u n a m universidad nacional autónoma de méxico servicios web con aplicaciones en bioinformática...
TRANSCRIPT
U N A MUniversidad NacionalAutónoma de México
Servicios Web con aplicaciones en Bioinformática
24 de marzo, 2009
Introducción.Navegando a través del tiempo en la genética Era Genómica
Genoma HumanoRetos
Explosión de datos.Análisis integrados.
BioinformaticaQué es?Consorcios y Grupos.Herramientas
Web Servicesweb servicesworkflows
Navegando a través del tiempo en la genética
1869: Friedrich Miescher isolates DNA for the first time.
1879: Mitosis observed
1865: Mendel's Peas
Gregor Mendel describes his experiments with peas showing that heredity is transmitted in discrete units.
Walter Flemming described chromosome behavior during animal cell division.
Miescher isolated a material rich in phosphorus from the cells and called it nuclein.
http://www.genome.gov/25019887
1900s
1900: Rediscovery of Mendel's work 1902: Orderly Inheritance of Disease Observed1902: Chromosome Theory of Heredity1909: The Word Gene Coined1911: Fruit Flies Illuminate the Chromosome Theory
1940's
1941: One Gene, One Enzyme 1943: X-ray Diffraction of DNA1944: DNA is "Transforming Principle"1944: Jumping Genes
1950's
1952: Genes are Made of DNA 1953: DNA Double Helix1955: 46 Human Chromosomes1955: DNA Copying Enzyme 1956: Cause of Disease Traced to Alteration 1958: Semiconservative Replication of DNA1959: Chromosome Abnormalities Identified
http://www.genome.gov/25019887
1960's
1961: mRNA Ferries Information 1961: First Screen for Metabolic Defect in Newborns1966: Genetic Code Cracked1968: First Restriction Enzymes Described
1970's
1972: First Recombinant DNA 1973: First Animal Gene Cloned1975-77: DNA Sequencing1976: First Genetic Engineering Company1977: Introns Discovered
1980's
1981-82: First Transgenic Mice and Fruit Flies 1982: GenBank Database Formed1983: First Disease Gene Mapped1983: PCR Invented1986: First Time Gene Positionally Cloned1987: First Human Genetic Map1987: YACs Developed1989: Microsatelites, New Genetic Markers1989: Sequence-tagged Sites, Another Marker
http://www.genome.gov/25019887
1990's
1990: Launch of the Human Genome Project NIH1990: ELSI Founded1990: Research on BACs1991: ESTs, Fragments of Genes1992: Second-generation Genetic Map of Human Genome1992: Data Release Guidelines Established1993: NEW HGP Five-year Plan1994: FLAVR SAVR Tomato1994: Detailed Human Genetic Map1994: Microbial Genome Project1995: Ban on Genetic Discrimination in Workplace 1995: Two Microbial Genomes Sequenced1995: Physical Map of Human Genome Completed1996: International Strategy Meeting on Human Genome Sequencing1996: Mouse Genetic Map Completed1996: Yeast Genome Sequenced1996: Archaea Genome Sequenced1996: Health Insurance Discrimination Banned1996: 280,000 Expressed Sequence Tags (ESTs)1996: Human Gene Map Created1996: Human DNA Sequence Begins1997: Bermuda Meeting Affirms Principle of Data Release 1997: E. coli Genome Sequenced1997: Recommendations on Genetic Testing1998: Private Company Announces Sequencing Plan1998: M. Tuberculosis Bacterium Sequenced1998: Committee on Genetic Testing1998: HGP Map Includes 30,000 Human Genes1998: New HGP Goals for 20031998: SNP Initiative Begins1998: Genome of Roundworm C. elegans Sequenced1999: Full-scale Human Genome Sequencing 1999: Chromosome 22
2000 - 2001
2000: Free Access to Genomic Information 2000: Chromosome 212000: Working Draft2000: Drosophila and Arabidopsis genomes sequenced2000: Executive Order Bans Genetic Descrimination in the Federal Workplace2000: Yeast Interactome Published2000: Fly Model of Parkinson's Disease Reported2001: First Draft of the Human Genome Sequence Released 2001: RNAi Shuts Off Mammalian Genes2001: FDA Approves Genetics-based Drug to Treat Leukemia
The President and Prime Minister Blair issued a Joint Statement in an effort to ensure that the public derives the maximum possible benefit from the sequence of the human genome.
