top down proteomics enabled by the orbitrap...
TRANSCRIPT
![Page 1: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/1.jpg)
Thermo Fisher Scien.fic – Annual Users’ Mee.ng
ASMS 2011 -‐ June 5, 2011
Top Down Proteomics Enabled by the Orbitrap Elite
Kelleher Research Team Northwestern University
![Page 2: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/2.jpg)
Executive Summary
• Top Down Proteomics: A Full Solution for Protein Isoforms in Discovery Mode
• Top Down MS: Targeted Analysis of Intact Antibodies
![Page 3: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/3.jpg)
Detailed Summary
• Top Down MS: Contemporary Context • Benchmarking the Elite on Protein Standards • Targeted Top Down MS of Humira Ab • Use of the Orbitrap Elite for Top Down
Proteomics of Human Cells • Database Strategies and Informatics for Precision
Proteomics: ProSight Suite of Software
Data from an Orbitrap Elite, equipped with ETD, HCD, CID and SID
![Page 4: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/4.jpg)
Detailed Summary
• Top Down MS: Contemporary Context • Benchmarking the Elite on Protein Standards • Targeted Top Down MS of Humira Ab • Use of the Orbitrap Elite for Top Down
Proteomics of Human Cells • Database Strategies and Informatics for Precision
Proteomics: ProSight Suite of Software
Data from an Orbitrap Elite, equipped with ETD, HCD, CID and SID
![Page 5: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/5.jpg)
• Top Down (intact protein)
• Middle Down (endogenous biomarkers, larger peptides >3 kDa)
• Bottom Up (tryptic peptides; classical)
N C
N C
N C
General Strategies of Protein Analysis by Mass Spectrometry
![Page 6: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/6.jpg)
Protein Variability in Higher Proteomes and BioPharma:
The Age of Protein Isoforms
![Page 7: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/7.jpg)
Top Down Proteomics: 2002
29 September, 2008
Proteomics using intact proteins as the primary unit of measurement
![Page 8: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/8.jpg)
Detailed Summary
• Top Down MS: Contemporary Context • Benchmarking the Elite on Protein Standards • Targeted Top Down MS of Humira Ab • Use of the Orbitrap Elite for Top Down
Proteomics of Human Cells • Database Strategies and Informatics for Precision
Proteomics: ProSight Suite of Software
![Page 9: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/9.jpg)
Orbitrap Technology: Upgrades for Next-Gen. Proteomics
New: • Generation II Ion Optics
• New detection system and pre-amplifier
• Compact HF (3.5 kV)
• eFT data processing
à >3.6 X speed increase
à Orbitrap physics: (m/z)-1/2 scaling of RP
![Page 10: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/10.jpg)
Time (min) 35 40 30 55 50 45 20 25 15
Ubiquitin-9+ R= 154 K
Myoglobin-17+ R= 141 K
Trypsinogen-12+ R= 107 K
952.0 952.2 952.4 952.6 952.8 953.0 953.2 953.4m/z
1999.0 1999.2 1999.4 1999.6 1999.8m/z
997.7 997.8 997.9 998.0 998.1 998.2 998.3 998.4 998.5 998.6m/z
1199.8 1200.0 1200.2 1200.4 1200.6 1200.8 1201.0m/z
Superoxide Dismutase-
13+ R= 132 K
1161.7 1161.8 1161.9 1162.0 1162.1 1162.2 1162.3m/z
Carbonic Anhydrase-25+
R= 115 K
Top Down of the Usual Suspects on Orbitrap Elite
