new syntaxin-3 regulates biphasic glucose stimulated insulin … · 2013. 10. 17. · syntaxin-3...
TRANSCRIPT
Syntaxin-3 Regulates Biphasic Glucose Stimulated Insulin Secretion in the Pancreatic Beta Cell
by
Ellen Koo
A thesis submitted in conformity with the requirements for the degree of Masters of Science
Graduate Department of Physiology
University of Toronto
© Copyright by Ellen Koo (2010)
Syntaxin-3 Regulates Biphasic Glucose Stimulated Insulin Secretion in the Pancreatic Beta Cell
Ellen Koo
Masters of Science (2010)
Department of Physiology
University of Toronto
Abstract
The molecular basis of exocytosis of insulin granules during biphasic glucose stimulated
insulin secretion (GSIS) of pancreatic beta cells remains unclear. Of the exocytotic Syntaxin
(Syn) family of SNARE proteins, Syn-1A has been postulated to mediate exocytosis of docked
insulin granules during first phase GSIS, while Syn-4 facilitates both phases of GSIS. Syn-3 is
also abundant in islet beta cells, but its function in GSIS is unknown. Our study aims to
investigate the role of Syn-3 in biphasic insulin secretion and how it regulates the recruitment to
plasma membrane and/or exocytotic fusion of insulin granules. Confocal microscopy showed
endogenous Syn-3 (and exogenously overexpressed Syn-3 WT-EGFP) to be localized to insulin
granules. We first examined the function of endogenous Syn-3 by down-regulating its
expression employing siRNA and lenti-shRNA viruses, the latter to establish a stable knockdown
INS-1 cell line; which impaired GSIS. Total internal reflection fluorescence microscopy
(TIRFM) of Syn-3 depleted INS-1 cells showed no change in the number of docked insulin
granules and preservation of fusion competence of previously docked granules – which are
functions previously attributed to Syn-1A. Remarkably, Syn-3 depletion caused marked
reduction in the number of newcomer granules and their subsequent exocytotic fusion, which
encompassed both first and second phases of GSIS. We then examined the effects of
ii
overexpressing Syn-3 WT-EGFP, which enhanced biphasic insulin secretion in mice islets.
Since open conformation Syn-1A was previously reported to enhance Syn-1A actions by
promoting exocytotic SNARE complex formation, we constructed open form Syn-3. Exogenous
open form Syn-3 had no effect on secretion as it is retained in the cytosol, unable to be trafficked
to insulin granules. Taken together, we conclude that Syn-3 in insulin granules functions to
facilitate (or mediate) mobilization of newcomer insulin granules to the plasma membrane, to
contribute to both first and second phases of GSIS in pancreatic beta cells.
iii
Acknowledgements I would like to thank my supervisor Dr. Herbert Gaisano, for giving me the opportunity to further
my learning in the field of research and for showing me patience and understanding during the
completion of this project.
I also wish to thank my supervisory committee members, Dr. Shuzo Sugita, Dr. Allen Volchuk
and Dr. Michael Wheeler, for sharing their knowledge and providing direction in my project.
This thesis would have not been possible without the support and expertise of my fellow lab
members. I wish to thank Dr. Dan Zhu, for the contributions to the TIRFM analysis of my
project. I especially want to thank Dr. Edwin Kwan, for teaching me the techniques used in my
experiments and the constructive feedback on my thesis. I also wish to thank Dr. Youhou Kang
and Huanli Xie, for the invaluable assistance that was always offered without hesitation.
Lastly, I would like to thank God, my parents, sister and friends for their love and
encouragement through the duration of my graduate studies.
iv
Table of Contents Abstract ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ii Acknowledgements ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... iv Table of Contents ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... v List of Figures ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... viii Chapter 1: Introduction ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 1
1.1 Exocytosis in Secretory Cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 1
1.1.1 Primary Exocytosis ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 1
1.1.2 Granule-Granule Fusion Underlying Sequential and Compound
Exocytosis ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 2
1.2 The Pancreatic Beta Cell as a Model of Exocytosis ... ... ... ... ... ... ... ... ... ... ... 3
1.3 Physiology of Biphasic Insulin Secretion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 6
1.4 The SNARE Family and SNARE Hypothesis ... ... ... ... ... ... ... ... ... ... ... ... ... ... 8
1.4.1 The Syntaxin Family ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 11
1.4.2 Syntaxin-1 Regulation of Insulin Secretion in the Beta Cell ... ... ... ... 13
1.4.3 Syntaxin-4 Regulation of Insulin Secretion in the Beta Cell ... ... ... ... 15
1.5 SNAREs in the Pathophysiology of Type-2 Diabetes ... ... ... ... ... ... ... ... ... ... 17
1.6 The SM Protein Family and Interactions with SNAREs ... ... ... ... ... ... ... ... ... 18
1.7 Cellular Functions of Syntaxin-3 in Various Tissues ... ... ... ... ... ... ... ... ... ... ... 21
1.8 Rationale and Hypothesis – Syntaxin-3 Recruitment of Newcomer Insulin
Granules during Biphasic Glucose Stimulated Insulin Secretion ... ... ... ... ... ... 22
v
Chapter 2: Research Design and Methods ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 24 2.1 INS-1 (832/13) Cell Culture ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 24
2.2 Immunoblotting ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 24
2.3 siRNA Transfection of INS-1 Cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 25
2.4 Static Insulin Secretion Assay ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 25
2.5 Lentivirus Transduction and Establishment of New Stable Cell Lines ... ... ... ... 26
2.6 Total Internal Refraction Fluorescence Microscopy ... ... ... ... ... ... ... ... ... ... ... ... 26
2.7 Cell Preparation for Confocal Immunofluorescence Microscopy ... ... ... ... ... ... ... 31
2.8 Adenovirus Production and Purification ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 31
2.9 Adenoviral Transduction of INS-1 Cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 33
2.10 Isolation of Mouse Pancreatic Islets and Beta Cells ... ... ... ... ... ... ... ... ... ... ... 33
2.11 Adenoviral Transduction of Mouse Islets ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 34
2.12 Mouse Islet Perifusion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 34
2.13 Statistics ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 34
Chapter 3: Results ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 35
3.1 Syntaxin-3 Expression in Pancreatic Islets and Colocalization with Insulin
Granules ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 35
3.2 RNAi-mediated Depletion of Syntaxin-3 Impaired Glucose Stimulated Insulin
Secretion in INS-1 Cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 37
3.3 Diminished Glucose Stimulated Insulin Secretion in Stable Syntaxin-3
Knockdown ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 39
vi
3.4 Syntaxin-3 Depletion Reduced Newcomer Granule Mobilization Underlying
Biphasic Insulin Secretion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 43
3.5 Syntaxin-3 Overexpression Potentiated Glucose Stimulated Insulin Secretion in
Mouse Islets ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 49
3.6 Overexpression of Syntaxin-3 (in Wild Type Conformation) Enhanced Glucose
Stimulated Insulin Secretion in INS-1 Cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... 55
3.7 Mislocalization of Open-Form Syntaxin-3 Following Overexpression in
INS-1 Cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 57
Chapter 4: Discussion
4.1 Syntaxin-3 Facilitates Exocytosis of Newcomer Granules during Biphasic
Glucose Stimulated Insulin Secretion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 59
4.2 Experimental Limitations ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 64
4.3 Future Directions ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 65
4.4 Physiological Relevance of Syntaxin-3 Function in Glucose Stimulated Insulin
Secretion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 68
References ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 70
vii
List of Figures
Figure 1 Glucose stimulated insulin secretion by the pancreatic beta cell ... ... ... ... ... 5
Figure 2 Biphasic pattern of glucose stimulated insulin secretion in the pancreatic
beta cell ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 7
Figure 3 SNARE complex formation and the SNARE hypothesis ... ... ... ... ... ... ... ... ... ... 10
Figure 4 Syntaxin protein conformation ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 12
Figure 5 Schematic drawing of the evanescent field by TIRFM ... ... ... ... ... ... ... ... ... ... 29
Figure 6 TIRFM of insulin granules labelled with Syncollin-pHluorin ... ... ... ... ... ... ... ... 30
Figure 7 Rat Syntaxin-1A and Syntaxin-3 protein sequence alignment ... ... ... ... ... ... ... 32
Figure 8 Endogenous expression of Syntaxin-3 in mouse pancreatic islets and
beta cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 36
Figure 9 RNAi-mediated depletion of Syntaxin-3 impaired glucose stimulated insulin
secretion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 38
Figure 10 Stable Syntaxin-3 knockdown INS-1 clones established using lenti-shRNA ... ... 40
Figure 11 Diminished glucose stimulated insulin secretion in stable Syntaxin-3 knockdown
cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 41
Figure 12 Immunoblot analyses examining exocytotic protein expression ... ... ... ... ... ... 42
Figure 13 Syntaxin-3 depletion reduced the total sum of fusion events underlying biphasic
insulin secretion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 45
Figure 14 TIRFM of INS-1 cells expressing NPY-EGFP insulin vesicle cargo protein
differentiated between pre-docked and newcomer granule fusion modes ... ... ... 46
Figure 15 Syntaxin-3 depletion did not affect the vesicle density at the plasma membrane
prior to stimulation ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 47
viii
ix
Figure 16 Syntaxin-3 depletion reduced newcomer granule mobilization underlying
biphasic insulin secretion ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 48
Figure 17 Syntaxin-3 overexpression and transduction efficiency in mouse islets ... ... 51
Figure 18 Confocal microscopy of whole mouse islet core ... ... ... ... ... ... ... ... ... ... ... 52
Figure 19 Syntaxin-3 overexpression potentiates glucose stimulated insulin
secretion in mouse islets ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 53
Figure 20 Cellular insulin content of mouse islets ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 54
Figure 21 Overexpression of Syntaxin-3 (wild type) enhanced glucose stimulated insulin
secretion in INS-1 cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 56
Figure 22 Mislocalization of open-form Syntaxin-3 following overexpression in
INS-1 cells ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... 58
Chapter 1
Introduction
1.1 Exocytosis in Secretory Cells
Exocytosis is the process by which vesicles traffic towards the cell periphery and fuse
with the plasma membrane. The principle steps of exocytosis can be further broken down into
vesicle trafficking, tethering, docking, priming and fusion. Membrane traffic initiates with
vesicle budding from a precursor compartment and proceeds with mobilization of granules to
future release sites. Tethering and docking of vesicles then occurs in plasma membrane regions
that are enriched in clusters of exocytotic proteins. To become fusion competent, granules must
be primed through a number of reactions which are ATP, Ca2+ and temperature dependent. The
final exocytotic event utilizes a narrow fusion pore that connects the inside of the granule to the
extracellular environment. Upon vesicle fusion, soluble particles are released into the
extracellular fluid, while lipids and integral membrane proteins are incorporated into the plasma
membrane and displayed at the cell surface. Since the vesicle membrane fuses with the plasma
membrane of the cell, this mechanism also has a role in maintaining cell integrity by restoring
membrane lost during endocytosis.
1.1.1 Primary Exocytosis
Primary exocytosis is characterized by the fusion of the secretory granule and the plasma
membrane. In the classical view of exocytosis, vesicles fully collapse into the membrane and
1
these components are later retrieved through endocytosis. However, electron microscopy of
exocytotic events has shown that synaptic vesicles may not necessarily undergo complete fusion,
but can briefly interact with the membrane in a “kiss-and-run” manner (Fesce et al. 1994). Kiss-
and-run exocytosis, also termed “reversible” fusion, is characterized by the ability of the fusion
pore to rapidly open and close as long as a certain diameter is not exceeded (MacDonald et al.
2005). Kiss-and-run exocytosis is also a mechanism for differential release of insulin since the
withdrawal back into the cytosol prevents the complete discharge of granule contents. In
addition, the transient nature of reversible fusion occurs without adding components to the
plasma membrane, eliminating the need for subsequent membrane retrieval. In recent reports, it
has been shown that kiss-and-run exocytosis may be the more prevalent type of fusion event
accounting for up to ~75% of exocytotic events in islet beta cells, which although result in
incomplete or no emptying of insulin cargo, would provide effective release of other smaller
resident granule cargo such as nucleotides (Obermuller et al. 2005).
1.1.2 Granule-Granule Fusion Underlying Sequential and Compound Exocytosis
Secondary exocytosis occurs upon fusion of granules with other granules and this can be
further categorized into sequential and compound exocytosis. Compound exocytosis
encompasses the two distinct processes of sequential exocytosis and multigranular exocytosis
(Alvarez de Toledo, Fernandez 1990). In sequential exocytosis, vesicles fuse with other vesicles
that have already fused with the plasma membrane. This process has been observed in glucose
stimulated islet cells, which show the orderly fusion of oncoming secretory granules with
granules already fused with the plasma membrane (Kwan et al. 2007, Kwan, Gaisano 2005). For
2
simplicity, multigranular exocytosis is termed compound exocytosis as used in the context of this
report. Compound exocytosis occurs when multiple vesicles have already undergone fusion in
the cytosol before surfacing to and fusing with the plasma membrane. This phenomenon is also
termed homotypic fusion and may allow for the unloading of a greater amount of cargo
following fusion of the granule with the plasma membrane.
1.2 The Pancreatic Beta Cell as a Model of Exocytosis
The storage and release of insulin by islet beta cells plays an essential role in glucose
homeostasis, lipid and protein metabolism, brain function and cell survival. Remarkably, the
release of this hormone is not constitutive, but highly controlled as ~99% of insulin secretion
follows a regulated pathway (Rhodes, Halban 1987). The beta cell is electrically excitable and
couples changes in extracellular glucose levels to insulin exocytosis. As plasma glucose rises,
GLUT-2 receptors on the cell surface transport glucose across the plasma membrane and into the
cytosol. As glucose is metabolized and ATP levels increase, the rise in the ATP/ADP ratio
closes KATP channels, resulting in cell depolarization. In response, voltage-dependent calcium
channels open and the Ca2+ influx initiates the beginning of biphasic insulin exocytosis. As
insulin promotes glucose uptake by the target organs, plasma glucose falls, reversing this
pathway to end the secretory process. Thus, glucose homeostasis is under feedback control of
insulin via changes in beta cell metabolism, electrical activity and KATP channel closure (Figure
1).