http://www.genome.gov/25019887
2002 -2003
2002: Mouse Genome Sequenced2002: Researchers Find Genetic Variation Associated with Prostate Cancer2002: Rice Genome Sequenced2002: The International HapMap Project is Announced2002: The Genomes to Life Program is Launched2002: Researchers Identify Gene Linked to Bipolar Disorder2003: Human Genome Project Completed2003: Fiftieth Anniversary of Watson and Crick's Description of the Double Helix
2003: The First National DNA Day Celebrated2003: ENCODE Program Begins2003: Premature Aging Gene Identified
http://www.genome.gov/25019887
2004 - The Future
2004: Rat and Chicken Genomes Sequenced2004: FDA Approves First Microarray2004: Refined Analysis of Complete Human Genome Sequence2004: Surgeon General Stresses Importance of Family History2005: Chimpanzee Genomes Sequenced2005: HapMap Project Completed2005: Trypanosomatid Genomes Sequenced2005: Dog Genomes Sequenced2006: The Cancer Genome Atlas (TCGA) Project Started2006: Second Non-human Primate Genome is Sequenced2006: Initiatives to Establish the Genetic and Environmental Causes of Common Diseases Launched
The Future
http://www.genome.gov/25019887
Retos de la genómica
"If our strands of DNA were stretched out in a line, the 46 chromosomes making up the human genome would extend more than six feet [close to two metres]. If the ... length of the 100 trillion cells could be stretched out, it would be ... over 113 billion miles [182 billion kilometres]. That is enough material to reach to the sun and back 610 times." [Source: Centre for Integrated Genomics]
The Human Genome Project is involved in determining the exact order of the DNA bases of the entire human genome. The human genome contains more than 3.2 billion base pairs and more than 30 000 genes.
Explosión de datos.El genoma humano
http://www.ncbi.nlm.nih.gov/sites/entrez?db=genome&cmd=search&term=
Que tanta informacion hay?
NCBI - National Center for Biotechnology InformationEstablished in 1988 as a national resource for molecular biology information, NCBI creates public databases, conducts research in computational biology, develops software tools for analyzing genome data, and disseminates biomedical information - all for the better understanding of molecular processes affecting human health and disease.
Genoma: tamaño del genoma, número de genes
Human Genome:3 billion DNA base pairs and has a data size of approximately 750 Megabytes
Mas bases de datos especializadas.
El futuro. Análisis integrados y aplicados
Pilares
Retos
I. Genomics to Biology
. Elucidating the structure of genomes and identifying the function of the myriad encoded elements will allow connections to be made between genomics and biology and will, in turn, accelerate the exploration of all realms of the biological sciences.
II. Genómica y saludLa genómica encierra la promesa del desarrollo de una medicina individualizada y el manejo de ésta para cada perfil genético.
Los últimos avances en la investigación en Ciencias Biológicas están produciendo un enorme crecimiento en el volumen y la
complejidad de la información biológica disponible. Las Tecnologías de la Información y las Comunicaciones son
cruciales para posibilitar el almacenamiento e interpretación de estos datos en los centros de investigación de un modo eficiente y
robusto
Bioinformática
Pero, ¿qué es la bioinformática?
Una definición de Bioinformática
Aplicación de las tecnologías de la información en Biología Molecular
Esto incluye la compilación, mantenimiento, distribución, análisis y uso de las inmensas cantidades de información biológica disponibles
2 Major research areas 2.1 Sequence analysis 2.2 Genome annotation 2.3 Computational evolutionary biology 2.4 Measuring biodiversity 2.5 Analysis of gene expression 2.6 Analysis of regulation 2.7 Analysis of protein expression 2.8 Analysis of mutations in cancer 2.9 Prediction of protein structure 2.10 Comparative genomics 2.11 Modeling biological systems 2.12 High-throughput image analysis 2.13 Protein-protein docking
Principales áreas de su aplicación
Major Organizations Bioinformatics Organization (Bioinformatics.Org): The Open-Access Institute EMBnet European Bioinformatics Institute European Molecular Biology Laboratory The International Society for Computational Biology National Center for Biotechnology Information National Institutes of Health homepage Open Bioinformatics Foundation: umbrella non-profit organization supporting certain open-source projects in bioinformatics Swiss Institute of Bioinformatics Wellcome Trust Sanger Institute
Major Journals Algorithms in Molecular Biology Bioinformatics BMC Bioinformatics Briefings in Bioinformatics Evolutionary Bioinformatics Genome Research The International Journal of Biostatistics Journal of Computational Biology Cancer Informatics Journal of the Royal Society Interface Molecular Systems Biology PLoS Computational Biology Statistical Applications in Genetic and Molecular Biology Transactions on Computational Biology and Bioinformatics - IEEE/ACM International Journal of Bioinformatics Research and Applications List of Bioinformatics journals at Bioinformatics.fr EMBnet.News at EMBnet.org
EMBnet is the organisation world-wide bringing bioinformatics professionals to work together to serve the expanding fields of genetics and molecular ...