![Page 11: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/11.jpg)
FT Mass Spectrometry
Thermo 7T LTQ-‐FT Ultra High-‐resolu>on Pep>de Analysis
Thermo Velos-‐Orbitrap High-‐resolu>on Pep>de Analysis
Custom 12T LTQ-‐FT Ultra Top Down Protein Characteriza>on
![Page 12: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/12.jpg)
Comparison of FT-Orbitrap and FT-ICR: Resolving Power
![Page 13: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/13.jpg)
Detailed Summary
• Top Down MS: Contemporary Context • Benchmarking the Elite on Protein Standards • Targeted Top Down MS of Humira Ab • Use of the Orbitrap Elite for Top Down
Proteomics of Human Cells • Database Strategies and Informatics for Precision
Proteomics: ProSight Suite of Software
![Page 14: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/14.jpg)
ETD of intact 150 kDa antibody: Humira IgG
148.0 148.5 149.0Mass, kDa
LTQ Velos Pro Orbitrap MS/MS ETD: fluorenthene, 10-25 ms LC: BioBasic-4 column (10 min gradient) Protein amount: 1 pmol per injection Number of scans summed: up to 1000
![Page 15: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/15.jpg)
ETD of intact 150 kDa antibody: Humira IgG
m/z
ETD: 25 ms
![Page 16: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/16.jpg)
Sequence coverage: ETD of Humira IgG, [M+54H]54+
Light Chain: 46 c-ions, 23 y-ions, 31 z-ions Heavy Chain: 48 c-ions, 21 y-ions, 35 z-ions Total unique cleavage sites: 161
N-acetylglucosamine
mannosefucosegalactoseN-acetylglucosamine
mannosefucosegalactose
Tsybin et al. Poster 557
Monday
![Page 17: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/17.jpg)
Detailed Summary
• Top Down MS: Contemporary Context • Benchmarking the Elite on Protein Standards • Targeted Top Down MS of Humira Ab • Use of the Orbitrap Elite for Top Down
Proteomics of Human Cells • Database Strategies and Informatics for Precision
Proteomics: ProSight Suite of Software
![Page 18: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/18.jpg)
Data Acquisition and Processing
![Page 19: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/19.jpg)
Work Flow for Top Down Proteomics
Cell lysate GELFrEE intact protein fractionation
–
+
100 kDa
10 kDa
High-throughput search using ProSightPC
Online nanoLC-MS/MS on 12 Tesla LTQ-FTMS
10 kDa
25 kDa
(60-90 min separation) (200 – 400 µg)
Lee, Kellie, Kelleher and co-workers, J. Am. Soc. Mass Spectrom. 2009.
Detergent Removal Columns
![Page 20: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/20.jpg)
400 600 800 1000 1200 1400m/z
Orbitrap Elite - Top Down Acquisition Cycle Intact MS1 216K RP
500 ms MS2 108K RP
275 ms Top 3 (transient, reaction time, overhead)
1.5 s Cycle Time
700 800 900 1000 1100 1200m/z
Data Dependent MS/MS
ProSight Search Intact Mass Determination
Fragment Mass Determination
MS1 Injection ~1 ms
MS2 Injection ~50 ms
![Page 21: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/21.jpg)
Intact and Fragment Mass Determination: ProSight HTTD Logic
Durbin, K.; Tran J.T.; Zamdborg, L.; Kelleher, N.L., Proteomics. 2010, 10, 3589-3597.
![Page 22: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/22.jpg)
0 10 20 30 40 50 60 70 80Time (min)
Metrics From A Single Injec>on Top 3 HCD Experiment
MS/MS spectra
Experiments with ≥4 Matching Frag.