3
Newly synthesized insulin is packaged into dense core vesicles and each beta cell
contains approximately 10 000 granules. The first phase of secretion is attributed to a readily-
releasable pool (RRP) of insulin granules located directly beneath the plasma membrane
(Rorsman, Renstrom 2003). These granules are secreted immediately as they are pre-docked and
primed for release. Ultrastructural studies have revealed that ~50-200 granules are docked at the
plasma membrane while another ~1500 granules are situated within 0.2µm from the cell surface
(Olofsson et al. 2002). The vast majority of insulin granules are located within storage pools in
the cytosol and second phase release constitutes the recruitment of these vesicles to refill the
RRP. This replenishment process has been reported to occur at a rate of 5-40 granules per cell
per minute (Olofsson et al. 2002). Since granule priming is necessary for release competency,
the second phase of secretion is the rate-limiting step of insulin exocytosis (Easom 2000).
4
Figure 1. Glucose stimulated insulin secretion by the pancreatic beta cell. Following the uptake of glucose into the pancreatic beta cell through GLUT-2 receptors, glucose is metabolized through glycolysis to increase intracellular ATP levels. The increased ATP/ADP ratio induces closing of KATP channels, leading to cell depolarization and subsequent calcium influx. Increased calcium concentrations lead to a series of intracellular signals which triggers the beta cell exocytotic machinery to secrete insulin. Adapted with permission from J Transl Med. 2007;5 (Copyright 2007 Ren et al; licensee BioMed Central Ltd.)
5
1.3 Physiology of Biphasic Insulin Secretion
Insulin release was first reported to secrete in a biphasic manner in 1968 (Curry, Bennett
& Grodsky 1968), and since then has been further characterized as a ‘storage-limited’ model of
exocytosis (Henquin et al. 2002). Under current concepts, biphasic insulin secretion corresponds
to the exocytosis of spatially or functionally distinct pools of granules as shown in Figure 2. The
first phase of insulin release develops rapidly and peaks within 5-10 minutes after stimulation.
However, this initial surge is relatively transient and shortly after, secretion decreases to a level
that is higher than basal release. Since the small pool of RRP granules is depleted within
minutes of stimulation, the first phase of insulin secretion also includes the recruitment and
release of newcomer insulin granules. Therefore, first phase secretion constitutes both the
secretion of pre-docked granules and the initiation of RRP replenishment.
While first phase release can be induced by KCl and glucose, the second phase of insulin
secretion occurs exclusively following stimulation by nutrients (Gembal, Gilon & Henquin
1992). Also in contrast to first phase, second phase release develops slowly, but can be sustained
over several hours during elevated glucose conditions (Curry, Bennett & Grodsky 1968). During
second phase secretion, insulin vesicles are recruited from the reserve pool of granules in the
cytosol to replenish the RRP near the plasma membrane. Upon arrival at the RRP, these
newcomer granules are primed and subsequently docked for exocytotic release. The second
phase response holds greater quantitative importance since only 1% of total insulin granules are
released during first phase secretion, allowing for the emptying of a greater amount of insulin
cargo (Ohara-Imaizumi et al. 2007).
6
Figure 2. Biphasic pattern of glucose stimulated insulin secretion in the pancreatic beta cell. The biphasic pattern of GSIS is attributed to the exocytosis of two pools of insulin granules. The release of the RRP (readily releasable pool) granules occur immediately following glucose stimulation and accounts for the transient first phase peak of GSIS. The second more sustained phase of secretion corresponds to the mobilization of insulin granules from the reserve pool to refill the RRP and priming of these granules to become fusion competent. Adapted with permission from J Transl Med. 2007;5 (Copyright 2007 Ren et al; licensee BioMed Central Ltd.)
7
1.4 The SNARE Family and SNARE Hypothesis
SNAREs are a superfamily of proteins that function in membrane fusion events of the
secretory pathway. SNARE proteins are receptors for SNAP (soluble NSF attachment protein)
and NSF (N-ethylmaleimide-sensitive factor), which are required for transport vesicle fusion in a
cell-free system (Sollner et al. 1993). Although variable in size and structure, these proteins
share a common 60-70 residue “SNARE motif” sequence containing heptad repeats (Ungar,
Hughson 2003). With the exception of synaptosomal associated protein SNAREs which contain
two motifs, the majority of SNARE proteins are anchored to the membrane at the C-terminal and
contain a single SNARE motif. Each SNARE motif is further classified under the structural
category of R-, Qa, Qb and Qc, and all functional SNARE complexes contain one of each type of
motif (Fasshauer et al. 1998). The Q/R classification of SNAREs refers to the conserved amino
acid residue at the zero layer of the SNARE four-helical bundle (see below). R-SNAREs
contribute an arginine (R) at this position and are usually vesicle-associated (v-SNAREs). Q-
SNAREs are target membrane-associated (t-SNAREs) and contribute a glutamine (Q) in the zero
ionic layer of the assembled SNARE complex. Q-SNAREs are further classified as Qa for the
Syntaxin subfamily, or Qb and Qc for the SNAP-25 N-terminal and C-terminal subfamily
respectively.
The conserved SNARE motif is essential for the formation of a four-helix bundle known
as the trans-SNARE complex or SNAREpin shown in Figure 3. The four-helix bundle is
composed of a combination of four SNARE motifs contributed by three or four different
SNAREs. The four helices interact across 16 layers and the middle of the bundle is defined as
8
the zero layer which dictates the Q/R classification of SNAREs mentioned above (Fasshauer et
al. 1998). The SNARE complex constitutes the core machinery required for each step of
membrane fusion and a specific set of four SNARE motifs corresponds to distinct exocytotic
events. SNAREs are proposed to catalyze membrane fusion in a process that involves the t-
SNARE helices and the v-SNARE helix interacting sequentially in layers to form the trans-
complex. During membrane fusion, the SNARE complex converts from “trans” to “cis” and the
SNARE motifs align in a manner resembling a molecular zipper. As the helices zipper up from
the N-termini towards the C-termini, the gap between the vesicle and plasma membrane closes.
This generates an inward force which drives fusion by pulling the bilayers together. The energy
released during this process is used to overcome the fusion barrier and after complete zippering
of the SNARE motifs, a lower energy stable cis-complex results (Hua, Scheller 2001).
The SNARE hypothesis proposes that SNARE proteins constitute the core machinery
essential for membrane fusion. Simply put, each membrane participating in fusion must contain
at least one anchored SNARE. Under the hypothesis, the interactions of distinct sets of v-
SNAREs and t-SNAREs regulate membrane fusion by ensuring vesicle specificity, targeting and
fusion (Sollner et al. 1993). Since only a small combination of SNAREs are fusogenic and
correspond to specific transport processes, SNAREs are considered one of the major components
dictating the specificity of membrane fusion. Interestingly, SNARE interactions in vitro have
shown considerable promiscuity during fusion events (Grote, Novick 1999, Bajohrs et al. 2005),
suggesting the existence of additional control mechanisms involved in exocytosis.
9
Figure 3. SNARE complex formation and the SNARE hypothesis. Vesicle associated SNAREs interact with target membrane associated SNAREs to assemble a four-helix SNARE complex essential to driving membrane fusion. Adapted by permission from Macmillan Publishers Ltd: Nature Reviews Molecular Cell Biology. 2001;2, 98-106. (Copyright 2001)
10
1.4.1 The Syntaxin Family
Syntaxins are a large mammalian family of t-SNARE proteins which are specialized for
regulating exocytosis. Syn-1 was first discovered in the plasma membrane of neurons and since
then, numerous isoforms have been found in a variety of cell types (Bennett et al. 1993). The
majority of Syntaxins are transmembrane anchored proteins and are localized on cell
compartments such as the ER, Golgi and endosomes (Teng, Wang & Tang 2001). Syntaxin is
anchored in lipid membranes at the hydrophobic C-terminal, while the N-terminal remains in the
cytosol. The SNARE motif is on the C-terminal and is highly conserved between all Syntaxin
proteins. Located at the N-terminal is an alpha-helical region, termed the Habc domain, which is
connected to the SNARE motif via a long flexible linker (or hinge) region. In its wild-type state,
Syntaxin can rapidly switch between an “open” or “closed” protein conformation (Margittai et al.
2003) as shown in Figure 4. When not bound in the SNARE complex, Syntaxin interacts
intramolecularly due to the folding of the Habc domain to mask the C-terminal SNARE motif. In
this conformation, Syntaxin cannot bind to other SNAREs and is considered “closed.” When
assembling into the SNARE complex, Syntaxin unfolds into the “open” conformation, exposing
the SNARE motif to participate in the four-helix bundle formation essential for fusion (Gerber et
al. 2008, Dulubova et al. 1999). Of the numerous syntaxin isoforms, Syn-1,-2,-3 and -4 are
implicated in regulating insulin exocytosis in pancreatic beta cells (Wheeler et al. 1996). While
the function of Syn-2 and -3 remain unclear, there has been considerable progress in defining the
roles of Syn-1 and -4 during insulin secretion.
11
Figure 4. Syntaxin protein conformation. Syntaxin can adopt an open conformation in which the SNARE motif is available to participate in SNARE complex formation which is essential for membrane fusion. However, when the Habc domain folds over to mask the SNARE motif, Syntaxin cannot bind to other SNAREs and is considered “closed.” Adapted with permission from Osborn and Jorgensen 2007, University of Utah.
12
1.4.2 Syntaxin-1 Regulation of Insulin Secretion in the Beta Cell
In the neuronal presynaptic membrane, Syntaxin-1 (Syn-1), SNAP-25 and vesicle-
associated membrane protein-2 (VAMP-2, synaptobrevin) form a SNARE complex which
functions in synaptic vesicle fusion (Rothman 2002). The crucial role of these exocytotic
proteins was revealed when synaptic vesicle fusion was impaired following SNARE targeted
proteolysis by neurotoxins (Boyd et al. 1995, Jahn, Niemann 1994). Since these SNAREs are
also expressed in the pancreatic beta cell, the trimeric complex was proposed to mediate the
secretion of insulin granules (Gerber, Sudhof 2002). Consistent with this hypothesis, ~400
aggregates of Syn-1/SNAP-25 complexes were seen in the mouse beta cell (Vikman et al. 2006),
which is remarkably similar to the number of docked granules reported in ultrastructural studies
(Olofsson et al. 2002). Perifusion of Syn-1A knockout mice islets showed a blunted first phase
secretion, supporting an essential role for Syn-1A in the docking and fusion of insulin granules in
the RRP of pancreatic beta cells (Ohara-Imaizumi et al. 2007).
Aside from regulating granule fusion during first phase release, Syn-1A interacts with
three important ion channels to mediate beta cell excitability and insulin exocytosis (Leung et al.
2003, Neshatian et al. 2007, Ahmed et al. 2007). Firstly, Syn-1A has been shown to regulate
KATP channel closure which triggers cell depolarization and subsequent insulin exocytosis (Cui et
al. 2004). By binding to the sulfonylurea receptor-1 (SUR1) regulatory component of the KATP
channel, Syn-1A effectively inhibits current activity (Pasyk et al. 2004). This was demonstrated
by an increase in KATP channel activity following botulinum toxin C1 mediated cleavage of Syn-
1A in HIT beta cells (Pasyk et al. 2004). It was also determined that the N-terminal H3 domain
13
mediated channel inhibition, revealing the functional importance of Syn-1A in open
conformation. Since KATP channel inhibition initiates the cascade of events which ultimately
culminates in secretion of insulin, Syn-1A regulation is crucial to beta cell exocytosis.
Another target of Syn-1A is Kv2.1, which is the major delayed rectifier K+ channel in
beta cell repolarization (MacDonald, Wheeler 2003). Syn-1A has been reported to inhibit Kv2.1
function by interacting with the C-terminus of the channel (Leung et al. 2003). Overexpression
of Syn-1A impaired trafficking of Kv2.1 channels to the plasma membrane and modified gating
properties by delaying channel activation (Leung et al. 2003). Structure-function studies also
showed Syn-1A and Kv2.1 binding inhibited channel activity and decreased the current
amplitude (Leung et al. 2003). Further investigation revealed Syn-1A also reduced Kv2.1
channel availability upon steady-state depolarization (Leung et al. 2005). Interestingly, both
closed and open form Syn-1A appears to inhibit channel function although the open
conformation is more potent in blocking current activity (Leung et al. 2005). This inhibition by
Syn-1A can significantly alter exocytosis as Kv2.1 blockage impairs repolarization which
subsequently enhances Ca2+ influx and sustains insulin secretion (MacDonald, Wheeler 2003).
Kv2.1 channels have also been shown to interact with Syn-1 bound to SNAP-25 (Tsuk et al.
2005). This interaction was suggested to stabilize the t-SNARE complex at the plasma
membrane and determine the rate of association between Syn-1/SNAP-25 and VAMP-2 on the
insulin granule. Since formation of the full SNARE complex resulted in complete dissociation
from the channel, Kv2.1 appears to stabilize the transition state of the t-SNARE complex prior to
fusion (Tsuk et al. 2008). In this context, it is likely that Syn-1/SNAP-25/Kv2.1 association acts
14
as a scaffold for the docking of insulin granules in preparation for SNARE complex assembly
and exocytotic fusion.
Lastly, Syn-1A interacts with L-type voltage dependent calcium channels (VDCC) which
control cellular Ca2+ levels during exocytosis in beta cells of rats, mice and humans (Sheng et al.
1996, Schulla et al. 2003, Yang, Berggren 2006). L-type VDCC is critical to both phases of
secretion since the Ca2+ influx triggers KATP channel dependent insulin exocytosis, while
intracellular Ca2+ signaling is required for RRP replenishment. Syn-1A has been shown to
regulate L-type VDCC by maintaining channel activity and preventing rundown (Yang et al.
