfb region of Shigella flexneri encoding the Y serotype O-antigen
specificity. Mol Microbiol 5, 1491-1499.
Macpherson, D. F., Manning, P. A. & Morona, R. (1994). Characterization of the dTDP-
rhamnose biosynthetic genes encoded in the rfb locus of Shigella flexneri. Mol Microbiol 11,
281-292.
Macpherson, D. F., Manning, P. A. & Morona, R. (1995). Genetic analysis of the rfbX gene of
Shigella flexneri. Gene 155, 9-17.
Makela, P. H. (1965). Inheritance of the O antigens of Salmonella groups B and D. J Gen
Microbiol 41, 57-65.
Makino, S., Sasakawa, C., Kamata, K., Kurata, T. & Yoshikawa, M. (1986). A genetic
determinant required for continuous reinfection of adjacent cells on large plasmid in S. flexneri
2a. Cell 46, 551-555.
Marczak, M., Dzwierzynska, M. & Skorupska, A. (2013). Homo- and heterotypic interactions
between Pss proteins involved in the exopolysaccharide transport system in Rhizobium
leguminosarum bv. trifolii. Biol Chem 394, 541-559.
![Page 248: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/248.jpg)
Bibliography
220
Marczak, M., Matysiak, P., Kutkowska, J. & Skorupska, A. (2014). PssP2 is a polysaccharide
co-polymerase involved in exopolysaccharide chain-length determination in Rhizobium
leguminosarum. PLoS One 9, e109106.
Marino, P. A., McGrath, B. C. & Osborn, M. J. (1991). Energy dependence of O-antigen
synthesis in Salmonella typhimurium. J Bacteriol 173, 3128-3133.
Marolda, C. L., Tatar, L. D., Alaimo, C., Aebi, M. & Valvano, M. A. (2006). Interplay of the
Wzx translocase and the corresponding polymerase and chain length regulator proteins in the
translocation and periplasmic assembly of lipopolysaccharide O antigen. J Bacteriol 188, 5124-
5135.
Marolda, C. L., Haggerty, E. R., Lung, M. & Valvano, M. A. (2008). Functional analysis of
predicted coiled-coil regions in the Escherichia coli K-12 O-antigen polysaccharide chain length
determinant Wzz. J Bacteriol 190, 2128-2137.
Maurelli, A. T., Baudry, B., d'Hauteville, H., Hale, T. L. & Sansonetti, P. J. (1985). Cloning
of plasmid DNA sequences involved in invasion of HeLa cells by Shigella flexneri. Infect Immun
49, 164-171.
![Page 249: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/249.jpg)
Bibliography
221
Maurelli, A. T., Fernandez, R. E., Bloch, C. A., Rode, C. K. & Fasano, A. (1998). "Black
holes" and bacterial pathogenicity: a large genomic deletion that enhances the virulence of
Shigella spp. and enteroinvasive Escherichia coli. Proc Natl Acad Sci U S A 95, 3943-3948.
Mavris, M., Manning, P. A. & Morona, R. (1997). Mechanism of bacteriophage SfII-mediated
serotype conversion in Shigella flexneri. Mol Microbiol 26, 939-950.
May, K. (2007). Molecular characterisation of Shigella flexneri IcsA and the Role of
Lipopolysaccharide O-Antigen in Actin-based Motility. PhD Thesis.
May, K. L. & Morona, R. (2008). Mutagenesis of the Shigella flexneri autotransporter IcsA
reveals novel functional regions involved in IcsA biogenesis and recruitment of host neural
Wiscott-Aldrich syndrome protein. J Bacteriol 190, 4666-4676.
Mazur, A., Krol, J. E., Marczak, M. & Skorupska, A. (2003). Membrane topology of PssT,
the transmembrane protein component of the type I exopolysaccharide transport system in
Rhizobium leguminosarum bv. trifolii strain TA1. J Bacteriol 185, 2503-2511.
McGrath, B. C. & Osborn, M. J. (1991). Localization of the terminal steps of O-antigen
synthesis in Salmonella typhimurium. J Bacteriol 173, 649-654.
![Page 250: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/250.jpg)
Bibliography
222
McKinney, J., Guerrier-Takada, C., Galan, J. & Altman, S. (2002). Tightly regulated gene
expression system in Salmonella enterica serovar Typhimurium. J Bacteriol 184, 6056-6059.
Meier-Dieter, U., Barr, K., Starman, R., Hatch, L. & Rick, P. D. (1992). Nucleotide sequence
of the Escherichia coli rfe gene involved in the synthesis of enterobacterial common antigen.
Molecular cloning of the rfe-rff gene cluster. J Biol Chem 267, 746-753.
Menard, R., Sansonetti, P. J. & Parsot, C. (1993). Nonpolar mutagenesis of the ipa genes
defines IpaB, IpaC, and IpaD as effectors of Shigella flexneri entry into epithelial cells. J
Bacteriol 175, 5899-5906.
Monack, D. M. & Theriot, J. A. (2001). Actin-based motility is sufficient for bacterial
membrane protrusion formation and host cell uptake. Cell Microbiol 3, 633-647.