Total ProSight ID’s
(E<0.01)
Posi.ve Results
Unique Proteins
Unique Isoforms
585 1892 1037 55% 33 78
1108.2 1108.6 1109.0 1109.4 1109.8m/z538.5 538.7 538.9 539.1 539.3 539.5
m/z
Coiled-‐coil domain-‐containing protein 72; E-‐value 4 E-‐16 Profilin-‐1; E-‐value 2 E-‐16 Ribonuclease UK114, E-‐value 7 E-‐18
998.0 999.0 1000.0m/z
![Page 23: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/23.jpg)
Scope of the Study Thus Far (H1299 Cells)
10
15
20
25
37
50
60 Files HCD/ETD/CID DD
34 Files 16 HCD DD
28 High-‐High SID
18 Files Med-‐High-‐SID
![Page 24: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/24.jpg)
Database Searching: Overall Results Ø ProSight Experiments: 52081 Ø Total Iden>fica>on Events (E-‐value <0.01): 40779
Ø Hits with an annotated PTM: 33808
Ø Unique Swiss-‐Prot Accession Numbers: 501 Ø Dis.nct Protein Isoforms: 1792 Ø Number of Alterna>ve Splice Events (var_seq): 32 Ø Number of PTMs (Unique Sites) Detected: 1300
Ø Phosphoryla>on: 319 Ø Methyl(x): 86 Ø Myristoyl-‐/Palmitoyl-‐: 3 Ø Actetyla>on: 406
Ø N-‐terminal Acetyla>on: 483 Ø Geranylgeranyla>on: 2 Ø Hypusine: 1
![Page 25: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/25.jpg)
Distribu>on of Observed Masses (kDa)
Overall Results (con>nued) One in a million chance of obtaining wrong
result!
Hyper Confident ID’s
0
10
25
80
-‐log (E-‐value)
• 90 .RAW Files • Frac>ons <55kDa 20
15
5
![Page 26: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/26.jpg)
m/z
1158.02z=35
1155.66z=35
Example Iden>fica>on at 40 kDa (FT/FT)
900 1000 1100 1200 1300 1400 1500m/z 800 1000 1200 1400 1600 1800
m/z
MS2 SID Reduces the an>-‐apopto>c ac>vity of Bcl-‐xl and Bcl-‐2.
Δ80
Retriculon 4B (Isoform 2):
@ !@E!@D!@L @D @Q!@S @P!@L!@V!@ !@S!@S!@D!@S!@P!@P!@R!@P!@Q!@P!@A!@F!@K!@Y!@Q!@F!@V!@R!@E!@P!@E!@D!@E!@E!@E!@E!@E!@E!@E!@E!@E!@E!@D!@E!@D!@E!@D!@L!@E!@E!@L!@E!@V!@L!@E!@R!@K!@P!@A!@A!@G!@L!@S!@A!@A!@P!@V P!@T!@A P!@A!@A!@G!@A P!@L!@M!@D!@F!@G!@N!@D!@F!@V!@P!@P!@A!@P!@R!@G!@P!@L!@P!@A!@A!@P!@P!@V!@A!@P!@E!@R!@Q!@P!@S!@W!@D!@P!@S!@P!@V!@S!@S!@T!@V @P!@A!@P!@S!@P!@L!@S!@A!@A!@A!@V!@S!@P!@S!@K!@L!@P!@E!@D!@D!@E!@P!@P!@A!@R!@P!@P!@P!@P!@P!@P!@A!@S!@V!@S!@P!@Q!@A!@E!@P!@V!@W!@T!@P!@P!@A!@P!@A!@P!@A!@A!@P!@P!@S!@T!@P!@A!@A!@P!@K!@R!@R!@G!@S!@S!@G!@S!@V!@V!@V!@D!@L!@L!@Y!@W!@R!@D!@I!@K!@K!@T!@G!@V!@V!@F!@G!@A!@S!@L!@F!@L!@L!@L!@S!@L!@T!@V F!@S!@I!@V!@S!@V!@T!@A!@Y!@I!@A!@L!@A!@L!@L!@S!@V!@T!@I!@S!@F!@R!@I!@Y!@K!@G!@V!@I!@Q!@A!@I!@Q!@K!@S!@D!@E!@G!@H!@P!@F!@R!@A!@Y!@L!@E!@S!@E!@V!@A!@I!@S!@E!@E!@L!@V!@Q!@K!@Y!@S!@N!@S!@A!@L!@G!@H!@V!@N!@C!@T!@I!@K!@E!@L!@R!@R!@L!@F!@L!@V!@D!@D!@L!@V!@D!@S!@L!@K!@F!@A!@V!@L!@M!@W!@V!F!T!Y!V!G!@A!L!F!@N!@G!@L!T!L!L!I!L!A!L!I!S!L!F!S!V!P!V!@I!@Y!@E!@R!@H!@Q!@A!@Q!@I!@D!@H!@Y!@
L!@G!@L!@A!@N!@K!@N!@V!@K!@D!@A!@M!@A!@K!@I!@Q!@A!@K!@I P!@G!@L!@K!@R!@K!@A!@E!