1999). However, overexpression of Syn-1A also reduced L-type VDCC activity and exocytosis
in beta cells and insulinoma cell lines (Kang et al. 2002). Sensitivity to Syn-1A expression may
be linked to the assembly of SNARE complexes which occurs in the vicinity of L-type VDCC.
This provides advantages as SNARE complex formation in these calcium microdomains
simultaneously allows for a quick response and fast feedback in controlling the influx of Ca2+
(Leung et al. 2007).
1.4.3 Syntaxin-4 Regulation of Insulin Secretion in the Beta Cell
Syn-4 plays an important role in coupling pancreatic insulin secretion to the uptake of
glucose into skeletal muscle and adipose tissue (Hou, Pessin 2007). Together with SNAP-23 and
VAMP-2, Syn-4 regulates the translocation of GLUT-4 receptors to the plasma membrane of
adipocytes and muscle cells. Various reports have also demonstrated that Syn-4 is implicated in
15
insulin granule exocytosis. A study overexpressing Synip, a Syn-4 binding partner and
sequestration agent, led to impaired insulin release in beta-HC-9 cells (Saito et al. 2003).
Perifusion of Syn-4 (-/+) mice islets showed reduced biphasic glucose stimulated insulin
secretion (Spurlin, Thurmond 2006), while Syn-4 overexpression in mouse beta cells amplified
the first and second phase of release (Spurlin, Thurmond 2006). Syn-4 (-/+) mice were also
found to be insulin resistant and glucose intolerant 4-6 months after birth. However, islets
collected from these mice at the ages of 2-3 months demonstrated normal glucose tolerance
(Spurlin, Thurmond 2006). These data indicate that secretory defects may precede insulin
resistance and further support a positive role for Syn-4 in exocytotic release.
The precise mechanism by which Syn-4 mediates insulin exocytosis remains unclear.
Although Syn-4 association with VAMP-2 may be involved (Oh, Thurmond 2009), the
significance of this interaction still needs to be elucidated. Not surprisingly, the protein
conformation of Syn-4 may specify between a positive or negative effect on secretion. Recently,
it was reported that Syn-4 in closed conformation tethers F-actin to the plasma membrane and
prevents granule docking. The corresponding decrease in the number of docked granules
implicated closed form Syn-4 in the negative regulation of exocytosis. Further support for this
role was seen when glucose induced conversion of Syn-4 into open conformation disrupted
cytoskeleton binding, and subsequently enhanced insulin secretion (Jewell et al. 2008).
16
1.5 SNAREs in the Pathophysiology of Type-2 Diabetes
Impairments in biphasic secretion are an early indicator of beta cell dysfunction and
considered a major contributor to type-2 diabetes mellitus. Secretory defects from islets of type-
2 diabetic patients and rodent models are strongly correlated with reduced expression of SNARE
proteins Syn-1A, SNAP-25 and VAMP-2 (Chan et al. 1999, Ostenson et al. 2006). Remarkably,
when Syn-1A and SNAP-25 levels were restored with adenoviral delivery vectors, the secretory
deficiency was reversed (Nagamatsu et al. 1999). Decreased expression of exocytotic SNAREs
reduces the number of fusogenic SNARE complexes and consequently inhibits insulin release.
SNAREs also regulate various ion channels mediating insulin release and altered channel
function negatively impacts the secretory process. For example, changes in cellular Ca2+ influx
may affect the nature of fusion events as high calcium concentrations were reported to shift the
mechanism of secretion from kiss-and-run to complete fusion (Elhamdani, Azizi & Artalejo
2006). It is therefore speculated that the opposite effect may occur in diabetes, and the
likelihood of kiss-and-run fusion events is increased (Eliasson et al. 2008). Interestingly, a study
supporting this theory showed that rat islets exposed to 48 hours of high glucose conditions
exhibited a higher ratio of kiss-and-run events, while only 5% of exocytotic events proceeded to
full fusion (Tsuboi et al. 2006). This suggests that impaired insulin release may be related to
incomplete emptying of insulin cargo during exocytosis induced by elevated glucose levels.
Adding to the complexity of the disease, certain ion channel impairments may not exhibit as
strong of a correlation to secretory defects in diabetes. This was the case when glibenclamide, a
pharmacological KATP channel inhibitor, was used to stimulate insulin secretion in diabetic rat
islets. Following drug administration, secretion by diabetic islets was identical to the results of
17
glucose stimulated insulin release (Tsuboi et al. 2006). Thus, defects in the exocytotic
machinery may be severe enough to result in the manifestation of type-2 diabetes, independent of
KATP channel activity.
1.6 The SM Protein Family and Interactions with SNAREs
The Sec1/Munc18 (SM) proteins are a family of cytosolic proteins which have been
isolated in various species of mammals and yeast (Gallwitz, Jahn 2003). SM proteins were first
discovered when examining yeast and C. elegans mutants exhibiting impaired membrane
trafficking and secretion. Genetic deletion of specific SM proteins resulted in profound secretory
defects, further indicating the requirement of SM proteins in membrane fusion. SM proteins
function to regulate the assembly of the SNARE complex and interact with t-SNAREs through
association with other proteins. This association may be stronger than anticipated as deletion of
a SM protein also reduced the expression of its respective SNARE binding partner (Gallwitz,
Jahn 2003). The structure of SM proteins resembles a clasp and contains a central cleft that may
or may not interact with SNAREs. This results in multiple binding modes, which may account
for differential effects in regulating SNARE function. In the most common mode, a SNARE
protein binds to a small groove on the SM protein surface, forming a complex which functions in
trafficking steps involving endosomes, ER and Golgi network.
Numerous studies demonstrated the critical role of SM proteins in SNARE mediated
exocytosis such as impaired neurotransmitter release by neurons of Munc18-a knockout mice
18
(Verhage et al. 2000). Munc18-a (or Munc18-1), expressed primarily in neurons and
neuroendocrine cells, has been known to interact with Syn-1,-2 and -3. The binding mode
between Munc18-a and Syn-1, however, is the most unique and well characterized. During this
interaction, closed form Syn-1A is inserted into the central cleft of Munc18-a (Sudhof, Rothman
2009). This binding prevents unfolding of Syntaxin into open conformation and inactivates the
SNARE function of the protein. Although this led to initial suggestions of Munc18-a as a
negative regulator of membrane fusion, later studies revealed Munc18-a overexpression had no
observable effect on exocytosis (Gallwitz, Jahn 2003). It is therefore more likely that Munc18
binding functions to traffic SNAREs towards target membrane compartments to regulate
exocytosis (Arunachalam et al. 2008). In contrast to the aforementioned inhibitory effect of
Munc18, later theories proposed Munc18-a to promote exocytosis. Other hypothesis suggested
SM proteins may be involved in SNARE complex formation and proofreading by differentiating
between cognate and noncognate partners (Peng, Gallwitz 2002). There is in fact, substantial
evidence for these theories as Munc18-a was found to interact with binding partners that promote
assembly of SNARE complexes. Munc18-a also stabilized a half-closed conformation of
Syntaxin which participated in SNARE complex assembly (Zilly et al. 2006) and also activated
SNARE-mediated membrane fusion in a reconstituted liposome system (Shen et al. 2007). In the
latter case, Munc18-a was observed to associate directly with the assembled SNARE complex
(Dulubova et al. 2007).
Apart from Munc18-a, mammalian homologue Munc18-c (Munc18-3) has also been
implicated in regulating vesicle fusion at the plasma membrane. Munc18-c is expressed
ubiquitously and can bind to Syn-2 and -4 in islets and beta cell lines (Tellam et al. 1997).
19
Munc18-c was previously implicated as a negative regulator of Syn-4 following Munc18-c
overexpression which impaired GLUT-4 translocation. However, this defect was reversed if
cells were subsequently overexpressed with Syn-4 (Cheatham 2000). Later studies of Munc18-c
(-/+) mice islets revealed impairments in glucose stimulated insulin secretion (Oh et al. 2005)
that were selective to the second phase of release (Oh, Thurmond 2009). These Munc18-c
deficient mice were also more susceptible to type-2 diabetes, supporting a positive secretory
function for this SNARE isoform. Munc18-c appears to closely mediate Syn-4 accessibility to
VAMP-2, which has implications for granule docking at the plasma membrane after glucose
stimulation (Oh, Thurmond 2009).
Munc18-b (Munc18-2) can interact with Syn-1, -2 and -3 and is found abundantly in non-
neuronal cells (Hata, Sudhof 1995). This remaining SM protein isoform has been reported to
regulate trafficking and exocytosis in platelets (Schraw et al. 2003), mast cells (Tadokoro et al.
2007), and epithelial cells (Riento et al. 1998). Most recently, Munc18-b was also implicated in
promoting SNARE complex formation to facilitate vesicle docking and fusion in epithelial
secretion (Liu et al. 2007). In the pancreatic beta cell however, the function of Munc18-b during
insulin release remains to be fully elucidated. Since Munc18-b is upregulated in Munc18-a
knockdown PC12 cells (Arunachalam et al. 2008), Munc18-b may share redundant roles with
Munc18-a in the secretory process. It was also shown that Munc18-b binding to Syn-3 was
functionally important in the transport of vesicles in epithelial cells (Kauppi, Wohlfahrt &
Olkkonen 2002). It is thereby possible that Munc18-b interaction with Syn-3 may serve a
significant role in the exocytotic release of insulin in beta cells as well.
20
1.7 Cellular Functions of Syntaxin-3 in Various Tissues
The Syn-3 SNARE protein is ~33 kDa in size and can exist as isoforms Syn-3A, B, C,
and D following alternative gene splicing. Syn-3A is found exclusively in non-neuronal tissues
while Syn-3B is only expressed in the mouse retina (Curtis et al. 2008). Differential localization
of Syn-3 splice variants may contribute to distinct functions in various cell types. One major
role of Syn-3 is in the regulation of cellular growth and development. Syn-3 proteins are
enriched in cells undergoing rapid growth and differentiation (Martin-Martin et al. 1999, Bajohrs
et al. 2005), and are essential for the outgrowth of neurites (Darios, Davletov 2006). In addition,
Syn-3 has been identified as a target for mediating omega-3 and -6 fatty acid induced cell
membrane expansion (Darios, Davletov 2006). Most recently, omega-3 docosahexaenoice acids
were reported to promote Syn-3 pairing with SNAP-25, which regulates rhodopsin trafficking
and expansion of the ciliary membrane in rod photoreceptor cells (Mazelova et al. 2009).
Numerous studies have demonstrated the versatile role of Syn-3 in regulating the
secretory process of various cell types. In canine kidney cells, Syn-3 has been implicated in
apical membrane docking and fusion events involved in cargo trafficking following a raft based
mechanism (Lafont et al. 1999). In gastric glands, Syn-3 has been shown to regulate parietal
acid secretion in complex with Munc18-b and SNAP-25 (Ammar et al. 2002). In mouse retina
cells, Syn-3 mediates presynaptic transmitter release from conventional and ribbon synapses
(Curtis et al. 2008, Sherry et al. 2006). Interestingly, Syn-3 may also share functional
similarities with Syn-1 as demonstrated in SNARE overexpression studies. Elevated levels of
Syn-3 in insulinoma beta cell lines produced inhibitory effects on exocytosis, Ca2+ channels and
21
insulin biosynthesis that were similar to the results of overexpressed Syn-1 (Kang et al. 2002).
Therefore, the secretory role of Syn-3 may be equally as important as Syn-1, and a study recently
published suggests that Syn-3 functions as a core component of the minimal machinery required
to drive fusion between liposomes in mast cell exocytosis (Sakiyama et al. 2009).
1.8 Rationale and Hypothesis – Syntaxin-3 Recruitment of Newcomer Insulin Granules
during Biphasic Glucose Stimulated Insulin Secretion
Previous investigations have revealed a significant role for Syn-3 in the regulation of
exocytosis in pancreatic acinar cells. In acinar cells, zymogen granule exocytosis involves both
primary fusion at the plasma membrane and homotypic fusion within the cytoplasm (Edwardson,
An & Jahn 1997, Hansen, Antonin & Edwardson 1999, Wasle, Edwardson 2002). Syn-3 has
been localized primarily to the zymogen granule membrane, and therefore proposed to function
in secondary granule-granule fusion (Pickett et al. 2007). Since homotypic fusion of zymogen
granules accounts for 70% of total granule fusion events in the acinar cell (Nemoto et al. 2001),
the exocytotic role of Syn-3 is crucial in the secretory process in this exocrine pancreatic tissue.
We hypothesize an equally significant function for Syn-3 in the exocytotic pathway of
the endocrine pancreas, and specifically in islet beta cells. Preliminary data shows an abundance
of Syn-3 in mouse, rat and human beta cells, as well as in the rat INS-1 832/13 cell line. Since
Syn-1A and Syn-4 has been implicated in granule docking and release during first phase GSIS
(Ohara-Imaizumi et al. 2007, Spurlin, Thurmond 2006, Lam et al. 2005), we hypothesize that
22
Syn-3 has a functional role during second phase secretion. The recruitment and priming of
granules to new exocytotic sites on the plasma membrane during second phase GSIS is currently
undefined. However, the increased efficacy of second phase release is in part attributed to
recruitment and accelerated granule-granule fusions that underlie sequential and compound
exocytoses (Kwan, Gaisano 2005). We suggest the molecular machinery for granule-granule
fusions underlying the above exocytotic events involves Syn-3. Since Syn-3 is also the only
exocytotic syntaxin uniquely present on the secretory insulin vesicle (Wheeler et al. 1996), we
hypothesize Syn-3 participates in SNARE mediated fusion between granules.
Employing viral vectors and siRNA strategies, we overexpressed and depleted Syn-3 in
primary beta cells and insulinoma cells models. Using perifusion, secretion assays and imaging
techniques, we examined the effects of Syn-3 perturbation on glucose stimulated insulin
secretion. We also investigated functional differences between Syn-3 in open versus closed
protein conformation. We predict that altered expression of Syn-3 will translate to
corresponding changes in glucose stimulated insulin secretion. We aim to elucidate the roles of
Syn-3 in the primed release of secretory insulin vesicles during alternate exocytotic pathways of
recruitment and granule-granule fusion.