Morona, J. K., Paton, J. C., Miller, D. C. & Morona, R. (2000a). Tyrosine phosphorylation of
CpsD negatively regulates capsular polysaccharide biosynthesis in streptococcus pneumoniae.
Mol Microbiol 35, 1431-1442.
Morona, R., Mavris, M., Fallarino, A. & Manning, P. A. (1994). Characterization of the rfc
region of Shigella flexneri. J Bacteriol 176, 733-747.
![Page 251: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/251.jpg)
Bibliography
223
Morona, R., van den Bosch, L. & Manning, P. A. (1995). Molecular, genetic, and topological
characterization of O-antigen chain length regulation in Shigella flexneri. J Bacteriol 177, 1059-
1068.
Morona, R., Van Den Bosch, L. & Daniels, C. (2000b). Evaluation of Wzz/MPA1/MPA2
proteins based on the presence of coiled-coil regions. Microbiology 146 1-4.
Morona, R., Daniels, C. & Van Den Bosch, L. (2003). Genetic modulation of Shigella flexneri
2a lipopolysaccharide O antigen modal chain length reveals that it has been optimized for
virulence. Microbiology 149, 925-939.
Morona, R. & Van Den Bosch, L. (2003a). Multicopy icsA is able to suppress the virulence
defect caused by the wzzSF mutation in Shigella flexneri. FEMS Microbiol Lett 221, 213-219.
Morona, R. & Van Den Bosch, L. (2003b). Lipopolysaccharide O antigen chains mask IcsA
(VirG) in Shigella flexneri. FEMS Microbiol Lett 221, 173-180.
Morona, R., Purins, L., Tocilj, A., Matte, A. & Cygler, M. (2009). Sequence-structure
relationships in polysaccharide co-polymerase (PCP) proteins. Trends Biochem Sci 34, 78-84.
![Page 252: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/252.jpg)
Bibliography
224
Muhlradt, P. (1969). Biosynthesis of Salmonella lipopolysaccharide. The in vitro transfer of
phosphate to the heptose moiety of the core. Eur J Biochem 11, 241-248.
Mulford, C. A. & Osborn, M. J. (1983). An intermediate step in translocation of
lipopolysaccharide to the outer membrane of Salmonella typhimurium. Proc Natl Acad Sci U S A
80, 1159-1163.
Muller, J. M., Ziegler-Heitbrock, H. W. & Baeuerle, P. A. (1993). Nuclear factor kappa B, a
mediator of lipopolysaccharide effects. Immunobiology 187, 233-256.
Murray, G. L., Attridge, S. R. & Morona, R. (2003). Regulation of Salmonella typhimurium
lipopolysaccharide O antigen chain length is required for virulence; identification of FepE as a
second Wzz. Mol Microbiol 47, 1395-1406.
Murray, G. L., Attridge, S. R. & Morona, R. (2006). Altering the length of the
lipopolysaccharide O antigen has an impact on the interaction of Salmonella enterica serovar
Typhimurium with macrophages and complement. J Bacteriol 188, 2735-2739.
Murray, S. R., Bermudes, D., de Felipe, K. S. & Low, K. B. (2001). Extragenic suppressors of
growth defects in msbB Salmonella. J Bacteriol 183, 5554-5561.
![Page 253: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/253.jpg)
Bibliography
225
Naide, Y., Nikaido, H., Maekelae, P. H., Wilkinson, R. G. & Stocker, B. A. (1965).
Semirough Strains of Salmonella. Proc Natl Acad Sci U S A 53, 147-153.
Nath, P. & Morona, R. (2015). Mutational analysis of the major periplasmic loops of Shigella
flexneri Wzy: identification of the residues affecting O antigen modal chain length control, and
Wzz-dependent polymerization activity. Microbiology 161, 774-785.
Nath, P., Tran, E. N. & Morona, R. (2015). Mutational Analysis of the Shigella flexneri O-
Antigen Polymerase Wzy: Identification of Wzz-Dependent Wzy Mutants. J Bacteriol 197, 108-
119.
Niebuhr, K., Jouihri, N., Allaoui, A., Gounon, P., Sansonetti, P. J. & Parsot, C. (2000). IpgD,
a protein secreted by the type III secretion machinery of Shigella flexneri, is chaperoned by IpgE
and implicated in entry focus formation. Mol Microbiol 38, 8-19.
Niebuhr, K., Giuriato, S., Pedron, T., Philpott, D. J., Gaits, F., Sable, J., Sheetz, M. P.,
Parsot, C., Sansonetti, P. J. & Payrastre, B. (2002). Conversion of PtdIns(4,5)P(2) into
PtdIns(5)P by the S.flexneri effector IpgD reorganizes host cell morphology. EMBO J 21, 5069-
5078.
Niyogi, S. K. (2005). Shigellosis. J Microbiol 43, 133-143.
![Page 254: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/254.jpg)
Bibliography
226
Nurminen, M., Hellerqvist, C. G., Valtonen, V. V. & Makela, P. H. (1971). The smooth
lipopolysaccharide character of 1,4,(5),12 and 1,9,12 transductants formed as hybrids between
groups B and D of salmonella. Eur J Biochem 22, 500-505.
