uc davis/nih neufacility romab · 2021. 2. 22. · 250 148 98—— 64 50—— 36—— n76/8...

1
Anti-Ataxin-1 11NQ, NeuroMab clone N76/8 Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (also known as spinocerebellar ataxia type 1 protein homolog accession number P54254) Rat: 100% identity (34/34 amino acids identical) Human: 88% identity (30/34 amino acids identical) Monoclonal antibody info: Mouse strain: Balb/C Myeloma cell: SP2/0 Mouse Ig Isotype: IgG2b NeuroMab Applications: Immunoblotting, Immunohistochemistry and Immunoprecipitation Species Reactivity: human, mouse, rat MW: 85 kD Left: transfected cell immunoblot: COS cells transiently transfected with Ataxin-1 and Kv2.1 plasmids and probed with N76/8 TC supe. Right: adult rat brain immunoblot: extracts of cerebella from Ataxin-1 KO and WT mice and probed with N76/8 (left) or K89/41 (right) TC supe. Adult rat cerebellum (left) and hippocampus (right) immunohistochemistry UC Davis/NIH NeuroMab Facility Department of Physiology and Membrane Biology, UC Davis, Davis CA 95616 http://neuromab.ucdavis.edu [email protected]u © 2020 The Regents of the University of California All Rights Reserved Available as TC supe (RRID: AB_10671173) & Pure IgG (RRID: AB_10673960)

Upload: others

Post on 21-Jul-2021

0 views

Category:

Documents


0 download

TRANSCRIPT

Page 1: UC Davis/NIH NeuFacility roMab · 2021. 2. 22. · 250 148 98—— 64 50—— 36—— N76/8 anti-Ataxin-l x K89/41 anti-Kv2.1 ch O O 98 — 50 — O o o o N76/8 anti-Ataxin-l NeuroMab

Anti-Ataxin-1 11NQ, NeuroMab clone N76/8

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of

mouse ataxin-1 (also known as spinocerebellar ataxia type 1 protein homolog accession number P54254)

Rat: 100% identity (34/34 amino acids identical) Human: 88% identity (30/34 amino acids identical)

Monoclonal antibody info: Mouse strain: Balb/C Myeloma cell: SP2/0 Mouse Ig Isotype: IgG2b

NeuroMab Applications: Immunoblotting, Immunohistochemistry and Immunoprecipitation

Species Reactivity: human, mouse, rat

MW: 85 kD

Left: transfected cell immunoblot: COS cells transiently transfected with Ataxin-1 and Kv2.1 plasmids and probed with N76/8 TC supe.

Right: adult rat brain immunoblot: extracts of cerebella from Ataxin-1 KO and WT mice and probed with N76/8 (left) or K89/41 (right) TC supe.

Adult rat cerebellum (left) and hippocampus (right) immunohistochemistry

UC Davis/NIH NeuroMab Facility Department of Physiology and Membrane Biology, UC Davis, Davis CA 95616http://neuromab.ucdavis.edu [email protected]

© 2020 The Regents of the University of CaliforniaAll Rights Reserved

Available as TC supe (RRID: AB_10671173) & Pure IgG (RRID: AB_10673960)