23
Chapter 2
Research Design and Methods
2.1 INS-1 (832/13) Cell Culture
The rat INS-1 (832/13) cell line was donated by Dr. Christopher Newgard (Duke
University Medical Centre, Durham NC). This particular model was chosen for study because
this cell line was characterized by robust KATP channel-dependent and independent glucose
insulin secretion (Hohmeier et al. 2000). INS-1 cells were cultured in RPMI 1640 Medium
(GIBCO) supplemented with 2mM L-glutamine, 10mM HEPES, 10% FBS, 100U/mL penicillin,
100ug/mL streptomycin, 1mM sodium pyruvate and 50µM β-mercaptoethanol at 37ºC in 5%
CO2.
2.2 Immunoblotting
Clonal cell lines or islets were transferred to ice and washed with cold PBS. Cells were
then resuspended with lysis buffer containing protease inhibitors (Roche Applied Science).
Samples were lysed upon sonication and after centrifuging yielded supernatants which were
retained and subjected to 15% SDS-PAGE. Separated proteins were transferred to PVDF
membranes and immunoblotted with anti-Syn1 (Sigma) or anti-Syn3 (SYSY) primary
antibodies, and peroxidase-labeled second antibodies. Protein bands were then visualized by
chemiluminescene (Pierce).
24
2.3 siRNA Transfection of INS-1 Cells
Two days prior to transfection, INS-1 cells were seeded in 12-well plates in RPMI 1640
culture medium supplemented with 2mM L-glutamine, 10mM HEPES, 1mM sodium pyruvate
and 50µM β-mercaptoethanol at 37ºC in 5% CO2. On the day of transfection, 0.2mL of OPTI-
MEM® I medium (Invitrogen) was mixed with 0.6µL of RNAi duplex (Dharmacon) solution
(20µM) in a microfuge tube. The siRNA pool targeting the rat Syntaxin-3 gene contained the
following nucleotide sequences:
5’-GAGAUUGAGGGUCGGCACA-3’, 5’-AAACGAGGCUCAACAUCGA-3’,
5’-CUGAAAUAAGAGUGGCCUA-3’ and 5’-GAAUCAGGGUGAGAUGUUA-3’.
The non-targeting pool (NTP) of siRNAs used in control cells contained the following nucleotide
sequences: 5’-UGGUUUACAUGUCGACUAA-‘3, 5’-UGGUUUACAUGUUGUGUGA-‘3,
5’-UGGUUUACAUGUUUUCUGA-‘3 and 5’-UGGUUUACAUGUUUUCCUA-‘3.
In another microfuge tube, 50µL of OPTI-MEM® I medium was combined with 2µL of
Lipofectamine® RNAiMAX (Invitrogen). The contents of the two microfuge tubes were mixed
together and incubated at room temperature for 10-20min. Approximately 0.84mL of this
mixture was then added to each well. Cells were then incubated for 48 hours before being
collected for static secretion assay or immunoblotting.
2.4 Static Insulin Secretion Assay
Adenoviral transduced INS-1 cells grown in 12-well plates in RPMI 1640 culture medium
were washed once with Krebs-Ringer bicarbonate (KRB) buffer and incubated in 1mL of KRB
solution for one hour. Buffer was aspirated and cells were incubated in 1mL of 0.8mM glucose
KRB solution for one hour. Fractions were then collected and 1mL of 10mM glucose KRB
25
solution was added to each well. After incubating for one hour, fractions were collected. INS-1
cells were then trypsinized and pelleted by centrifugation. Fractions of secreted insulin and
lysed cell samples were then quantified for insulin using a radioimmunoassay (RIA) kit (Linco
Research Inc.) according to manufacturer’s instructions.
2.5 Lentivirus Transduction and Establishment of New Stable Cell Lines
All lentiviruses used in this study were prepared by Dr. Shuzo Sugita’s laboratory
(University of Toronto). Two days before transduction, INS-1 cells were plated in 100mm
dishes and incubated in RPMI 1640 growth medium at 37ºC in 5% CO2. On the day of
transduction, INS-1 cells were transduced with equal volumes of lentivirus solution and RPMI
1640 medium. Cells were then incubated for 48 hours at 37ºC in 5% CO2. After 2 days,
medium containing lentiviruses was discarded and replaced with fresh culture medium. Cells
were then incubated in virus free medium for 48 hours at 37ºC in 5% CO2. Puromycin selection
was then used to isolate successfully transduced cells by adding 10mL of 1µg/mL puromycin
RPMI 1640 medium to each dish. Cells were then passaged and maintained in growth medium
containing puromycin for ~2 weeks in order to yield a stable cell line.
2.6 Total Internal Refraction Fluorescence Microscopy
TIRFM was performed by Dr. Dan Zhu from Dr. Herbert Gaisano’s laboratory (University
of Toronto). TIRF imaging uses an evanescent wave, which results from the reflection of
incident light at the boundary between two mediums of different refractive indexes (Figure 5).
Since the evanescent wave field only penetrates a depth of ~100nm from the cell plasma
membrane, TIRFM allows for the selective visualization of this region in high resolution. INS-1
26
cells were cultured in RPMI 1640 supplemented with 10% FBS at 37oC and 5% CO2. One day
after plating, cells were transfected with Syntaxin3-RNAi or NTP control using Lipofectamine®
RNAiMAX (Invitrogen). One day after transfection, INS-1 cells were infected with either
Syncollin-pHluorin or Adenovirus-NPY-EGFP. Syncollin-pHluorin consists of granule
membrane anchored protein, Syncollin, fused to a pH-sensitive form of EGFP in the vesicle
lumen. In the acidic environment of the granule lumen, Syncollin-pHluorin is non-fluorescent.
However, upon fusion of insulin vesicles with the plasma membrane during exocytosis, exposure
to the neutral extracellular environment causes EGFP to fluoresce. Therefore, each bright spot
on the cell represents the exocytosis of a secretory granule. By measuring the number and
fluorescence intensity of these bright spots on the plasma membrane, changes in exocytosis can
be elucidated (Figure 6).
Ad-NPY-EGFP, consisting of EGFP tagged Neuropeptide-Y, is a vesicle cargo protein
which was also used to visualize insulin granules located near the plasma membrane. Since
NPY-EGFP is not pH-sensitive, this fluorescent marker allowed for the differentiation between
the fusion of pre-docked vs. newcomer granules. Experiments were performed 48 h after
transfection at room temperature in a standard extracellular saline solution containing 138 mM
NaCl, 5.6mM KCl, 1.2mM CaCl2, 2.6mM MgCl2, 5mM glucose and 5 mM HEPES (pH 7.4). A
16.7mM high glucose solution used to stimulate the INS-1 cells was enhanced with 10nM GLP-1
and 150μM isobutylmethylxanthine (IBMX).
In the TIRF microscopy setup, a 488-nm beam was used to excite EGFP or pHluorin,
combined with a 488RDC long-pass dichroic filter and a 525/50-nm band-pass emission filter.
The red fluorescence was excited by a 543-nm beam combined with a 543-nm RDC dichroic
filter and a 600/75-nm band-pass emission filter cube (Chroma). Dual images of green and red
27
fluorescence were split by the Dual-View image splitter and recorded using the cooled 16-
bit EM-CCD camera (Cascade Quant-EM) at the right port of the microscope. The penetration
depth of the evanescent field (130 nm) was aligned by measuring the incidence angle of the 488-
nm laser beam with a prism (n = 1.5163). Images were acquired at 5-Hz with a 100-ms exposure
time by a Nikon NIS-Elements software. Insulin granule mobilities and exocytosis were
analyzed by Matlab (MathWorks), ImageJ (NIH), Igor Pro 5.01 (WaveMetrics) softwares.
28
Figure 5. Schematic drawing of the evanescent field by TIRFM. An evanescent wave arises on the cell-substrate interface and penetrates a very small distance into the cell, allowing for the behaviour of insulin granules near the plasma membrane to be tracked with precision. Note: n2 must have a lower refractive index than n1. (Figure from unknown source)
29
Figure 6. TIRFM of insulin granules labelled with Syncollin-pHluorin. Top: The Syncollin-pHluorin signal footprint of a cell undergoing exocytosis after K+-stimulation. Bottom: The corresponding fluorescence intensity change of the whole cell (background subtracted) shown. The grey lines indicate the images acquired at the corresponding time points.
30
2.7 Cell Preparation for Confocal Immunofluorescence Microscopy
One day before preparation for imaging, cells were seeded onto coverslips and incubated
overnight at 37ºC in 5% CO2. The following day, cells were washed with PBS and fixed with
3.7-4% paraformaldehyde for 15 min at room temperature. After fixing, cells were
permeabilized with 0.1% Triton X100 for 15 min at room temperature. Cells were then blocked
for non specific proteins with 10% goat serum solution for 1 hour at room temperature. After
washing with PBS, cells were immunostained with primary antibodies for 1-2 hours, followed by
secondary antibody incubation for 0.5-1 hour. Coverslips were then mounted onto microscope
slides with fluorescent mounting medium (DAKO).
2.8 Adenovirus Production and Purification
The EGFP, Syn-1A and Syn-3 adenoviruses used in this study were prepared by Yu He
from Dr. Herbert Gaisano’s laboratory (University of Toronto). The empty virus control was
donated by W. Hughes (Garvan Institute, Sydney, Australia). Recombinant Syn-1A and Syn-3
adenoviruses were prepared using the Gateway® pAD system (Invitrogen) and subjected to
plaque-purification and amplification. Constitutively open form mutants of Syn-1A and Syn-3
were generated through a double mutation in Leu-165 Ala and Glu-166 Ala in the wild
type protein (Dulubova et al. 1999) (Figure 7).
31
Syn-1A 1 MKDRTQELRTAKD-S-DDD-DDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRK Syn-3 1 MKDRLEQLK-AKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKL **** * ** *** * * * ****** ** * **** * *** * Syn-1A 58 HSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRK Syn-3 60 YSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDE-V-RSSADLRIRK * ** * * *** ** * *** ** ** **** * ** * ********** Syn-1A 118 TQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIF Syn-3 118 SQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIF *** ********* ** * * *** ************ ** **** ********** Syn-1A 178 ASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNV Syn-3 178 TSGII-DSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNV **** ** ********** ** * ** ** ******** ***** **** * ** ** Syn-1A 238 EHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVIL-GIIIASTIG Syn-3 237 MHTVDHVEKARDETKRAMKYQGQARKKLIIIIVIVVVLLGIL-ALIIG * ** ** * ** * *** ** * * ** * * ** * **
Figure 7. Rat Syntaxin-1A and Syntaxin-3 protein sequence alignment. Alignment of the amino acid sequences from rat (Rattus norvegicus) Syn-1A (M95734) and Syn-3 (L20820). Optimal alignment was produced with the ExPASy Proteomics SIM program. Conservation between Syn-1A and Syn-3 is indicated by the residues marked with asterisks. Highlighted residues indicate the mutation sites of wild-type Syntaxin to generate the open-form mutant. In both Syn-1A and Syn-3 open form mutants, Leu-165
Ala and Glu-166 Ala.
32
2.9 Adenoviral Transduction of INS-1 Cells
INS-1 cells were grown in 12-well plates in RPMI 1640 culture medium one day prior to
transduction. The next day, old medium was removed and replaced with 0.3mL of fresh medium
containing adenoviruses and incubated at 37ºC in 5% CO2 for 1.5 hour. Medium was then
discarded and replaced with fresh virus free RPMI 1640 medium. Cells were then incubated at
37ºC in 5% CO2 for 48 hours and subject to static insulin secretion assay, immunoblotting or
confocal microscopy.
2.10 Isolation of Mouse Pancreatic Islets and Beta Cells
Male C57BL/6 mice, 19-21 in bodyweight (Charles River Laboratories Inc.), were
sacrificed by cervical dislocation and the abdominal cavity was opened. Under a dissecting
microscope, the pancreatic duct was cannulated and 2mL of 2mg/mL collagenase (Sigma) was
injected into the common bile duct for pancreatic digestion. The pancreas was then excised and
incubated at 37ºC for 17min, followed by shaking to break apart tissue. The pancreatic samples
were then centrifuged at 1400rpm for 2 min at 4ºC, washed with Hanks’ balanced salt
solution/HEPES and filtered through a gauze. The islets were then handpicked under an upright
stereomicroscope and cultured in RPMI 1640 medium supplemented with 11mM D-glucose,
10% FBS, 100U/mL penicillin and 100µg/mL streptomycin at 37ºC in 5% CO2 overnight.
To further isolate single beta cells, islets were washed with PBS and centrifuged at
1000rpm for 4 min at room temperature. Islets were then trypsinized and incubated for 5 min at
37ºC in 5% CO2. Using a pipette, islets were then dispersed into individual cells and incubated
in 2.8mM glucose RPMI 1640 containing FBS at 37ºC in 5% CO2.
33
2.11 Adenoviral Transduction of Mouse Islets
Mouse islets were collected and placed in 35mm dishes containing 1mL of 11mM glucose
RPMI 1640 medium. Adenoviruses were then pipetted into dishes and incubated at 37ºC in 5%
CO2 for 1.5 hours. Medium was then removed and replaced with fresh 11mM glucose RPMI
1640 and incubated for 48 hours at 37ºC in 5% CO2 before perifusion or immunoblotting.
2.12 Mouse Islet Perifusion
Groups of 50 islets were placed in perifusion chambers and perifused at 37ºC with Krebs-
Ringer bicarbonate buffer (pH 7.4) supplemented with 10mM HEPES and 0.07% bovine serum
albumin at a flow rate of ~1mL/min. Islets were equilibrated for 30min in KRB buffer
containing 2.8mM glucose, followed by 10min of 2.8mM glucose stimulation and 40min of
16.7mM glucose stimulation. Eluted fractions were collected and quantified for insulin content
using a RIA kit (Linco Research Inc.) following manufacturer’s instructions. Islets were
retrieved following perifusion and pelleted by centrifugation and lysed using acid-ethanol
solution (0.2mM HCl in 75% ethanol). Islet lysates were quantified for total insulin content and
used to normalize secreted insulin values.