Oaks, E. V., Wingfield, M. E. & Formal, S. B. (1985). Plaque formation by virulent Shigella
flexneri. Infect Immun 48, 124-129.
Oaks, E. V., Hale, T. L. & Formal, S. B. (1986). Serum immune response to Shigella protein
antigens in rhesus monkeys and humans infected with Shigella spp. Infect Immun 53, 57-63.
Ogawa, H., Nakamura, A. & Nakaya, R. (1968). Cinemicrographic study of tissue cell cultures
infected with Shigella flexneri. Jpn J Med Sci Biol 21, 259-273.
Ogawa, M., Yoshimori, T., Suzuki, T., Sagara, H., Mizushima, N. & Sasakawa, C. (2005).
Escape of intracellular Shigella from autophagy. Science 307, 727-731.
Okada, N., Sasakawa, C., Tobe, T., Talukder, K. A., Komatsu, K. & Yoshikawa, M.
(1991a). Construction of a physical map of the chromosome of Shigella flexneri 2a and the direct
assignment of nine virulence-associated loci identified by Tn5 insertions. Mol Microbiol 5, 2171-
2180.
![Page 255: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/255.jpg)
Bibliography
227
Okada, N., Sasakawa, C., Tobe, T., Yamada, M., Nagai, S., Talukder, K. A., Komatsu, K.,
Kanegasaki, S. & Yoshikawa, M. (1991b). Virulence-associated chromosomal loci of Shigella
flexneri identified by random Tn5 insertion mutagenesis. Mol Microbiol 5, 187-195.
Okamura, N. & Nakaya, R. (1977). Rough mutant of Shigella flexneri 2a that penetrates tissue
culture cells but does not evoke keratoconjunctivitis in guinea pigs. Infect Immun 17, 4-8.
Okamura, N., Nagai, T., Nakaya, R., Kondo, S., Murakami, M. & Hisatsune, K. (1983).
HeLa cell invasiveness and O antigen of Shigella flexneri as separate and prerequisite attributes
of virulence to evoke keratoconjunctivitis in guinea pigs. Infect Immun 39, 505-513.
Okuda, J., Toyotome, T., Kataoka, N., Ohno, M., Abe, H., Shimura, Y., Seyedarabi, A.,
Pickersgill, R. & Sasakawa, C. (2005). Shigella effector IpaH9.8 binds to a splicing factor
U2AF(35) to modulate host immune responses. Biochem Biophys Res Commun 333, 531-539.
Olive, A. J., Kenjale, R., Espina, M., Moore, D. S., Picking, W. L. & Picking, W. D. (2007).
Bile salts stimulate recruitment of IpaB to the Shigella flexneri surface, where it colocalizes with
IpaD at the tip of the type III secretion needle. Infect Immun 75, 2626-2629.
Paciello, I., Silipo, A., Lembo-Fazio, L., Curcuru, L., Zumsteg, A., Noel, G., Ciancarella, V.,
Sturiale, L., Molinaro, A. & Bernardini, M. L. (2013). Intracellular Shigella remodels its LPS
![Page 256: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/256.jpg)
Bibliography
228
to dampen the innate immune recognition and evade inflammasome activation. Proc Natl Acad
Sci U S A 110, E4345-4354.
Papadopoulos, M. & Morona, R. (2010). Mutagenesis and chemical cross-linking suggest that
Wzz dimer stability and oligomerization affect lipopolysaccharide O-antigen modal chain length
control. J Bacteriol 192, 3385-3393.
Parsot, C. (2005). Shigella spp. and enteroinvasive Escherichia coli pathogenicity factors. FEMS
Microbiol Lett 252, 11-18.
Perepelov, A. V., Shekht, M. E., Liu, B., Shevelev, S. D., Ledov, V. A., Senchenkova, S. N.,
L'Vov V, L., Shashkov, A. S., Feng, L., Aparin, P. G., Wang, L. & Knirel, Y. A. (2012).
Shigella flexneri O-antigens revisited: final elucidation of the O-acetylation profiles and a survey
of the O-antigen structure diversity. FEMS Immunol Med Microbiol 66, 201-210.
Phalipon, A., Costachel, C., Grandjean, C., Thuizat, A., Guerreiro, C., Tanguy, M., Nato,
F., Vulliez-Le Normand, B., Belot, F., Wright, K., Marcel-Peyre, V., Sansonetti, P. J. &
Mulard, L. A. (2006). Characterization of functional oligosaccharide mimics of the Shigella
flexneri serotype 2a O-antigen: implications for the development of a chemically defined
glycoconjugate vaccine. J Immunol 176, 1686-1694.
![Page 257: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/257.jpg)
Bibliography
229
Picking, W. L., Nishioka, H., Hearn, P. D., Baxter, M. A., Harrington, A. T., Blocker, A. &
Picking, W. D. (2005). IpaD of Shigella flexneri is independently required for regulation of Ipa
protein secretion and efficient insertion of IpaB and IpaC into host membranes. Infect Immun 73,
1432-1440.