Software tools for bioinformatics simple command-line tools, complex graphical programs,CGI
Best-known algorithms:
BLAST, an algorithm for determining the similarity of arbitrary sequences against other sequences, possibly from curated databases of protein or DNA sequences.
EMBOSS. Software analysis package.
RSAT. Regulatory Sequence Analysis Tools.
Software en Bioinformática
A bioinformatics « world » for humansA bioinformatics « world » for humans
http://tux.crystalxp.net/en.id.10838-brunocb-leonard-de-vinci----tux-de-vitruve.html
My sweet home-made bioinformatics My sweet home-made bioinformatics platformplatform
Complete datasets
Download
Download
Do your analysis: scripts
BLAST
BLAT
RSAT
Clustalw
MEME
…
Download and install
Download and install
Parsing HTML
Parsing HTML
Web page only ressources
Filtered datasets
DownloadDownload
SQL queries
SQL queries
Perl
scrip
t
Perl
scrip
t
My nightmare (home-made) platformMy nightmare (home-made) platform
Complete datasets
Filtered datasets
DownloadDownload
Perl
scrip
t
Perl
scrip
t
Download
Download
SQL queries
SQL queries
BLAST
BLAT
RSAT
Clustalw
MEME
…
Download and install
Download and install
Do your analysis: scripts
Parsing HTML
Parsing HTML
Web page only ressources
UPDATES
NEW ANNOTATION
DEPENDENCIES
UPDATES
LIBRARIESNEW DATABASE SCHEMA
Bye bye home-made platform…Bye bye home-made platform…
http://www.genomequest.com/landing-pages/ODI-webinar-web.html
•Datos masivos. Necesidad de procesarlos e integrarlos.•Los datos se encuentran en distintos servidores, en distintas bases de datos, y en distintos formatos. Problema de intercambio de datos.
•Muchas herramientas y se encuentran en distintos servidores, en distintas formas de acceso (CGI-Forms, HTML), distintos formatos de entrada y salida, y en distintos lenguajes. Problema de interoperabilidad (comunicación entre herramientas)
Problemas :
Solución al Problema de intercambio de datos.
Intercambio de datos a través de un formato definido en XML.
XML permite estructurar datos y documentos en forma de árboles de etiquetas con atributos. El modelo de datos XML consiste en un árbol que no distingue entre objetos y relaciones, ni tiene noción de jerarquía de clases.
Si queremos semántica (significado)
Lenguajes para la definición de ontologías y metadatos en la web.
RDF Schema Query Language. OWL Ontology Web Language.
Solución al Problema de interoperabilidadUn servicio web (en inglés Web service) es un conjunto de protocolos y estándares que sirven para intercambiar datos entre aplicaciones. Distintas aplicaciones de software desarrolladas en lenguajes de programación diferentes, y ejecutadas sobre cualquier plataforma, pueden utilizar los servicios web para intercambiar datos en redes de ordenadores como Internet. La interoperabilidad se consigue mediante la adopción de estándares abiertos. Las organizaciones OASIS y W3C son los comités responsables de la arquitectura y reglamentación de los servicios Web.
Programs « talking » to programsPrograms « talking » to programs
retrieve-seq -org Saccharomyces_cerevisiae -feattype CDS -type upstream -format fasta …clic
kclick
#!/usr/bin/perl -wRSAT server in Bruxelles
login ssh
Anonymous access
anywhere
A future bioinformatics « world » for computers ?A future bioinformatics « world » for computers ?
I have a dream…
A future bioinformatics « world » for computers ?A future bioinformatics « world » for computers ?
I have a dream… Run analysis remotely
Only retrieve necessary data
Data always up-to-date
No need for local installation
A unified way to access data and programs
Programs interacting with programs over the internet
Web Services to the rescue ?Web Services to the rescue ?
Stein. Creating a bioinformatics nation. Nature (2002) vol. 417 (6885) pp. 119-20
« Although this proposal may seem a far cry from what happens now, the technology exists to make it reality. The World Wide Web consortium, with industry heavy-weights such as IBM and Microsoft, are providing an alphabet soup of standards: SOAP/XML, WSDL, UDDI and XSDL. »
What are Web Services (WS) ?What are Web Services (WS) ?