2.13 Statistics
All data are presented as the mean ± standard error of the mean (SEM) with the indicated
number of experiments. Statistical significance was evaluated by the Student’s t-test using
Microcal Origin 6.0. In TIRFM analysis, Mann-Whitney rank sum test was performed according
to the normality of datum distribution in SigmaStat 3.11 (Systat Software, Inc). A significant
difference is indicated by asterisks (*p < 0.05, **p < 0.01, ***p < 0.001).
34
Chapter 3
Results 3.1 Syntaxin-3 Expression in Pancreatic Islets and Colocalization with Insulin Granules
We first performed immunoblot analysis to confirm the abundant levels of Syn-3 in
mouse pancreatic islets as shown in Figure 8A. Next, we examined the subcellular localization
of endogenous Syn-3 in beta cells using confocal microscopy. After dispersion of islets into
single cells, one group of beta cells remained in regular culture medium, while a second group
was stimulated with glucose and GLP-1 for three minutes. Cells were then immediately fixed
and immunostained with antibodies against Syn-3 and insulin. Analysis of unstimulated beta cell
images showed Syn-3 to be more or less evenly dispersed and colocalized to insulin granules
near the plasma membrane (Figure 8C, top row). In stimulated conditions, Syn-3 was present in
higher concentration at the plasma membrane and this was seen as a more clearly defined cell
shape. Stimulated beta cells also had larger Syn-3 clusters in the cytosol and plasma membrane
area, many of which were colocalized to insulin granules (Figure 8C, bottom row). The Pearson
correlation coefficient for Syn-3 and insulin granules was calculated to be 0.79 ± 0.011 (n=19
cells) indicating a strong localization to insulin granules (Figure 8B). These clusters likely
correspond to the homotypic fusion of insulin granules that is characteristic of GLP-1 stimulated
secretion (Kwan, Gaisano 2005) and electron microscopy ultrastructural studies will be needed
to confirm this. Furthermore, the concentrated levels of Syn-3 at the plasma membrane
following stimulation also support the notion of essential Syn-3 trafficking to the target
membrane in order to facilitate insulin release.
35
A) B)
C)
Figure 8. Endogenous expression of Syntaxin-3 in mouse pancreatic islets and beta cells. (A) 2µg of rat brain lysate (as a positive control) and (20µg of protein) from pancreatic mouse islets were prepared for use in anti-Syn3 immunoblotting to examine endogenous Syn-3 expression. (B) Distribution of calculated Pearson coefficient values between Syn-3 and insulin granules in mouse beta cells (n=19). (C) Representative images of mouse beta cells captured with confocal immunofluorescence microscopy in unstimulated conditions (top row) and during glucose and GLP-1 stimulated secretion (bottom row). The left column displays images stained for Syn-3, the middle column displays images stained for insulin and the right column displays the merged images.
36
3.2 RNAi-mediated Depletion of Syntaxin-3 Impaired Glucose Stimulated Insulin Secretion
in INS-1 Cells
To examine the endogenous function of Syn-3 in secretion by INS-1 cells, we used RNA
interference (RNAi) to downregulate Syn-3 expression through post transcriptional gene
silencing. After entry into the cell, the RNA interference pathway begins when double stranded
RNA is cleaved by the Dicer enzyme into smaller fragments 21-23 nucleotides long (Ketting et
al. 2001). These small interfering RNA (siRNA) strands are incorporated into the RNA-induced
silencing complex (RISC) and interact with a complementary region of messenger RNA. RISC
cleaves the bound mRNA which then promotes the degradation of this mRNA segment by
exonucleases. As a result, target gene expression is effectively repressed (Dykxhoorn, Novina &
Sharp 2003). In our study, the introduction of siRNA against Syn-3 depleted protein levels by
~70% and did not affect Syn-2, VAMP-2 or VAMP-8 expression (Figure 9A i). Following
glucose stimulation in a static secretion assay, diminished Syn-3 expression evoked a ~50%
reduction in insulin release, compared to control cells treated with non-targeting siRNAs (Figure
9B). Syn-3 RNA silencing significantly impaired glucose stimulated insulin release (ratio of
GSIS to insulin content: 0.087 ± 0.003% for si-Con vs. 0.051 ± 0.004% for si-Syn3, p<0.01), but
had no effect on basal secretion (0.39 ± .022% for si-Con vs. 0.57 ± 0.22% for si-Syn3) or
cellular insulin content (1.12 ± 0.04% for si-Con vs. 1.10 ± 0.05% for si-Syn3, relative to
untransfected control). Taken together, these data show an important role for Syn-3 in
facilitating glucose stimulated insulin secretion.
37
B) Figure 9. RNAi-mediated depletion of Syntaxin-3 impaired glucose stimulated insulin secretion. (A) i) INS-1 cells were transduced with si-Con or si-Syn3 and prepared for use in anti-Syn3 immunoblotting to detect knockdown efficiency. INS-1 cell lysates were also prepared for use in immunoblotting to examine for changes in Syn-2, VAMP-2 and VAMP-8 protein expression. ii) Optical density scanning quantification was used to derive the band density for each si-Con band, which was used to normalize the si-Syn3 bands in each experiment following immunostaining for Syn-3. Data represent the average ±SE of three independent experiments; **p<0.01 (B) 24h following adenovirus infection, cells were pre-incubated in KRBH for one hour, followed by an hour of stimulation in 0.8mM and 10mM glucose conditions. Secreted insulin was measured by RIA. Data represent the average ±SE from three independent experiments; **p<0.01
38
3.3 Diminished Glucose Stimulated Insulin Secretion in Stable Syntaxin-3 Knockdown
Cells
We then established a stable Syn-3 knockdown cell line to investigate the effects of
persistent Syn-3 gene silencing. To repress Syn-3 expression, we used short hairpin RNA
(shRNA) to once again trigger the RNAi pathway. In this case, shRNA was favoured over
siRNA due to its characteristic stable expression in cells (Paddison et al. 2004). The pLKO-puro
vector system was used to stably express shRNA in INS-1, and select for infected cells with
puromycin antibiotic. pLKO is a HIV-1 based expression vector which contains the required
viral processing elements to effectively integrate into the host genome (Zufferey et al. 1997).
After incorporation into the nuclear DNA, the expression of shRNA is driven by the human U6
promoter (Paddison et al. 2004). Lentiviruses encoding a puromycin resistance gene and either
Syn-3 shRNA or EGFP, were used to infect INS-1 cells. This allowed us to generate Syn-3
knockdown clones and a control cell line. After fluorescent verification of transduction
efficiency (Figure 10A), puromycin resistant cells were selected for over a one month period.
Immunoblot analyses of remaining cells revealed knockdown to be heterogeneous as Syn-3
expression was reduced by ~50% (Figure 10B). This culminated to a significant (p<0.01) 40%
decrease in GSIS during a static insulin secretion assay comparing the glucose response between
Syn-3 KD and control groups (Figure 11). To examine whether Syn-3 depletion altered the
expression of other syntaxin isoforms and exocytotic proteins, Western blotting was performed
on the cell lysates of knockdown clones. Compared to the control cell line, we found decreased
expression of Syn-2 by ~34% and VAMP-2 by ~46% in Syn-3 KD cells, while the levels of
other exocytotic proteins remained unchanged (Figure 12).
39
A)
B) INS‐1 lysate
Figure 10. Stable Syntaxin-3 knockdown INS-1 clones established using lenti-shRNA. (A) Representative brightfield image and corresponding fluorescent signal from INS-1 cells after infection with lenti-pLKO-EGFP and puromycin selection of successfully transduced cells. (B) Lysates of INS-1 cells stably expressing EGFP (Control) and Syn-3 shRNA (Syn-3 KD) were prepared for use in anti-Syn3 immunoblotting to detect knockdown efficiency. Optical density scanning quantification was used to derive the band density for each Control band, which was used to normalize the Syn3 KD bands in each experiment. Data represent the average ±SE of three independent experiments; **p<0.01
40
Figure 11. Diminished glucose stimulated insulin secretion in stable Syntaxin-3 knockdown cells. The stable cell lines were pre-incubated in KRBH for one hour, followed by an hour of stimulation in 0.8mM and 10mM glucose conditions. Secreted insulin was measured by RIA. Data represent the average ±SE from three independent experiments; **p<0.01
41
A)
B) Syn‐2
C) VAMP‐2
Figure 12. Immunoblot analyses examining exocytotic protein expression. (A) Cell lysates containing 20µg of protein from control and Syn-3 KD INS-1 cells were immunostained for various exocytotic proteins, and changes in expression level between control and KD cells were compared. Samples of rat brain (2µg) and acinar cells (10µg) were used as positive and negative controls respectively. (B, C) Optical density scanning quantification was used to derive the band density for each Control band, which was used to normalize the Syn-3 KD bands following immunostaining for Syn-2 in (B) and VAMP-2 in (C). Data represent the average ±SE of three independent experiments; *p<0.05, **p<0.01
42
3.4 Syntaxin-3 Depletion Reduced Newcomer Granule Mobilization Underlying Biphasic Insulin Secretion To elucidate whether changes in granule dynamics contributed to the secretion deficits
seen in Syn-3 knockdown cells, total internal reflection fluorescence microscopy (TIRFM) was
performed on siRNA treated INS-1 groups. After labelling insulin vesicles with Syncollin-
pHluorin, TIRFM allowed us to selectively visualize the fusion of fluorescent granules at the
plasma membrane. Our results showed the accumulated fusion events in Syn-3 silenced cells
were significantly reduced during latter half of first phase release, and for the duration of second
phase secretion (Figure 13B). Compared to control, the average fusion rate of Syn-3 silenced
cells in both the first and second phase of secretion was decreased by ~40-45% (first phase: 15.6
± 2.42 per cell per 100 µm2 for control vs. 9.97 ± 1.27 per cell per 100 µm2 for Syn3-silenced
cells, p<0.05; second phase: 8.36 ± 1.38 per cell per 100 µm2 for control, and 4.09 ± 1.00 per cell
per 100 µm2 for Syn3-silenced cells, p<0.03) (Figure 13C). Lowered fusion rates in TIRFM
correspond to fewer fusion events at the plasma membrane. However, to elucidate whether
decreased secretion pertained to impaired fusion of pre-docked or newcomer granules,
experiments were repeated with insulin vesicle cargo marker, NPY-EGFP.
Insulin granules containing NPY-EGFP were observed as bright spots on the cell
membrane as shown in Figure 14. By measuring the intensity and duration of the fluorescent
signal emitted from these vesicles, we were able to differentiate between pre-docked vs.
newcomer granule fusion modes (Figure 14 i,ii,iii). After infecting INS-1 with Ad-NPY-EGFP
but prior to stimulation, we calculated the vesicle density of granules on the plasma membrane
and found no differences between control and Syn-3 depleted cells (0.105 ± 0.0058 vesicles per
µm2 for control vs. 0.103 ± 0.00678 vesicles per µm2 for Syn-3 KD) (Figure 15). Upon glucose
43
stimulation, the exocytosis of pre-docked granules was also comparable between both groups as
shown in Figure 16C (blue bars). This indicated that the number and fusion competency of
docked and primed vesicles at the plasma membrane was preserved, notwithstanding Syn-3
depletion. However, the exocytosis of newcomer granules, including those that were docked
briefly (green bars in Figure 16C) or not docked at all (red bars in Figure 16C), was significantly
decreased during both phases of secretion in Syn-3 KD cells. This reduction likely corresponds
to the decelerated recruitment of insulin granules to refill the RRP. The results of accumulated
fusion events in control vs. Syn-3 KD cells was consistent with earlier data obtained from
experiments with Syncollin-pHluorin, in which Syn-3 depletion effectively impaired biphasic
secretion (first phase: 13.0 ± 1.79 fusion events per 100 µm2 for control vs. 5.4 ± 1.01 fusion
events per 100 µm2 for Syn-3 KD, p<0.01; second phase: 11.1 ± 3.38 fusion events per 100 µm2
for control, and 4.53 ± 1.31 fusion events per 100 µm2 for Syn-3 KD, p<0.05) (Figure 16A,B).
Taken as a whole, our data suggests that Syn-3 depletion evoked a reduction in newcomer
granules and their subsequent exocytotic fusion, thereby impairing biphasic insulin secretion.
44
Figure 13. Syntaxin-3 depletion reduced the total sum of fusion events underlying biphasic insulin secretion. (A) Histogram of the number of fusion events (per 100 μm2) in control INS-1 cells (top; 10 cells) and Syn3-siRNA-silenced INS-1 cells (bottom; 10 cells) at 30s intervals. Time 0 indicates when 22 mM high glucose plus 10 nM GLP-1 and IBMX were added. (B) Time-lapse curves of accumulative fusion events per cell per μm2 display the difference between the control group and Syn3-siRNA-silenced group. (C) Comparison of the number of fusion events (per cell per 100 μm2) at 1st phase (0-5 minutes after stimulation) or 2nd phase (5-18 minutes), respectively; *p<0.05 for 1st phase, *p<0.03 for 2nd phase.
45
Figure 14. TIRFM of INS-1 cells expressing NPY-EGFP insulin vesicle cargo protein differentiated between pre-docked and newcomer granule fusion modes. Representative images of a control and Syn-3 KD INS-1 cell by TIRFM after 2-day co-transfection with Syn-3 siRNA and NPY-EGFP. Scale bar: 2mm. The sequential images and corresponding time-lapse fluorescence intensity curves indicate different fusion modes: (i) A fusion event from a pre-docked insulin granule. (ii) A fusion event of a newcomer granule which did not undergo a docking step on the plasma membrane before proceeding to exocytosis. (iii) A fusion event of a newcomer granule that underwent a short docking time (32 s in this case) on the plasma membrane before exocytosis.