Post, D. M., Ketterer, M. R., Phillips, N. J., Gibson, B. W. & Apicella, M. A. (2003). The
msbB mutant of Neisseria meningitidis strain NMB has a defect in lipooligosaccharide assembly
and transport to the outer membrane. Infect Immun 71, 647-655.
Prevost, M. C., Lesourd, M., Arpin, M., Vernel, F., Mounier, J., Hellio, R. & Sansonetti, P.
J. (1992). Unipolar reorganization of F-actin layer at bacterial division and bundling of actin
filaments by plastin correlate with movement of Shigella flexneri within HeLa cells. Infect
Immun 60, 4088-4099.
Pupo, G. M., Lan, R. & Reeves, P. R. (2000). Multiple independent origins of Shigella clones
of Escherichia coli and convergent evolution of many of their characteristics. Proc Natl Acad Sci
U S A 97, 10567-10572.
Purins, L., Van Den Bosch, L., Richardson, V. & Morona, R. (2008). Coiled-coil regions play
a role in the function of the Shigella flexneri O-antigen chain length regulator WzzpHS2.
Microbiology 154, 1104-1116.
![Page 258: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/258.jpg)
Bibliography
230
Qiao, S., Luo, Q., Zhao, Y., Zhang, X. C. & Huang, Y. (2014). Structural basis for
lipopolysaccharide insertion in the bacterial outer membrane. Nature 511, 108-111.
Raetz, C. R. (1990). Biochemistry of endotoxins. Annu Rev Biochem 59, 129-170.
Raetz, C. R. (1993). Bacterial endotoxins: extraordinary lipids that activate eucaryotic signal
transduction. J Bacteriol 175, 5745-5753.
Raetz, C. R. & Whitfield, C. (2002). Lipopolysaccharide endotoxins. Annu Rev Biochem 71,
635-700.
Raetz, C. R., Reynolds, C. M., Trent, M. S. & Bishop, R. E. (2007). Lipid A modification
systems in gram-negative bacteria. Annu Rev Biochem 76, 295-329.
Rajakumar, K., Jost, B. H., Sasakawa, C., Okada, N., Yoshikawa, M. & Adler, B. (1994).
Nucleotide sequence of the rhamnose biosynthetic operon of Shigella flexneri 2a and role of
lipopolysaccharide in virulence. J Bacteriol 176, 2362-2373.
Rajakumar, K., Sasakawa, C. & Adler, B. (1997). Use of a novel approach, termed island
probing, identifies the Shigella flexneri she pathogenicity island which encodes a homolog of the
immunoglobulin A protease-like family of proteins. Infect Immun 65, 4606-4614.
![Page 259: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/259.jpg)
Bibliography
231
Ranallo, R. T., Kaminski, R. W., George, T., Kordis, A. A., Chen, Q., Szabo, K. &
Venkatesan, M. M. (2010). Virulence, inflammatory potential, and adaptive immunity induced
by Shigella flexneri msbB mutants. Infect Immun 78, 400-412.
Ratcliff, S. W., Luh, J., Ganesan, A. T., Behrens, B., Thompson, R., Montenegro, M. A.,
Morelli, G. & Trautner, T. A. (1979). The genome of Bacillus subtilis phage SPP1: the
arrangement of restriction endonuclease generated fragments. Mol Gen Genet 168, 165-172.
Reddy, A., Cho, J., Ling, S., Reddy, V., Shlykov, M. & Saier, M. H. (2014). Reliability of
nine programs of topological predictions and their application to integral membrane channel and
carrier proteins. J Mol Microbiol Biotechnol 24, 161-190.
Robbins, J. R., Monack, D., McCallum, S. J., Vegas, A., Pham, E., Goldberg, M. B. &
Theriot, J. A. (2001). The making of a gradient: IcsA (VirG) polarity in Shigella flexneri. Mol
Microbiol 41, 861-872.
Rossi, O., Pesce, I., Giannelli, C., Aprea, S., Caboni, M., Citiulo, F., Valentini, S., Ferlenghi,
I., MacLennan, C. A., D'Oro, U., Saul, A. & Gerke, C. (2014). Modulation of endotoxicity of
Shigella generalized modules for membrane antigens (GMMA) by genetic lipid A modifications:
relative activation of TLR4 and TLR2 pathways in different mutants. J Biol Chem 289, 24922-
24935.
![Page 260: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/260.jpg)
Bibliography
232
Ruiz, N., Gronenberg, L. S., Kahne, D. & Silhavy, T. J. (2008). Identification of two inner-
membrane proteins required for the transport of lipopolysaccharide to the outer membrane of
Escherichia coli. Proc Natl Acad Sci U S A 105, 5537-5542.
Ruiz, N., Kahne, D. & Silhavy, T. J. (2009). Transport of lipopolysaccharide across the cell
envelope: the long road of discovery. Nat Rev Microbiol 7, 677-683.
Sandlin, R. C., Lampel, K. A., Keasler, S. P., Goldberg, M. B., Stolzer, A. L. & Maurelli, A.
T. (1995). Avirulence of rough mutants of Shigella flexneri: requirement of O antigen for correct
unipolar localization of IcsA in the bacterial outer membrane. Infect Immun 63, 229-237.