Theore>cal Mass: 40497.1 Da
Observed Mass: 40495.4 Da Mass Error: 42 ppm
Total Matching Ions: 34
* *
![Page 27: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/27.jpg)
Detailed Summary
• Top Down MS: Contemporary Context • Benchmarking the Elite on Protein Standards • Targeted Top Down MS of Humira Ab • Use of the Orbitrap Elite for Top Down
Proteomics of Human Cells • Database Strategies and Informatics for
Precision Proteomics: ProSight Suite of Software
![Page 28: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/28.jpg)
![Page 29: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/29.jpg)
![Page 30: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/30.jpg)
![Page 31: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/31.jpg)
Correct Gene Family
Correct Gene
Correct Protein Isoform
Shotgun Annotation Extended to the Whole Human Proteome
Roth, Kelleher, and Team, Mol Cell Proteomics, 2005, 7, 1002-1008.
![Page 32: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/32.jpg)
Update of the UniProtKB / Swiss-Prot
Release Version
“2011_04” (05-Apr-11)
![Page 33: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/33.jpg)
Feature counts for Swiss-Prot (Homo sapiens; April 2011)
20,225 total entries: • CONFLICT !was found 31853 times.!• VAR_SEQ !was found 20511 times.!• VARIANT !was found 64108 times.!• PEPTIDE !was found 373 times.!• PROPEP !was found 795 times.!• SIGNAL !was found 3447 times.!• CHAIN !was found 20747 times.!• TRANSIT !was found 486 times.!• MOD_RES !was found 39539 times.!• INIT_MET !was found 1478 times.!
![Page 34: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/34.jpg)
Swiss-Prot Entry for HMGA1
ID HMGA1_HUMAN Reviewed; 107 AA. AC P17096; P10910; Q5T6U9; Q9UKB0; DT 01-AUG-1990, integrated into UniProtKB/Swiss-Prot. DT 23-JAN-2007, sequence version 3. DT 05-APR-2011, entry version 140. DE RecName: Full=High mobility group protein HMG-I/HMG-Y; DE Short=HMG-I(Y); DE AltName: Full=High mobility group AT-hook protein 1; DE Short=High mobility group protein A1; DE AltName: Full=High mobility group protein R; GN Name=HMGA1; Synonyms=HMGIY; OS Homo sapiens (Human). OX NCBI_TaxID=9606; FT INIT_MET 1 1 Removed. FT CHAIN 2 107 High mobility group protein HMG-I/HMG-Y. FT MOD_RES 2 2 N-acetylserine (By similarity). FT MOD_RES 15 15 N6-acetyllysine. FT MOD_RES 26 26 Asymmetric dimethylarginine; in isoform HMG-I alternate. FT MOD_RES 26 26 Omega-N-methylarginine; in isoform HMG-I alternate. FT MOD_RES 26 26 Symmetric dimethylarginine; in isoform HMG-I; alternate. FT MOD_RES 36 36 Phosphoserine. FT MOD_RES 39 39 Phosphothreonine. FT MOD_RES 44 44 Phosphoserine. FT MOD_RES 49 49 Phosphoserine. FT MOD_RES 53 53 Phosphothreonine. FT MOD_RES 58 58 Asymmetric dimethylarginine; by PRMT6; alternate. FT MOD_RES 58 58 Omega-N-methylarginine; by PRMT6; alternate. FT MOD_RES 60 60 Asymmetric dimethylarginine; by PRMT6; FT MOD_RES 60 60 Omega-N-methylarginine; by PRMT6; FT MOD_RES 99 99 Phosphoserine; in isoform HMG-I and isoform HMG-Y. FT MOD_RES 102 102 Phosphoserine; by CK; in isoform HMG-I and isoform HMG-Y. FT MOD_RES 103 103 Phosphoserine; by CK; in isoform HMG-I and isoform HMG-Y. FT VAR_SEQ 35 45 Missing (in isoform HMG-Y). FT VAR_SEQ 66 107 NKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEE FT Q -> KNWRRRKRRASRRSPRRRSSDPCVPPAPHWRSSFLL FT GLDSFAPLPPPPPLPQAHHHHRLWPPPPSSTCALTTTLHST FT PAAAGLPWAEWGAVFPWPQFPAPPAHPRIHTCPPGQG (in FT isoform HMG-R). SQ SEQUENCE 107 AA; 11676 MW; E9C4E3F2200914B8 CRC64; MSESSSKSSQ PLASKQEKDG TEKRGRGRPR KQPPVSPGTA LVGSQKEPSE VPTPKRPRGR PKGSKNKGAA KTRKTTTTPG RKPRGRPKKL EKEEEEGISQ ESSEEEQ //