46
Figure 15. Syntaxin-3 depletion did not affect the vesicle density at the plasma membrane prior to stimulation. TIRFM of control and Syn-3 KD INS-1 cells 2 days after infection with Ad-NPY-EGFP showed no significant differences in the mean granule densities at the plasma membrane prior to stimulation (n= 20 cells).
47
Figure 16. Syntaxin-3 depletion reduced newcomer granule mobilization underlying biphasic insulin secretion. Control and Syn-3 knockdown (KD) INS-1 cells were stimulated with 16.7 mM glucose plus 10 nM GLP-1 plus 150 mM IBMX and analyzed by TIRFM. (A) The normalized cumulative fusion events of insulin granules per cell from control cells and Syn-3 KD INS-1 cells. (B) Summary of fusion events from A) in the first phase (0 - 5 min) and second phase (5 - 20 min) secretion. ***p<0.001 for 1st phase, *p<0.05 for 2nd phase. (C) Analysis of docked vs. newcomer granule exocytosis during biphasic insulin secretion from control cells (left) and Syn-3 KD (right) INS-1 cells. Note: pre-docked granules (blue) exocytosis is similar between control and Syn-3 KD cells; no-dock (red) and short-dock (green) newcomer granules are reduced in Syn-3 KD in both first and second phases. (n=10 cells, 338 fusion events from control group; n=12 cells, 206 fusion events from Syn-3 KD group)
48
3.5 Syntaxin-3 Overexpression Potentiated Glucose Stimulated Insulin Secretion in Mouse
Islets
Our next aim was to determine how elevated Syn-3 levels would affect the insulin
secretion of glucose perifused mouse islets. However, before initiating the perifusion assay,
numerous measures were taken to test the transduction efficiency of our adenoviruses. First,
Western blotting with anti-Syn3 and anti-EGFP antibodies was performed to verify the
successful expression of viral delivered proteins in mouse islets (Figure 17A). Next, infected
islets were dispersed into single cells and the number of fluorescent cells were compared to the
total cell count, yielding a transduction efficiency of ~30% (Figure 17B,C,D). Lastly, confocal
imaging was used to generate z-slices through whole islets to show fluorescence in the islet
centre, confirming viral penetration to the islet core where the majority of beta cells are situated
(Brissova et al. 2005) (Figure 18).
Perifusion analyses of Ad-Syn3 transduced islets showed a dramatic increase in the first
and second phase of stimulated secretion, while constitutive basal insulin release remained
unchanged (Figure 19A). The characteristic biphasic secretion curve of Ad-Syn3 was amplified
in the peak and plateau area, representing enhanced secretion in the transient first phase and
sustained second phase of insulin release. Comparison of area under the curve during first phase
(6.57E-3 ± 7.51E-4 for Ad-Syn3 vs. 3.09E-3 ± 4.22E-4 for control, p<0.05, n=3-6) and second
phase (4.67E-3 ± 6.80E-4 for Ad-Syn3 vs. 2.15E-3 ± 1.22E-4 for control, p<0.05, n=3-6) further
revealed the marked potentiation of >75% in biphasic insulin release (Figure 19B). To examine
whether enhanced secretion was secondary to higher insulin content, islet groups were measured
49
for total insulin using RIA. Measured readings indicated no differences in cellular insulin
content between Ad-Syn3 transduced islets and the control group (25.14 ± 1.08 ng/islet for Ad-
Syn3 vs. 27.96 ± 3.80 ng/islet for control, n=3) (Figure 20). These results are consistent with our
data from knockdown studies, providing further evidence for the positive role of Syn-3 in
regulating biphasic insulin secretion.
50
A)
Figure 17. Syntaxin-3 overexpression and transduction efficiency in mouse islets. (A) One hour after isolation, mouse islets were infected with Ad-EGFP (control), Ad-EGFP-Syn3-WT. After 24h incubation, cell lysates were immunoblotted with anti-EGFP and anti-Syn3 to confirm the expression of viral delivered proteins at 62kDa and 27kDa and endogenous syntaxin levels at 35kDa. (B) Islets were dispersed into single cells 24h after infection and the number of fluorescent cells were counted under a microscope and compared to the total number of dispersed cells in order to determine transfection efficiency. Data represent the average ±SE of three independent experiments. (C) Representative image of whole islets infected with Ad-EGFP-Syn3 after an incubation period of 24h. (D) Representative image of single cells that were dispersed from islets 24h after infection.
51
A)
B)
Figure 18. Confocal microscopy of whole mouse islet core. (A) Representative image and (B) z-stack of EGFP signal detected in a mouse islet following adenoviral infection.
52
A) B)
Figure 19. Syntaxin-3 overexpression potentiates glucose stimulated insulin secretion in mouse islets. (A) Islets were isolated and handpicked into groups of 50 for adenovirus infection 1h after isolation. After 24h, islets were incubated for 8 minutes at low glucose (2.8mM), followed by basal sample collection (1-10min) at low glucose to establish a baseline. Glucose was then elevated to 16.7mM. Eluted fractions were collected at 1 min intervals and insulin secretion determined by RIA. Insulin concentration values were normalized to the total insulin content of 50 islets perifused in each group. Data shown are the average ±SE from five independent experiments. (B) The average ±SE of area under the curves (AUC) of normalized insulin release from perifusions in (A). Data represent insulin release from 11-26 min for first-phase secretion (FP-IS), 27-40 min for second-phase secretion (SP-IS) and 11-40min minus basal secretion (0-10 min) for total GSIS; *p<0.05
53
Figure 20. Cellular insulin content of mouse islets. Islets were isolated and handpicked into groups of 50 for adenovirus infection one hour after isolation. After 24h, total insulin content was measured by RIA. Data shown are the average ±SE from three independent experiments.
54
3.6 Overexpression of Syntaxin-3 (in Wild Type Conformation) Enhanced Glucose
Stimulated Insulin Secretion in INS-1 Cells
Since, the open conformation of Syn-1A was previously reported to enhance its
exocytotic actions by promoting SNARE complex formation (Sutton et al. 1998), we constructed
a Syn-3 open form mutant to examine for similar effects on insulin secretion. INS-1 cells were
infected with adenoviruses carrying EGFP tagged syntaxins, and the transduction efficiency was
verified using epifluorescent microscopy (Figure 21A). Successful Syn-3 open form (OF) and
wild type (WT) overexpression was then confirmed with Western blotting (Figure 21B), before
subjecting transduced INS-1 cells to a static secretion assay. Additional controls groups were
established with Ad-EGFP (negative control), and EGFP tagged Ad-Syn1A-OF and Ad-Syn1A-
WT (positive controls).
Following stimulation with glucose, we found that secretion by Ad-Syn-1A cells was
consistent with previous reports in which OF Syn-1A enhanced insulin release (by 63%), while
the wild-type protein had no effect. In contrast, cells overexpressing Syn-3 WT exhibited a 47%
increase in secretion (0.10 ± 0.002 for Syn3 WT vs. 0.07 ± 0.01 for control, normalized to total
insulin content, p<0.05, n=3), while potentiation by exogenous Syn-3 OF was statistically
insignificant. Basal secretion between all groups remained unchanged (Figure 21C). These
results demonstrate how syntaxin conformation may produce differential effects specific to each
isoform. Furthermore, although elevated levels of Syn-3 had enhanced insulin release, our data
revealed the sensitivity of GSIS as exogenous open-form Syn-3 was unable to potentiate
secretion to the same extent as wild-type Syn-3.
55
Figure 21. Overexpression of Syntaxin-3 (wild type) enhanced glucose stimulated insulin secretion in INS-1 cells (A) INS-1 cells were infected with Ad-EGFP (control), and wild-type and open form Ad-EGFP-Syn3 and Ad-EGFP-Syn1. After 24h incubation, cell lysates were immunostained with anti-Syn3 and anti-Syn1 to detect the overexpression of viral delivered proteins at 62kDa. (B) Representative image of epifluorescent signal detected in INS-1 cells treated with Ad-EGFP 24h after infection. (C) After 24h incubation following infection by adenoviruses, INS-1 cells were preincubated with 0.8mM glucose followed by stimulation with 10mM glucose. Secreted insulin was measured by RIA. Data represent the average ±SE of three independent experiments with n = 4 for each group; *p<0.05
56
3.7 Mislocalization of Open-Form Syntaxin-3 Following Overexpression in INS-1 Cells
We hypothesized that perhaps exogenous open form Syn-3 had no effect on secretion due
to mislocalization, and employed confocal immunofluorescence microscopy to test our theory.
After infecting INS-1 cells with EGFP tagged adenoviruses used in our overexpression studies,
we stained with anti-insulin antibodies to allow visualization of the secretory granules. Confocal
imaging results showed an abundance of wild type Syn-3 in punctuate pattern along the plasma
membrane that was mostly colocalized with insulin granules. In contrast, open form Syn-3 was
less prevalent on the plasma membrane and more densely clustered in the cytosol and perinuclear
region of the cell. The degree of colocalization between insulin granules and open form Syn-3
mutants was also lower compared to wild-type Syn-3 (Figure 22A). Additional images of
overexpressed Syn-1A were captured to show the high concentration of Syn-1A clearly
delineating the plasma membrane (Figure 22B), which can be contrasted to the more punctuated
plasma membrane clusters of Syn-3. Open form Syn-1A, unlike open form Syn-3, was correctly
targeted to the plasma membrane, although some excess open form Syn-1A became localized to
the insulin granules more so than overexpressed Syn-1A WT. Taken together, our data supports
our hypothesis in which mislocalized Syn-3 OF prevented the mutant proteins from acting on
target membranes to effectively enhance insulin secretion following exogenous overexpression
in INS-1 cells. Nonetheless, the correctly localized overexpressed Syn-3 WT to insulin granules
was able to potentiate Syn-3 actions on exocytosis.
57
A)
B)
Figure 22. Mislocalization of open-form Syntaxin-3 following overexpression in INS-1 cells. Representative images of INS-1 cells captured with confocal immunofluorescence microscopy following infection with Ad-Syn-3WT and OF and Ad-Syn-1WT and OF. The left column displays images stained for Syn-3 in (A) and Syn-1 in (B). The middle column displays images stained for insulin and the right column displays the merged images.
58
Chapter 4
Discussion
4.1 Syntaxin-3 Facilitates Exocytosis of Newcomer Granules during Biphasic Glucose
Stimulated Insulin Secretion
In our investigation, overexpression of Syn-3 potentiated GSIS in INS-1 cells while
reduced endogenous Syn-3 impaired secretion, demonstrating a novel role for Syn-3 in positively
regulating glucose stimulated insulin secretion. We found that increasing wild-type Syn-3
enhanced GSIS to a level comparable to that achieved by Syn-1A overexpression. These results
are consistent with our previous report in which Syn-3 mimicked the actions of Syn-1A on L-
type calcium channels, insulin biosynthesis and exocytosis in HIT cells (Kang et al. 2002).
These parallel effects may be due to analogous structure function properties shared between Syn-
3 and Syn1A, such as conserved coiled coil domains and a 64% amino acid homology (Bennett
et al. 1993). In addition, both Syn-3 and Syn-1A can bind to SNAP-25 and VAMP-2 to form a
trimeric SNARE complex (Calakos et al. 1994, Fasshauer et al. 1999), likely contributing to their
shared role in facilitating GSIS. The mechanisms by which each isoform enhances secretion,
however, may differ considerably, as further investigation with perifusion and TIRFM revealed
separate, non-redundant roles for Syn-3 and Syn-1A pertaining to specific components of
biphasic secretion.
In contrast to Syn-1A which acts specifically on first phase GSIS (Ohara-Imaizumi et al.
2007), our data supports a role for Syn-3 in facilitating both phases of secretion. Although
59
previous studies revealed impaired release of docked and primed insulin vesicles by Syn-1A
depletion, the inhibitory effect was not seen on newcomer granules (Ohara-Imaizumi et al.
2007). Thus, Syn-1A is an unlikely regulator of newcomer granule exocytosis, opening up the
possibility of Syn-3 as the candidate syntaxin in assuming this mechanistic role. Consistent with
this theory, TIRFM of Syn-3 depleted INS-1 showed no change in the number of previously
docked granules, or in the fusion competency of these primed vesicles. This suggests that Syn-3
does not mediate the docking and release of RRP granules underlying first phase GSIS.
However, the exocytosis of newcomer granules recruited from the reserve pool located deeper in
the cytosol also contributes to first phase. These newcomer granules approach the plasma
membrane and are immediately released upon stimulation with minimal docking time (Shibasaki
et al. 2007). We show that Syn-3 regulates these latter events of first phase GSIS as Syn-3
depletion impaired newcomer granule recruitment and fusion in INS-1 cells. Since mobilization
of granules to refill the RRP underlies the entire second phase of GSIS, reduced Syn-3 also
inhibited the sustained release of insulin. Taken together, our data support a role for Syn-3 in
biphasic insulin secretion by accelerating the recruitment of newcomer granules during RRP
replenishment.
In addition to mobilizing newcomer granules, we propose a function for Syn-3 in
regulating the compound exocytosis of insulin vesicles. Syn-3 is the only syntaxin isoform
localized abundantly to insulin granules, reflecting its potential for mediating granule-granule
fusion. If homotypic fusion of insulin granules resembles the process observed in yeast vacuoles
or mammalian endosomes (Hong 2005), it likely involves membrane-anchored SNARE
isoforms. In accordance with the SNARE hypothesis of membrane fusion, Syn-3 must partner
60
with cognate SNAREs to facilitate compound exocytosis. However, it remains uncertain which
isoform of VAMP and SNAP are members of the Syn-3 associated SNARE complex driving
granule-granule fusion in the pancreatic beta cell. Since SNAP-25 redistributes from the plasma
membrane to granule membranes during sequential exocytosis (Takahashi et al. 2004), it likely
participates in the homotypic fusion of vesicles. Based on data from our current study, we
suggest VAMP-2 as the remaining member of the trimeric SNARE complex formation between
insulin granules. VAMP-2 expression was downregulated following Syn-3 knockdown,
indicating a close association between the two SNAREs. Our hypothesis of VAMP-2 as the
cognate partner of Syn-3 could possibly account for the secretion deficits observed in Syn-3 KD
cells. Decreased availability of Syn-3 and VAMP-2 would reduce active Syn-3/SNAP-
25/VAMP-2 complexes, consequently impairing granule-granule fusion and GSIS on a whole.