Sandlin, R. C., Goldberg, M. B. & Maurelli, A. T. (1996). Effect of O side-chain length and
composition on the virulence of Shigella flexneri 2a. Mol Microbiol 22, 63-73.
Sansonetti, P. J., Kopecko, D. J. & Formal, S. B. (1982). Involvement of a plasmid in the
invasive ability of Shigella flexneri. Infect Immun 35, 852-860.
Sansonetti, P. J. & Phalipon, A. (1999). M cells as ports of entry for enteroinvasive pathogens:
mechanisms of interaction, consequences for the disease process. Semin Immunol 11, 193-203.
![Page 261: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/261.jpg)
Bibliography
233
Sansonetti, P. J. (2001). Microbes and microbial toxins: paradigms for microbial-mucosal
interactions III. Shigellosis: from symptoms to molecular pathogenesis. Am J Physiol
Gastrointest Liver Physiol 280, G319-323.
Sasakawa, C., Kamata, K., Sakai, T., Makino, S., Yamada, M., Okada, N. & Yoshikawa, M.
(1988). Virulence-associated genetic regions comprising 31 kilobases of the 230-kilobase
plasmid in Shigella flexneri 2a. J Bacteriol 170, 2480-2484.
Sasakawa, C., Komatsu, K., Tobe, T., Suzuki, T. & Yoshikawa, M. (1993). Eight genes in
region 5 that form an operon are essential for invasion of epithelial cells by Shigella flexneri 2a. J
Bacteriol 175, 2334-2346.
Schnaitman, C. A. & Klena, J. D. (1993). Genetics of lipopolysaccharide biosynthesis in enteric
bacteria. Microbiol Rev 57, 655-682.
Schroeder, G. N., Jann, N. J. & Hilbi, H. (2007). Intracellular type III secretion by cytoplasmic
Shigella flexneri promotes caspase-1-dependent macrophage cell death. Microbiology 153, 2862-
2876.
Schroeder, G. N. & Hilbi, H. (2008). Molecular pathogenesis of Shigella spp.: controlling host
cell signaling, invasion, and death by type III secretion. Clin Microbiol Rev 21, 134-156.
![Page 262: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/262.jpg)
Bibliography
234
Schuch, R., Sandlin, R. C. & Maurelli, A. T. (1999). A system for identifying post-invasion
functions of invasion genes: requirements for the Mxi-Spa type III secretion pathway of Shigella
flexneri in intercellular dissemination. Mol Microbiol 34, 675-689.
Schwartz, M. (1976). The adsorption of coliphage lambda to its host: effect of variations in the
surface density of receptor and in phage-receptor affinity. J Mol Biol 103, 521-536.
Sereny, B. (1957). Experimental keratoconjunctivitis shigellosa. Acta Microbiol Acad Sci Hung
4, 367-376.
Sharma, O., Datsenko, K. A., Ess, S. C., Zhalnina, M. V., Wanner, B. L. & Cramer, W. A.
(2009). Genome-wide screens: novel mechanisms in colicin import and cytotoxicity. Mol
Microbiol 73, 571-585.
Shen, D. K., Saurya, S., Wagner, C., Nishioka, H. & Blocker, A. J. (2010). Domains of the
Shigella flexneri type III secretion system IpaB protein involved in secretion regulation. Infect
Immun 78, 4999-5010.
Shere, K. D., Sallustio, S., Manessis, A., D'Aversa, T. G. & Goldberg, M. B. (1997).
Disruption of IcsP, the major Shigella protease that cleaves IcsA, accelerates actin-based motility.
Mol Microbiol 25, 451-462.
![Page 263: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/263.jpg)
Bibliography
235
Simmons, D. A. & Romanowska, E. (1987). Structure and biology of Shigella flexneri O
antigens. J Med Microbiol 23, 289-302.
Simmons, D. A. (1993). Genetic and biosynthetic aspects of Shigella flexneri O-specific
lipopolysaccharides. Biochem Soc Trans 21, 58S.
Sirisena, D. M., Brozek, K. A., MacLachlan, P. R., Sanderson, K. E. & Raetz, C. R. (1992).
The rfaC gene of Salmonella typhimurium. Cloning, sequencing, and enzymatic function in
heptose transfer to lipopolysaccharide. J Biol Chem 267, 18874-18884.
Sirisena, D. M., MacLachlan, P. R., Liu, S. L., Hessel, A. & Sanderson, K. E. (1994).
Molecular analysis of the rfaD gene, for heptose synthesis, and the rfaF gene, for heptose
transfer, in lipopolysaccharide synthesis in Salmonella typhimurium. J Bacteriol 176, 2379-2385.
Somerville, J. E., Jr., Cassiano, L. & Darveau, R. P. (1999). Escherichia coli msbB gene as a
virulence factor and a therapeutic target. Infect Immun 67, 6583-6590.
Sperandeo, P., Deho, G. & Polissi, A. (2009). The lipopolysaccharide transport system of
Gram-negative bacteria. Biochim Biophys Acta 1791, 594-602.
![Page 264: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/264.jpg)
Bibliography
236
Stagg, R. M., Tang, S. S., Carlin, N. I., Talukder, K. A., Cam, P. D. & Verma, N. K. (2009).