Definition: A Web service is a software system designed to support interoperable machine-to-
machine interaction over a network Source: W3C: http://www.w3.org/TR/ws-gloss/
Service provider(server)client
network => internet
PERL scriptrun_BLAST () blastall
call run_BLAST()
send back the results
#!/usr/bin/perl -w
SOAP-based Web Services: SOAP: Simple Object Access Protocol Standard of the W3C with specifications: messaging with XML, HTTP for transport
Various types of Web services : SOAPVarious types of Web services : SOAP
PERL scriptrun_BLAST () blastall
#!/usr/bin/perl -w
BLAST parameters$sequence $subst_matrix $threshold
XML
XML
XML
XML
BLAST result
XML
XML$result
HTTP
Various types of Web services : SOAPVarious types of Web services : SOAP
PERL scriptrun_BLAST () blastall
#!/usr/bin/perl -w
XML
<soapenv:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/" xmlns:blas="http://tempuri.org/Blast"> <soapenv:Body> <blas:searchParam soapenv:encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"> <program xsi:type="xsd:string">blastp</program> <database xsi:type="xsd:string">SWISS</database> <query xsi:type="xsd:string">MHLEGRDGRR YPGAPAVELL QTSVPSGLAE LVAGKRRLPR GAGGADPSHS</query> <param xsi:type="xsd:string"></param> </blas:searchParam> </soapenv:Body></soapenv:Envelope>
XML
Request envelope
Response envelope
<soap:Envelope soap:encodingStyle="http://schemas.xmlsoap.org/soap/encoding/" xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/" xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"> <soap:Body> <n:searchParamResponse xmlns:n="http://tempuri.org/Blast"> <Result xsi:type="xsd:string">BLASTP 2.2.18 [Mar-02-2008]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database searchprograms", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searchesusing compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= query (50 letters)
Database: SWISS: SWISS sequence taken from the header [Last updateMar/02/2009] 405,506 sequences; 146,168,000 total letters
Searching..................................................done
Score ESequences producing significant alignments: (bits) Value
sp|Q04671|P_HUMAN RecName: Full=P protein; AltName: Full=Melanoc... 104 1e-22
>sp|Q04671|P_HUMAN RecName: Full=P protein; AltName: Full=Melanocyte-specific transporter protein; AltName: Full=Pink-eyed dilution protein homolog; Length = 838
Score = 104 bits (260), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%)
Query: 1 MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHS 50 MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSSbjct: 1 MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHS 50
Database: SWISS: SWISS sequence taken from the header [Last update Mar/02/2009] Posted date: Mar 2, 2009 5:30 AM Number of letters in database: 146,168,000 Number of sequences in database: 405,506 Lambda K H 0.314 0.136 0.403
GappedLambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62Gap Penalties: Existence: 11, Extension: 1Number of Sequences: 405506Number of Hits to DB: 17,615,102Number of extensions: 565364Number of successful extensions: 858Number of sequences better than 10.0: 2Number of HSP's gapped: 858Number of HSP's successfully gapped: 2Length of query: 50Length of database: 146,168,000Length adjustment: 23Effective length of query: 27Effective length of database: 136,841,362Effective search space: 3694716774Effective search space used: 3694716774Neighboring words threshold: 11Window for multiple hits: 40X1: 16 ( 7.2 bits)X2: 38 (14.6 bits)X3: 64 (24.7 bits)S1: 42 (21.9 bits)S2: 62 (28.5 bits)</Result> </n:searchParamResponse> </soap:Body></soap:Envelope>
Various types of Web services : SOAPVarious types of Web services : SOAP
PERL
run_BLAST () blastall
SOAP::LiteSOAP::WSDLXML::Compile::WSDL11
BLAST parameters
XML
Client
serialization
ZSISOAPpy
AXISMETRO
XMLresult deserialization
PHP-SOAP
Various types of Web services : SOAPVarious types of Web services : SOAP
PERL
run_BLAST ()
SOAP::Lite/Apache
XML
XML
BLAST result
Client
?