Aside from decreased VAMP-2, the expression of Syn-2 was also significantly reduced
following knockdown of Syn-3 in INS-1 cells. Presently, the exocytotic role of Syn-2 in the beta
cell remains to be elucidated. Decreased Syn-2 may have contributed to blunted GSIS, but the
mechanism underlying this effect is unknown. Preliminary data from perifusion, IPGTT,
capacitance, and TIRFM studies (Zhu, D., Xie L., Hansen J.B., Gaisano, H.Y., unpublished
observations) suggest an inhibitory role for Syn-2 in secretion. In addition, confocal microscopy
revealed Syn-2 localization to insulin granules upon stimulation with glucose and GLP-1
(unpublished data). These results indicate a potential role for Syn-2 in negatively regulating
granule-granule fusion during compound exocytosis. In accordance with these data, it is
therefore plausible that Syn-2 expression may have been downregulated to compensate for the
impaired secretion of Syn-3 KD cells.
61
Concurrent changes in Syn-2 and -3 are not unusual, and have recently been observed in
Munc18-a/-b double knockdown PC12 cells (Han et al. 2009). These KD cells showed reduced
Syn-2 and -3 levels, suggesting critical roles for Munc18-a and -b in supporting the expression of
both syntaxin isoforms. Of the SM proteins, we believe Munc-18b is the strongest candidate for
regulating the exocytotic role of Syn-3 during GSIS. Munc18-b binds to Syn-3 with the highest
affinity (compared to Syn-1, -2 and -4) (Liu et al. 2007), and has a Syn-3 specific binding site at
the C-terminal end (Liu et al. 2007). This interaction has demonstrated importance in promoting
Syn-3/SNAP-25 formation to allow for fusogenic SNARE complex assembly during epithelial
secretion (Liu et al. 2007). Furthermore, since Munc18-b association with Syn-3 is known to
regulate plasma-granule and granule-granule fusion in mast cells (Tadokoro et al. 2007), we
believe this interaction has similar significance in the pancreatic beta cell. In fact, unpublished
data from Dr. Gaisano’s laboratory demonstrated many of the above postulated actions for
Munc18-b and its interactions with Syn-3 in islet beta cell insulin granule-granule fusion.
Although the mechanism by which Munc18-b regulates Syn-3 in GSIS is undefined, we
suggest Munc18-b may serve as a chaperone to Syn-3 through the secretory pathway, similar to
Munc18-a trafficking of Syn-1 (Arunachalam et al. 2008, Han et al. 2009). With only minor
differences between the Syn-3/Munc18-b complex compared to the Syn-1/Munc18-a complex
(Kauppi, Wohlfahrt & Olkkonen 2002), the coupling of each Syn/Munc18 pair likely involves
similar molecular interactions. Presuming that Syn-3/Munc18-b binding activity is specified by
the conformation of Syn-3, these binding modes would probably resemble those of Syn-
1/Munc18-a interaction. Munc-18a is known to bind Syn-1 in the closed conformation
(Dulubova et al. 1999), which is essential for trafficking Syn-1 through the ER and Golgi
62
complex (Medine et al. 2007). In the same way, it is plausible that Munc18-b may selectively
bind to the closed conformation of Syn-3 in order to traffic to the target membrane. In our study,
open form Syn-3 was mislocalized mainly in a non-insulin granule compartment in the
perinuclear region (likely the Golgi), and less prominent on insulin granules and the plasma
membrane compared to wild-type Syn-3. We suggest Syn-3 open form mutants could not
properly bind Munc18-b, and as a result would not traffic out of this cytoplasmic compartment.
Unable to reach the target site to facilitate membrane fusion, mislocalized Syn-3 mutants would
fail to enhance secretion. This is in fact, consistent with our findings as open form Syn-3 had no
significant effect on GSIS, despite its overexpression in INS-1 cells.
There are likely other proteins that modulate the assembly (or disassembly) of the Syn-3
SNARE complex to carry out its action in exocytosis. For example, Syn-3 function may involve
complexins, grappling proteins which interact with SNARE complexes to regulate GSIS in
pancreatic beta cells (Abderrahmani et al. 2004). Complexin II has been shown to bind isolated
Syn-3 (Tadokoro, Nakanishi & Hirashima 2010), and the Syn-3/SNAP-25/VAMP-2 complex
(Pabst et al. 2000, Pabst et al. 2002). Although complexins have conflicting roles on SNARE-
mediated fusion in neurons, sperm cells and mast cells (Tokumaru 2001, Roggero et al. 2007,
Tadokoro 2005), altered expression of complexin in pancreatic beta cells produced a common
inhibitory effect on vesicle fusion (Abderrahmani et al. 2004). As facilitators of exocytosis,
complexins interact with SNARE complexes in a 1:1 ratio (Chen et al. 2002) to stabilize its
highly fusogenic state immediately before release (Reim et al. 2001, Xue et al. 2007). From our
data, we suggest that decreased Syn-3 and VAMP-2 expression in our KD cells may have led to
corresponding reductions in Syn-3/SNAP-25/VAMP-2 complexes available to bind complexins.
63
This imbalance may have perturbed the expression and activity of complexins, and based on
previous reports, is predicted to inhibit GSIS in pancreatic beta cells.
4.2 Experimental Limitations
Although Syn-3 overexpression in HIT cells has been reported to inhibit insulin secretion
(Kang et al. 2002), we believe the effects of syntaxin upregulation often depend on the beta cell
line chosen for study. Such is the case with Syn-1A, as overexpression decreased insulin
biosynthesis and content in HIT cells (Kang et al. 2002) and a Syn-1A overexpressing mouse
(Lam et al. 2005), but increased insulin content in the βTC3 cell line (Nagamatsu et al. 1996).
These differences indicate the complexity of syntaxin regulation on GSIS and demonstrate how
various aspects of the insulin secretory process may be altered. These effects include changes to
the SNARE exocytotic machinery, ion channel activity and insulin gene transcription and
biosynthesis. Certain effects may be more pronounced in particular beta cell lines, accounting
for the observed discrepancies in overexpression studies. It is therefore important to conduct
similar experiments on primary cells to supplement data obtained from cell lines. By
overexpressing Syn-3 in mouse islets and observing enhanced secretion, we confirmed that Syn-
3 potentiation of GSIS is not limited to only the INS-1 cell line. Conversely, we performed
siRNA experiments (acutely and stable knockdown) on INS-1 cells to reduce insulin secretion,
and will have to confirm these results in lenti-shRNA knockdown of Syn-3 in pancreatic islets,
the latter to examine reduction in biphasic insulin secretion,
64
We acknowledge another limitation to our study is in the heterogeneity of the Syn-3 KD
cell line which may have concealed possible changes in the expression of other exocytotic
proteins. Despite anticipated reductions in Munc18 proteins known to interact with Syn-3, no
differences were observed in KD versus control. Given the strength of evidence showing the
closely linked expression of syntaxin and SM proteins (Verhage et al. 2000, Lam et al. 2005,
Voets et al. 2001, Toonen et al. 2005), modest reductions in Munc18 were likely masked by the
presence of incomplete knockdown cells. For a more accurate assessment of protein expression
after Syn-3 knockdown, a pure cell line should be isolated through colony selection and then re-
examined for potential compensation effects. A clean Syn-3 KD model characterized by
pronounced secretion deficits would confirm the critical function of Syn-3 during GSIS, and also
reveal any changes to protein expression that may have been previously overshadowed.
4.3 Future Directions
The sensitivity of GSIS to syntaxin expression has been widely acknowledged in Syn-1A
overexpression and knockdown studies performed in islets and insulinoma cell lines (Nagamatsu
et al. 1999, Lam et al. 2005, Nagamatsu et al. 1996). Interestingly, both forms of Syn-1A
perturbation produced severe deficits in GSIS, suggesting syntaxin regulated fusion may follow a
bell shaped curve function. Overexpressed Syn-1A may form incomplete SNARE complexes
that may inhibit or compete with fusogenic SNARE complexes, or excess Syn-1A may directly
affect ion channels that participate in inhibiting the secretory process (Leung et al. 2007).
According to this theory, optimal secretion would be achieved within a specified range of
65
syntaxin expression that orchestrates the exocytotic and ion channel events (Leung et al. 2007).
Fluctuations in endogenous syntaxin levels are proposed to inhibit ion channel activity and
exocytotic machinery, thereby impairing secretion. While Syn-3 is less likely to have such
diverse influence in the different components of the insulin secretory process, it remains a
possibility, particularly with calcium channels (see below). To determine whether this principle
is applicable to Syn-3, we should measure the dose dependent effects of Syn-3 on GSIS and ion
channel activities. The obtained dose-response curve would then elucidate the sensitivity of Syn-
3 expression on these secretory components and further support their essential role in
contributing to GSIS in pancreatic beta cells.
While we have established a function for Syn-3 in the recruitment of newcomer granules,
the molecular interactions underlying this process remain uncertain. To more clearly examine
Syn-3 mediated granule dynamics, we can use electron microscopy to provide details on granule
size and number during conditions of elevated or depleted Syn-3 expression. In addition, our
finding that Syn-3 acts specifically on newcomer granules can be strengthened with
electrophysiological studies. Single beta cell exocytosis can be analyzed with membrane
capacitance measurements using a series of depolarizations to stimulate secretion. A series of
pulses sequentially triggers the release of primed RRP vesicles, followed by the exocytosis of
newcomer granules. We anticipate altered Syn-3 expression to amplify or attenuate capacitance
increases triggered by the later pulses. This would correspond to changes in the fusion of
newcomer granules and complement our findings from this study.
66
We have previously reported Syn-3 to influence L-type Ca2+ channel activity (Kang et al.
2002), and this effect is worth re-examining in INS-1 cells. Using patch clamp techniques we
can measure changes in calcium current following perturbation of Syn-3 expression. Since Syn-
3 regulates biphasic GSIS, we aim to examine the activity of L-type Ca2+ channels, known to
trigger first phase release, and R-type Ca2+ channels which control the Ca2+ influx required for
RRP replenishment during second phase GSIS (Schulla et al. 2003, Jing et al. 2005).
Interestingly, recent research has proposed newcomer insulin granules to exhibit higher calcium
sensitivity compared to the RRP (Pedersen, Sherman 2009). According to their theory, this
highly Ca2+ -sensitive pool of granules (HSCP) responds to cytosolic calcium concentrations
mediated by R-type Ca2+ channels. Therefore, if we confirm an influential role of Syn-3 on R-
type Ca2+ channels activity, it would suggest that Syn-3 regulation of newcomer granule
exocytosis involves changes to the release rate of the HSCP.
Our final goal for future experiments is to characterize the protein interactions of open
form and wild type Syn-3. By performing pull-down assays, we can show how Syn-3
conformation may dictate its binding activity with other regulators of exocytosis. Proteins found
consistently bound to Syn-3 imply these interactions may be important for mediating the role of
Syn-3 during GSIS. We can also quantify binding affinity in order to determine whether
exocytotic proteins, such as Munc18 and complexin, selectively interact with Syn-3 in a specific
conformation. More comprehensive data on Syn-3 binding modes can supplement our current
findings and provide insight into the differential effects of wild type versus open form Syn-3 on
GSIS.
67
4.4 Physiological Relevance of Syntaxin-3 Function in Glucose Stimulated Insulin Secretion
Glucose stimulated insulin secretion in pancreatic beta cells was completely abolished
following neurotoxin mediated cleavage of VAMP-2 (Regazzi et al. 1995). However, when
similar conditions produced a loss of Syn-1 function, insulin release was impaired by only 25%
(Yang et al. 1999, Land et al. 1997). These results revealed that VAMP-2 was indispensable to
secretion, while Syn-1 appeared to regulate GSIS alongside other syntaxin isoforms. This is in
fact, demonstrated by our study which found Syn-3 to facilitate exocytosis of newcomer granules
during biphasic GSIS. Prior to this report, the exocytotic role of Syn-3 in the pancreatic beta cell
was undetermined. By confirming a function for Syn-3 in biphasic GSIS, we have shown that
both phases of secretion are regulated by multiple syntaxin isoforms. Syn-3 supports first phase
secretion alongside Syn-1, but acts specifically on RRP replenishment which is differentiated
from Syn-1 control of docked granules (Ohara-Imaizumi et al. 2007). Syn-3 regulation of
second phase GSIS is also significant as previously Syn-4 was the only syntaxin implicated in
this phase (Spurlin, Thurmond 2006).
The presence of numerous syntaxin isoforms in the beta cell may function to dictate the
compartmental specificity of insulin granule exocytosis. Pairing of VAMP-2 with distinct
syntaxin isoforms is proposed to differentiate between granule-granule vs. PM-granule fusion
events. Furthermore, the ability of Syn-3 to influence calcium channel activity may reveal a
mechanism which specifies the exocytosis of newcomer granules as opposed to those residing in
the RRP. By elucidating the role of Syn-3 in vesicle targeting and release, we can gain a more
68
detailed understanding of the granule dynamics underlying sequential vs. compound exocytosis
during glucose stimulated insulin secretion.
69
References
Abderrahmani, A., Niederhauser, G., Plaisance, V., Roehrich, M.E., Lenain, V., Coppola, T., Regazzi, R. & Waeber, G. 2004, "Complexin I regulates glucose-induced secretion in pancreatic beta-cells", Journal of cell science, vol. 117, no. Pt 11, pp. 2239-2247.
Ahmed, I., Cosen-Binker, L.I., Leung, Y.M., Gaisano, H.Y. & Diamant, N.E. 2007, "Modulation of the K(v)4.3 channel by syntaxin 1A", Biochemical and biophysical research communications, vol. 358, no. 3, pp. 789-795.