A novel glucosyltransferase involved in O-antigen modification of Shigella flexneri serotype 1c.
J Bacteriol 191, 6612-6617.
Steinhauer, J., Agha, R., Pham, T., Varga, A. W. & Goldberg, M. B. (1999). The unipolar
Shigella surface protein IcsA is targeted directly to the bacterial old pole: IcsP cleavage of IcsA
occurs over the entire bacterial surface. Mol Microbiol 32, 367-377.
Stevenson, G., Neal, B., Liu, D., Hobbs, M., Packer, N. H., Batley, M., Redmond, J. W.,
Lindquist, L. & Reeves, P. (1994). Structure of the O antigen of Escherichia coli K-12 and the
sequence of its rfb gene cluster. J Bacteriol 176, 4144-4156.
Sun, Q., Knirel, Y. A., Lan, R., Wang, J., Senchenkova, S. N., Jin, D., Shashkov, A. S., Xia,
S., Perepelov, A. V., Chen, Q., Wang, Y., Wang, H. & Xu, J. (2012). A novel plasmid-
encoded serotype conversion mechanism through addition of phosphoethanolamine to the O-
antigen of Shigella flexneri. PLoS One 7, e46095.
Sun, Q., Lan, R., Wang, J., Xia, S., Wang, Y., Wang, Y., Jin, D., Yu, B., Knirel, Y. A. & Xu,
J. (2013a). Identification and characterization of a novel Shigella flexneri serotype Yv in China.
PLoS One 8, e70238.
![Page 265: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/265.jpg)
Bibliography
237
Sun, Q., Lan, R., Wang, Y., Wang, J., Wang, Y., Li, P., Du, P. & Xu, J. (2013b). Isolation
and genomic characterization of SfI, a serotype-converting bacteriophage of Shigella flexneri.
BMC Microbiol 13, 39.
Sun, Q., Knirel, Y. A., Lan, R., Wang, J., Senchenkova, S. N., Shashkov, A. S., Wang, Y.,
Wang, Y., Luo, X. & Xu, J. (2014). Dissemination and serotype modification potential of
pSFxv_2, an O-antigen PEtN modification plasmid in Shigella flexneri. Glycobiology 24, 305-
313.
Suzuki, T., Lett, M. C. & Sasakawa, C. (1995). Extracellular transport of VirG protein in
Shigella. J Biol Chem 270, 30874-30880.
Suzuki, T., Saga, S. & Sasakawa, C. (1996). Functional analysis of Shigella VirG domains
essential for interaction with vinculin and actin-based motility. J Biol Chem 271, 21878-21885.
Suzuki, T., Miki, H., Takenawa, T. & Sasakawa, C. (1998). Neural Wiskott-Aldrich syndrome
protein is implicated in the actin-based motility of Shigella flexneri. EMBO J 17, 2767-2776.
Suzuki, T. & Sasakawa, C. (2001). Molecular basis of the intracellular spreading of Shigella.
Infect Immun 69, 5959-5966.
![Page 266: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/266.jpg)
Bibliography
238
Talukder, K. A., Islam, Z., Islam, M. A., Dutta, D. K., Safa, A., Ansaruzzaman, M.,
Faruque, A. S., Shahed, S. N., Nair, G. B. & Sack, D. A. (2003). Phenotypic and genotypic
characterization of provisional serotype Shigella flexneri 1c and clonal relationships with 1a and
1b strains isolated in Bangladesh. J Clin Microbiol 41, 110-117.
Tamano, K., Aizawa, S., Katayama, E., Nonaka, T., Imajoh-Ohmi, S., Kuwae, A., Nagai, S.
& Sasakawa, C. (2000). Supramolecular structure of the Shigella type III secretion machinery:
the needle part is changeable in length and essential for delivery of effectors. EMBO J 19, 3876-
3887.
Taylor, V. L., Udaskin, M. L., Islam, S. T. & Lam, J. S. (2013). The D3 bacteriophage alpha-
polymerase inhibitor (Iap) peptide disrupts O-antigen biosynthesis through mimicry of the chain
length regulator Wzz in Pseudomonas aeruginosa. J Bacteriol 195, 4735-4741.
Teh, M. Y., Tran, E. N. & Morona, R. (2012). Absence of O antigen suppresses Shigella
flexneri IcsA autochaperone region mutations. Microbiology 158, 2835-2850.
Teh, M. Y. & Morona, R. (2013). Identification of Shigella flexneri IcsA residues affecting
interaction with N-WASP, and evidence for IcsA-IcsA co-operative interaction. PLoS One 8,
e55152.
![Page 267: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/267.jpg)
Bibliography
239
Tocilj, A., Munger, C., Proteau, A., Morona, R., Purins, L., Ajamian, E., Wagner, J.,
Papadopoulos, M., Van Den Bosch, L., Rubinstein, J. L., Fethiere, J., Matte, A. & Cygler,
M. (2008). Bacterial polysaccharide co-polymerases share a common framework for control of
polymer length. Nat Struct Mol Biol 15, 130-138.