VAR_SEQ indicates splice variants
MOD_RES indicates post-translational modifications
This entry will produce 3 ProSight
Base Sequences and 32,256 ProSight Protein Forms
![Page 35: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/35.jpg)
Proper Presentation of Human Protein Databases for Mass Spectral Searching
UniProt entries for Homo Sapiens
Features Recognized
Reduce Redundant Sequences
Allow 213 PTMs/SNPs possible per sequence
54190 Base Sequences
20225 Entries
8.5 Million Isoforms
(5 GB)
• Initial Methionine • Chain • Known Modifications • Sequence Variants • Conflicts
The Process of “Shotgun Annotation”
(Kelleher Group, JACS, 2004) Allows automated detection of
combinatorial modifications
![Page 36: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/36.jpg)
ProSightPC Evolu>on
Windows7 ! X64 ! New Features !
![Page 37: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/37.jpg)
Detailed Summary
• Top Down MS: Contemporary Context • Benchmarking the Elite on Protein Standards • Use of the Orbitrap Elite for Top Down
Proteomics of Human Cells • Database Strategies and Informatics for Precision
Proteomics: The ProSight Way • Targeted Top Down MS of Humira Ab
![Page 38: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/38.jpg)
Conclusions ❒ Top Down Proteomics in a robust platform is now possible in the 5-40 kDa regime. ❒ 40-150 kDa: under accelerating development and targeted analysis in this size regime is readily performed now. ❒ The Orbitrap Elite is an ultra-high performance instrument for Top Down on a LC timescale (>3.6 X). Complementarity of fragmentation methods useful for both éI.D.’s and localizing PTMs. ❒ Proteome studies of DNA-damage models and primary cancer/serum samples now underway.
![Page 39: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/39.jpg)
Acknowledgements
• Iain Mylchreest • Alexander Makarov • Michael Senko • Stevan Horning • Oliver Lange • Vlad Zabrouskov • Andreas Huhmer
• Eugene Damoc • Eduard Denisov • Alain Guiller • Hartmut Kuipers • Jens Griep-Raming
![Page 40: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/40.jpg)
The Chemistry of Life Processes Institute
Kelleher Research Group
![Page 41: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/41.jpg)
Proteomics Center @ Northwestern
Dr. Paul Thomas, Associate Director
Dr. Phil Compton, Head of Instrumentation
Mr. Ryan Fellers, Senior Software Engineer
![Page 42: Top Down Proteomics Enabled by the Orbitrap Eliteapps.thermoscientific.com/media/SID/LSMS/PDF/LSMSUsersMtg/...Detailed Summary • Top Down MS: Contemporary Context • Benchmarking](https://reader034.vdocuments.site/reader034/viewer/2022051407/5b016dc27f8b9a54578e2a1a/html5/thumbnails/42.jpg)
Thank You