AXIS / Tomcat
deserialization
serialization
PHP-SOAP/ Apache
blastall
Various types of Web services : SOAPVarious types of Web services : SOAP
PERL
run_BLAST ()
XML
XML
BLAST result
Client
deserialization
serialization
blastall
PERL
BLAST parameters
XML
Client
serialization
XMLresult deserialization
XML
XML
WSDL: Web Services Description Language: XML « a machine-readable description of the operations offered by the service » The server « introduce himself » to the clients
Names of the available services (=methods) Parameters of each service (name + type) Result of each service (type)
Various types of Web services : SOAP-Various types of Web services : SOAP-WSDLWSDL
<?xml version="1.0" encoding ='UTF-8' ?><?xml-stylesheet type="text/xsl" href="RSATWS.xsl"?><definitions name="RSATWS"
targetNamespace="urn:RSATWS" xmlns:tns="urn:RSATWS" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://schemas.xmlsoap.org/wsdl/"
xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:html="http://www.w3.org/1999/xhtml" xmlns:xsl="http://www.w3.org/1999/XSL/Transform">
<types> <xsd:schema targetNamespace="urn:RSATWS" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:xsd="http://www.w3.org/2001/XMLSchema">
<!-- RSA TOOLS REQUESTS --> <xsd:complexType name="RetrieveSequenceRequest"> <xsd:annotation>
<xsd:documentation>Parameters for the operation retrieve_seq.</xsd:documentation> </xsd:annotation> <xsd:sequence>
<xsd:element name="output" type="xsd:string" minOccurs="0"> <xsd:annotation> <xsd:documentation>Return type.
Accepted values: 'server' (result is stored on a file on the server), 'client' (result is directly transferred to the client),'both' (result is stored on the server and transferred to the client), and ticket (an identifier, allowing to monitor the job status and retrieve the result when it is done, is returned to the client).Default is 'both'.</xsd:documentation>
</xsd:annotation> </xsd:element> <xsd:element name="organism" type="xsd:string" minOccurs="1">
<xsd:annotation> <xsd:documentation>Organism. Words need to be underscore separated (example: Escherichia_coli_K12).</xsd:documentation> </xsd:annotation> </xsd:element>
<xsd:element name="query" type="xsd:string" minOccurs="0" maxOccurs="unbounded"> <xsd:annotation> <xsd:documentation>A list of query genes.</xsd:documentation> </xsd:annotation> </xsd:element>
<xsd:element name="all" type="xsd:int" minOccurs="0"> <xsd:annotation> <xsd:documentation>Return sequences for all the genes of the organism if value = 1. Incompatible with query.</xsd:documentation> </xsd:annotation> </xsd:element>
<xsd:element name="noorf" type="xsd:int" minOccurs="0">
WSDL: The URL of the WSDL is necessary to « consume » a SOAP/WSDL Web Service
(=write a client) Allows for automatic generation of client-side libraries « client stub »
=> Reduce the amount of code you have to write
Various types of Web services : SOAP-Various types of Web services : SOAP-WSDLWSDL
parameters
XML
Client
serialization
XMLresult deserialization
Example: to write a client for RSAT Web Services in PERL
- SOAP::WSDL installed- http://rsat.ulb.ac.be/rsat/web_services/RSATWS.wsdl- PERL library « RSATWS » downloadable on RSAT Website, generated from the WSDL
Example of code for RSAT PERL Client:
Various types of Web services : SOAP-Various types of Web services : SOAP-WSDLWSDL
#!/usr/bin/perl –w
use SOAP::WSDL; use lib 'RSATWS';use MyInterfaces::RSATWebServices::RSATWSPortType;
## new soap objectmy $soap=MyInterfaces::RSATWebServices::RSATWSPortType->new();
## parametersmy %args = ('format' => ‘text’);
## Send the request to the servermy $som = $soap->supported_organisms({'request' => \%args});
## Get the resultunless ($som) { printf "A fault (%s) occured: %s\n", $som->get_faultcode(), $som->get_faultstring();
} else { my $results = $som->get_response();
my $result = $results -> get_client(); print "Supported organism(s): \n".$result; }
Various types of Web services : RESTVarious types of Web services : REST
RESTful Web services: HTTP transport but no messaging system Can be seen as a way to retrieve resources via their URLs Most often used for databases Often not really considered as « Web Services »
Example:
http://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nucleotide&id=U12345&rettype=fasta