Tominaga, A., Lan, R. & Reeves, P. R. (2005). Evolutionary changes of the flhDC flagellar
master operon in Shigella strains. J Bacteriol 187, 4295-4302.
Tran, E. N., Doyle, M. T. & Morona, R. (2013). LPS unmasking of Shigella flexneri reveals
preferential localisation of tagged outer membrane protease IcsP to septa and new poles. PLoS
One 8, e70508.
Tran, E. N. & Morona, R. (2013). Residues located inside the Escherichia coli FepE protein
oligomer are essential for lipopolysaccharide O-antigen modal chain length regulation.
Microbiology 159, 701-714.
Tran, E. N., Papadopoulos, M. & Morona, R. (2014). Relationship between O-antigen chain
length and resistance to colicin E2 in Shigella flexneri. Microbiology 160, 589-601.
Tsai, C. M. & Frasch, C. E. (1982). A sensitive silver stain for detecting lipopolysaccharides in
polyacrylamide gels. Anal Biochem 119, 115-119.
![Page 268: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/268.jpg)
Bibliography
240
Valtonen, M. V., Plosila, M., Valtonen, V. V. & Makela, P. H. (1975). Effect of the quality of
the lipopolysaccharide on mouse virulence of Salmonella enteritidis. Infect Immun 12, 828-832.
Van den Bosch, L., Manning, P. A. & Morona, R. (1997). Regulation of O-antigen chain
length is required for Shigella flexneri virulence. Mol Microbiol 23, 765-775.
Van den Bosch, L. & Morona, R. (2003). The actin-based motility defect of a Shigella flexneri
rmlD rough LPS mutant is not due to loss of IcsA polarity. Microb Pathog 35, 11-18.
van der Ley, P., de Graaff, P. & Tommassen, J. (1986). Shielding of Escherichia coli outer
membrane proteins as receptors for bacteriophages and colicins by O-antigenic chains of
lipopolysaccharide. J Bacteriol 168, 449-451.
Venkatesan, M. M., Buysse, J. M. & Kopecko, D. J. (1988). Characterization of invasion
plasmid antigen genes (ipaBCD) from Shigella flexneri. Proc Natl Acad Sci U S A 85, 9317-
9321.
Venkatesan, M. M., Buysse, J. M. & Oaks, E. V. (1992). Surface presentation of Shigella
flexneri invasion plasmid antigens requires the products of the spa locus. J Bacteriol 174, 1990-
2001.
![Page 269: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/269.jpg)
Bibliography
241
Verma, N. K., Brandt, J. M., Verma, D. J. & Lindberg, A. A. (1991). Molecular
characterization of the O-acetyl transferase gene of converting bacteriophage SF6 that adds group
antigen 6 to Shigella flexneri. Mol Microbiol 5, 71-75.
Vimont, S., Dumontier, S., Escuyer, V. & Berche, P. (1997). The rfaD locus: a region of
rearrangement in Vibrio cholerae O139. Gene 185, 43-47.
von Seidlein, L., Kim, D. R., Ali, M., Lee, H., Wang, X., Thiem, V. D., Canh do, G.,
Chaicumpa, W., Agtini, M. D., Hossain, A., Bhutta, Z. A., Mason, C., Sethabutr, O.,
Talukder, K., Nair, G. B., Deen, J. L., Kotloff, K. & Clemens, J. (2006). A multicentre study
of Shigella diarrhoea in six Asian countries: disease burden, clinical manifestations, and
microbiology. PLoS Med 3, e353.
Waldo, G. S., Standish, B. M., Berendzen, J. & Terwilliger, T. C. (1999). Rapid protein-
folding assay using green fluorescent protein. Nat Biotechnol 17, 691-695.
Wang, J., Knirel, Y. A., Lan, R., Senchenkova, S. N., Luo, X., Perepelov, A. V., Wang, Y.,
Shashkov, A. S., Xu, J. & Sun, Q. (2014). Identification of an O-acyltransferase gene (oacB)
that mediates 3- and 4-O-acetylation of rhamnose III in Shigella flexneri O antigens. J Bacteriol
196, 1525-1531.
![Page 270: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/270.jpg)
Bibliography
242
Wang, L., Wang, Q. & Reeves, P. R. (2010a). The variation of O antigens in gram-negative
bacteria. Subcell Biochem 53, 123-152.
Wang, R. F. & Kushner, S. R. (1991). Construction of versatile low-copy-number vectors for
cloning, sequencing and gene expression in Escherichia coli. Gene 100, 195-199.
Wang, X., Zhang, C., Shi, F. & Hu, X. (2010b). Purification and characterization of
lipopolysaccharides. Subcell Biochem 53, 27-51.
Waterman, S. R. & Small, P. L. (1996). Identification of sigma S-dependent genes associated
with the stationary-phase acid-resistance phenotype of Shigella flexneri. Mol Microbiol 21, 925-
940.
Watson, P. R., Benmore, A., Khan, S. A., Jones, P. W., Maskell, D. J. & Wallis, T. S. (2000).
Mutation of waaN reduces Salmonella enterica serovar Typhimurium-induced enteritis and net
secretion of type III secretion system 1-dependent proteins. Infect Immun 68, 3768-3771.
West, N. P., Sansonetti, P., Mounier, J., Exley, R. M., Parsot, C., Guadagnini, S., Prevost,
M. C., Prochnicka-Chalufour, A., Delepierre, M., Tanguy, M. & Tang, C. M. (2005).
Optimization of virulence functions through glucosylation of Shigella LPS. Science 307, 1313-
1317.
![Page 271: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/271.jpg)
Bibliography
243
Whitfield, C. (2006). Biosynthesis and assembly of capsular polysaccharides in Escherichia coli.
Annu Rev Biochem 75, 39-68.
Whitfield, C. (2010). Glycan chain-length control. Nat Chem Biol 6, 403-404.
Whitfield, C. & Trent, M. S. (2014). Biosynthesis and export of bacterial lipopolysaccharides.
Annu Rev Biochem 83, 99-128.
Wong, D. K., Morris, C., Lam, T. L., Wong, W. K. & Hackett, J. (1999). Identification of O-
antigen polymerase transcription and translation start signals and visualization of the protein in
Salmonella enterica serovar Typhimurium. Microbiology 145 ( Pt 9), 2443-2451.
Wood, P. K., Morris, J. G., Jr., Small, P. L., Sethabutr, O., Toledo, M. R., Trabulsi, L. &
Kaper, J. B. (1986). Comparison of DNA probes and the Sereny test for identification of
invasive Shigella and Escherichia coli strains. J Clin Microbiol 24, 498-500.
Woodward, R., Yi, W., Li, L., Zhao, G., Eguchi, H., Sridhar, P. R., Guo, H., Song, J. K.,
Motari, E., Cai, L., Kelleher, P., Liu, X., Han, W., Zhang, W., Ding, Y., Li, M. & Wang, P.
G. (2010). In vitro bacterial polysaccharide biosynthesis: defining the functions of Wzy and Wzz.
Nat Chem Biol 6, 418-423.
![Page 272: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/272.jpg)
Bibliography
244
Wyckoff, T. J., Lin, S., Cotter, R. J., Dotson, G. D. & Raetz, C. R. (1998). Hydrocarbon rulers
in UDP-N-acetylglucosamine acyltransferases. J Biol Chem 273, 32369-32372.
Yang, F., Yang, J., Zhang, X., Chen, L., Jiang, Y., Yan, Y., Tang, X., Wang, J., Xiong, Z.,
Dong, J., Xue, Y., Zhu, Y., Xu, X., Sun, L., Chen, S., Nie, H., Peng, J., Xu, J., Wang, Y.,
Yuan, Z., Wen, Y., Yao, Z., Shen, Y., Qiang, B., Hou, Y., Yu, J. & Jin, Q. (2005). Genome
dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery. Nucleic
Acids Res 33, 6445-6458.
Yethon, J. A., Heinrichs, D. E., Monteiro, M. A., Perry, M. B. & Whitfield, C. (1998).
Involvement of waaY, waaQ, and waaP in the modification of Escherichia coli
lipopolysaccharide and their role in the formation of a stable outer membrane. J Biol Chem 273,
26310-26316.
Yethon, J. A. & Whitfield, C. (2001). Lipopolysaccharide as a target for the development of
novel therapeutics in gram-negative bacteria. Curr Drug Targets Infect Disord 1, 91-106.
Yoshida, S., Katayama, E., Kuwae, A., Mimuro, H., Suzuki, T. & Sasakawa, C. (2002).
Shigella deliver an effector protein to trigger host microtubule destabilization, which promotes
Rac1 activity and efficient bacterial internalization. EMBO J 21, 2923-2935.
![Page 273: Characterisation of the Shigella flexneri · Abstract iii Abstract Shigella flexneri is the major causative agent of shigellosis that account for ~14000 deaths annually in Asia. The](https://reader031.vdocuments.site/reader031/viewer/2022013022/5f94a9a74ffd5064ac07c633/html5/thumbnails/273.jpg)
Bibliography
245
Yoshida, S., Handa, Y., Suzuki, T., Ogawa, M., Suzuki, M., Tamai, A., Abe, A., Katayama,
E. & Sasakawa, C. (2006). Microtubule-severing activity of Shigella is pivotal for intercellular
spreading. Science 314, 985-989.
Zhang, J., Liu, H., Zhang, X., Yang, J., Yang, F., Yang, G., Shen, Y., Hou, Y. & Jin, Q.
(2003). Complete DNA sequence and gene analysis of the virulence plasmid pCP301 of Shigella
flexneri 2a. Sci China C Life Sci 46, 513-521.
Zhao, G., Wu, B., Li, L. & Wang, P. G. (2014). O-antigen polymerase adopts a distributive
mechanism for lipopolysaccharide biosynthesis. Appl Microbiol Biotechnol 98, 4075-4081.
Zurawski, D. V., Mitsuhata, C., Mumy, K. L., McCormick, B. A. & Maurelli, A. T. (2006).
OspF and OspC1 are Shigella flexneri type III secretion system effectors that are required for
postinvasion aspects of virulence. Infect Immun 74, 5964-5976.