>gi|540023|gb|U12345.1|AMU12345 Aepyceros melampus isolate am5 D-loop, partial sequence; mitochondrialACTACCGCTATCAATATACTCCCACAAATATCAAGAGCCTTCCCAGTATTAAATTTGCTAAAATTTTAAAAATTCAATACGAACTTCACACTCCACAGCCTCACGCGAAATTAATAATACGTATTTAAATTCTAGAGTACATACCATGAACTATCGTTTAGTACATGAATTTACACACGTCAGCCCGATCAAATGTTTATGTACATAACACATTATATATGTACATTTCAGTTTGTGTATATAGACATAACATTAATGTAATAAAGACATAATATGTATATAGTACATTAATTGATTGTCCTCAAGCATATAAGCAAGTACTAGACATTCACTAGCGGTACATAGTACATTTCATTGTTCATCGTACATAGCGCATGTCAGNCAAATCCGTTCTTGTCAACATGCATATCCCGTCCACTAGATCAC
Web Services: pros and consWeb Services: pros and cons
Advantages Independency of languages => interoperability Standard for accessing and describing the services Improved connectivity between the programs Possibility of constructing workflows
Drawbacks Independency of languages
not that straightforward to make a “universal” server Each language has its own “implementation” of the standard
Heavy system (SOAP/WSDL), need maintenance by service providers Efficiency => heavy network traffic + serializing/deserializing
WS everywhere WS everywhere
Amazon Google http://seekda.com/
Extensive search engine for Web Services (currently 27 813 services)
http://demo.service-finder.eu (alpha version, promising)
WS in BioinformaticsWS in Bioinformatics
http://www.ebi.ac.uk/Tools/webservices/
http://www.ncbi.nlm.nih.gov/entrez/query/static/eutils_help.html
http://xml.ddbj.nig.ac.jp/index.html
http://rsat.bigre.ulb.ac.be/rsat/
http://www.genome.jp/kegg/soap/
http://api.bioinfo.no/wsdl/JasparDB.wsdl
Los servicios web semánticos proponen extender estas tecnologías, en vías de consolidación, con ontologías y semántica que permitan la selección, integración e invocación dinámica de servicios, dotándoles así mismo de la capacidad de reconfigurarse dinámicamente para adaptarse a los cambios (p.e. interrupción de servicios o aparición de otros más adecuados) sin intervención humana.
Agregando Significado…
¿Qué son los servicios Web semánticos?
Los Servicios Web Semánticos son una nueva tecnología resultante de la combinación de la Web Semántica y los Servicios Web.
Servicios Web Semánticos = Servicios Web + WebSemántica
Servicios Web y Web semántica
Servicios Web: Conjunto de protocolos y estándares que permiten el intercambio de datos independientemente de plataforma y lenguaje de programación.
Web Semántica: Se basa en añadir semántica a los datos publicados en la Web de forma que las máquinas sean capaces de procesar la información contenida en los documentos de modo similar a como los usuarios humanos lo pueden hacer.
¿Porqué surgen los servicios Web semánticos?
Existen en la actualidad una gran cantidad de servicios disponibles y esto hace inviable en tiempo y eficiencia que sea un usuario humano el que determine el servicio o servicios necesarios para satisfacer una necesidad concreta.
Debido a esto surgen los Servicios Web Semánticos los cuales describen a los Servicios Web con contenido semántico de forma que el descubrimiento de servicios, su composición e invocación se pueda realizar de forma automática por parte de entidades software capaces de procesar la información semántica disponible.
Ontologia
Representa las capacidades del servicio y sus restricciones de
uso. Integra la semántica del servicio con su descripción. Consta de los siguientes elementos:
Información funcional del servicio: entradas, salidas,
precondiciones, postcondiciones
Información no funcional : Categoría, Coste ,Calidad de servicio
Find Relevant Genes from Online Databases
Find Relevant Genes from Online Databases
Find Associations between Frequent TermsFind Associations between Frequent Terms
Gene Expression Analysis Gene Expression Analysis
WorkFlows. Conectando herramientas
Example of workflowExample of workflow
Sand et al. Nature Protocol (2008) vol. 3 (10) pp. 1604-1615
Taverna: a workbench to design workflowsTaverna: a workbench to design workflows
http://taverna.sourceforge.net/
WS in bioinformatics: Utopia ?WS in bioinformatics: Utopia ?
• Work is on service providers• Reluctancy of service providers to add/switch to WS– Takes time and human ressources to set up WS– Necessity to find people that are WS experts or willing to learn WS
• Lack of advertisement• Lack of a global registry
• Various WS: SOAP/REST + BioMOBY + SOAPLAB All accessed in different ways
• Lack of users !!!
A future bioinformatics « world » for computers ?A future bioinformatics « world » for computers ?
I still have a dream…
AcknowledgementsAcknowledgements
Prof. Jacques van HeldenDr. Morgan Thomas
Grupo: Luis José Muniz Rascado, Jair, Lilian, Shirley, Ale, Aura
Dr. Julio Collado Vides