Alvarez de Toledo, G. & Fernandez, J.M. 1990, "Compound versus multigranular exocytosis in peritoneal mast cells", The Journal of general physiology, vol. 95, no. 3, pp. 397-409.
Ammar, D.A., Zhou, R., Forte, J.G. & Yao, X. 2002, "Syntaxin 3 is required for cAMP-induced acid secretion: streptolysin O-permeabilized gastric gland model", American journal of physiology.Gastrointestinal and liver physiology, vol. 282, no. 1, pp. G23-33.
Arunachalam, L., Han, L., Tassew, N.G., He, Y., Wang, L., Xie, L., Fujita, Y., Kwan, E., Davletov, B., Monnier, P.P., Gaisano, H.Y. & Sugita, S. 2008, "Munc18-1 is critical for plasma membrane localization of syntaxin1 but not of SNAP-25 in PC12 cells", Molecular biology of the cell, vol. 19, no. 2, pp. 722-734.
Bajohrs, M., Darios, F., Peak-Chew, S.Y. & Davletov, B. 2005, "Promiscuous interaction of SNAP-25 with all plasma membrane syntaxins in a neuroendocrine cell", The Biochemical journal, vol. 392, no. Pt 2, pp. 283-289.
Bennett, M.K., Garcia-Arraras, J.E., Elferink, L.A., Peterson, K., Fleming, A.M., Hazuka, C.D. & Scheller, R.H. 1993, "The syntaxin family of vesicular transport receptors", Cell, vol. 74, no. 5, pp. 863-873.
Boyd, R.S., Duggan, M.J., Shone, C.C. & Foster, K.A. 1995, "The effect of botulinum neurotoxins on the release of insulin from the insulinoma cell lines HIT-15 and RINm5F.", Journal of Biological Chemistry, vol. 270, no. 31, pp. 18216-18218.
Brissova, M., Fowler, M.J., Nicholson, W.E., Chu, A., Hirshberg, B., Harlan, D.M. & Powers, A.C. 2005, "Assessment of human pancreatic islet architecture and composition by laser scanning confocal microscopy", The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, vol. 53, no. 9, pp. 1087-1097.
Calakos, N., Bennett, M.K., Peterson, K.E. & Scheller, R.H. 1994, "Protein-protein interactions contributing to the specificity of intracellular vesicular trafficking", Science (New York, N.Y.), vol. 263, no. 5150, pp. 1146-1149.
Chan, C.B., MacPhail, R.M., Sheu, L., Wheeler, M.B. & Gaisano, H.Y. 1999, "Beta-cell hypertrophy in fa/fa rats is associated with basal glucose hypersensitivity and reduced SNARE protein expression.", Diabetes, vol. 48, no. 5, pp. 997-1005.
70
Cheatham, B. 2000, "GLUT4 and company: SNAREing roles in insulin-regulated glucose uptake", Trends in endocrinology and metabolism: TEM, vol. 11, no. 9, pp. 356-361.
Chen, X., Tomchick, D.R., Kovrigin, E., Arac, D., Machius, M., Sudhof, T.C. & Rizo, J. 2002, "Three-dimensional structure of the complexin/SNARE complex", Neuron, vol. 33, no. 3, pp. 397-409.
Cui, N., Kang, Y., He, Y., Leung, Y.M., Xie, H., Pasyk, E.A., Gao, X., Sheu, L., Hansen, J.B., Wahl, P., Tsushima, R.G. & Gaisano, H.Y. 2004, "H3 domain of syntaxin 1A inhibits KATP channels by its actions on the sulfonylurea receptor 1 nucleotide-binding folds-1 and -2.", Journal of Biological Chemistry, vol. 279, no. 51, pp. 53259-53265.
Curry, D.L., Bennett, L.L. & Grodsky, G.M. 1968, "Dynamics of insulin secretion by the perfused rat pancreas", Endocrinology, vol. 83, no. 3, pp. 572-584.
Curtis, L.B., Doneske, B., Liu, X., Thaller, C., McNew, J.A. & Janz, R. 2008, "Syntaxin 3b is a t-SNARE specific for ribbon synapses of the retina", The Journal of comparative neurology, vol. 510, no. 5, pp. 550-559.
Darios, F. & Davletov, B. 2006, "Omega-3 and omega-6 fatty acids stimulate cell membrane expansion by acting on syntaxin 3", Nature, vol. 440, no. 7085, pp. 813-817.
Dulubova, I., Khvotchev, M., Liu, S., Huryeva, I., Sudhof, T.C. & Rizo, J. 2007, "Munc18-1 binds directly to the neuronal SNARE complex", Proceedings of the National Academy of Sciences of the United States of America, vol. 104, no. 8, pp. 2697-2702.
Dulubova, I., Sugita, S., Hill, S., Hosaka, M., Fernandez, I., Sudhof, T.C. & Rizo, J. 1999, "A conformational switch in syntaxin during exocytosis: role of munc18", EMBO Journal 18(16):4372-82, .
Dykxhoorn, D.M., Novina, C.D. & Sharp, P.A. 2003, "Killing the messenger: short RNAs that silence gene expression", Nature reviews.Molecular cell biology, vol. 4, no. 6, pp. 457-467.
Easom, R.A. 2000, "Beta-granule transport and exocytosis", Seminars in cell & developmental biology, vol. 11, no. 4, pp. 253-266.
Edwardson, J.M., An, S. & Jahn, R. 1997, "The secretory granule protein syncollin binds to syntaxin in a Ca2(+)-sensitive manner.", Cell, vol. 90, no. 2, pp. 325-333.
Elhamdani, A., Azizi, F. & Artalejo, C.R. 2006, "Double Patch Clamp Reveals That Transient Fusion (Kiss-and-Run) Is a Major Mechanism of Secretion in Calf Adrenal Chromaffin Cells: High Calcium Shifts the Mechanism from Kiss-and-Run to Complete Fusion", Journal of Neuroscience, vol. 26, no. 11, pp. 3030-3036.
Eliasson, L., Abdulkader, F., Braun, M., Galvanovskis, J., Hoppa, M.B. & Rorsman, P. 2008, "Novel aspects of the molecular mechanisms controlling insulin secretion", The Journal of physiology, vol. 586, no. 14, pp. 3313-3324.
71
Fasshauer, D., Antonin, W., Margittai, M., Pabst, S. & Jahn, R. 1999, "Mixed and non-cognate SNARE complexes. Characterization of assembly and biophysical properties", The Journal of biological chemistry, vol. 274, no. 22, pp. 15440-15446.
Fasshauer, D., Sutton, R.B., Brunger, A.T. & Jahn, R. 1998, "Conserved structural features of the synaptic fusion complex: SNARE proteins reclassified as Q- and R-SNAREs", Proceedings of the National Academy of Sciences of the United States of America, vol. 95, no. 26, pp. 15781-15786.
Fesce, R., Grohovaz, F., Valtorta, F. & Meldolesi, J. 1994, "Neurotransmitter release: fusion or 'kiss-and-run'?", Trends in cell biology, vol. 4, no. 1, pp. 1-4.
Gallwitz, D. & Jahn, R. 2003, "The riddle of the Sec1/Munc-18 proteins - new twists added to their interactions with SNAREs", Trends in biochemical sciences, vol. 28, no. 3, pp. 113-116.
Gembal, M., Gilon, P. & Henquin, J.C. 1992, "Evidence that glucose can control insulin release independently from its action on ATP-sensitive K+ channels in mouse B cells", The Journal of clinical investigation, vol. 89, no. 4, pp. 1288-1295.
Gerber, S.H., Rah, J.C., Min, S.W., Liu, X., de Wit, H., Dulubova, I., Meyer, A.C., Rizo, J., Arancillo, M., Hammer, R.E., Verhage, M., Rosenmund, C. & Sudhof, T.C. 2008, "Conformational switch of syntaxin-1 controls synaptic vesicle fusion", Science (New York, N.Y.), vol. 321, no. 5895, pp. 1507-1510.
Gerber, S.H. & Sudhof, T.C. 2002, "Molecular determinants of regulated exocytosis", Diabetes, vol. 51 Suppl 1, pp. S3-11.
Grote, E. & Novick, P.J. 1999, "Promiscuity in Rab-SNARE interactions", Molecular biology of the cell, vol. 10, no. 12, pp. 4149-4161.
Han, L., Jiang, T., Han, G.A., Malintan, N.T., Xie, L., Wang, L., Tse, F.W., Gaisano, H.Y., Collins, B.M., Meunier, F.A. & Sugita, S. 2009, "Rescue of Munc18-1 and -2 Double Knockdown Reveals the Essential Functions of Interaction between Munc18 and Closed Syntaxin in PC12 Cells", Molecular biology of the cell, vol. 20, no. 23, pp. 4962-4975.
Hansen, N.J., Antonin, W. & Edwardson, J.M. 1999, "Identification of SNAREs involved in regulated exocytosis in the pancreatic acinar cell.", Journal of Biological Chemistry, vol. 274, no. 32, pp. 22871-22876.
Hata, Y. & Sudhof, T.C. 1995, "A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic", The Journal of biological chemistry, vol. 270, no. 22, pp. 13022-13028.
Henquin, J.C., Ishiyama, N., Nenquin, M., Ravier, M.A. & Jonas, J.C. 2002, "Signals and pools underlying biphasic insulin secretion", Diabetes, vol. 51 Suppl 1, pp. S60-7.
Hohmeier, H.E., Mulder, H., Chen, G., Henkel-Rieger, R., Prentki, M. & Newgard, C.B. 2000, "Isolation of INS-1-derived cell lines with robust ATP-sensitive K+ channel-dependent and -independent glucose-stimulated insulin secretion", Diabetes, vol. 49, no. 3, pp. 424-430.
72
Hong, W. 2005, "SNAREs and traffic", Biochimica et biophysica acta, vol. 1744, no. 3, pp. 493-517.
Hou, J.C. & Pessin, J.E. 2007, "Ins (endocytosis) and outs (exocytosis) of GLUT4 trafficking", Current opinion in cell biology, vol. 19, no. 4, pp. 466-473.
Hua, Y. & Scheller, R.H. 2001, "Three SNARE complexes cooperate to mediate membrane fusion", Proceedings of the National Academy of Sciences of the United States of America, vol. 98, no. 14, pp. 8065-8070.
Jahn, R. & Niemann, H. 1994, "Molecular mechanisms of clostridial neurotoxins", Annals of the New York Academy of Sciences, vol. 733, pp. 245-255.
Jewell, J.L., Luo, W., Oh, E., Wang, Z. & Thurmond, D.C. 2008, "Filamentous actin regulates insulin exocytosis through direct interaction with Syntaxin 4", The Journal of biological chemistry, vol. 283, no. 16, pp. 10716-10726.
Jing, X., Li, D.Q., Olofsson, C.S., Salehi, A., Surve, V.V., Caballero, J., Ivarsson, R., Lundquist, I., Pereverzev, A., Schneider, T., Rorsman, P. & Renstrom, E. 2005, "CaV2.3 calcium channels control second-phase insulin release", The Journal of clinical investigation, vol. 115, no. 1, pp. 146-154.
Kang, Y., Huang, X., Pasyk, E.A., Ji, J., Holz, G.G., Wheeler, M.B., Tsushima, R.G. & Gaisano, H.Y. 2002, "Syntaxin-3 and syntaxin-1A inhibit L-type calcium channel activity, insulin biosynthesis and exocytosis in beta-cell lines.", Diabetologia, vol. 45, no. 2, pp. 231-241.
Kauppi, M., Wohlfahrt, G. & Olkkonen, V.M. 2002, "Analysis of the Munc18b-syntaxin binding interface. Use of a mutant Munc18b to dissect the functions of syntaxins 2 and 3", The Journal of biological chemistry, vol. 277, no. 46, pp. 43973-43979.
Ketting, R.F., Fischer, S.E., Bernstein, E., Sijen, T., Hannon, G.J. & Plasterk, R.H. 2001, "Dicer functions in RNA interference and in synthesis of small RNA involved in developmental timing in C. elegans", Genes & development, vol. 15, no. 20, pp. 2654-2659.
Kwan, E.P. & Gaisano, H.Y. 2005, "Glucagon-like peptide 1 regulates sequential and compound exocytosis in pancreatic islet beta-cells", Diabetes, vol. 54, no. 9, pp. 2734-2743.
Kwan, E.P., Xie, L., Sheu, L., Ohtsuka, T. & Gaisano, H.Y. 2007, "Interaction between Munc13-1 and RIM is critical for glucagon-like peptide-1 mediated rescue of exocytotic defects in Munc13-1 deficient pancreatic beta-cells", Diabetes, vol. 56, no. 10, pp. 2579-2588.
Lafont, F., Verkade, P., Galli, T., Wimmer, C., Louvard, D. & Simons, K. 1999, "Raft association of SNAP receptors acting in apical trafficking in Madin–Darby canine kidney cells", Proceedings of the National Academy of Sciences of the United States of America, vol. 96, no. 7, pp. 3734-3738.
Lam, P.P., Leung, Y.M., Sheu, L., Ellis, J., Tsushima, R.G., Osborne, L.R. & Gaisano, H.Y. 2005, "Transgenic mouse overexpressing syntaxin-1A as a diabetes model", Diabetes, vol. 54, no. 9, pp. 2744-2754.
73
Land, J., Zhang, H., Vaidyanathan, V.V., Sadoul, K., Niemann, H. & Wollheim, C.B. 1997, "Transient expression of botulinum neurotoxin C1 light chain differentially inhibits calcium and glucose induced insulin secretion in clonal beta-cells", FEBS letters, vol. 419, no. 1, pp. 13-17.
Leung, Y.M., Kang, Y., Gao, X., Xia, F., Xie, H., Sheu, L., Tsuk, S., Lotan, I., Tsushima, R.G. & Gaisano, H.Y. 2003, "Syntaxin 1A binds to the cytoplasmic C terminus of Kv2.1 to regulate channel gating and trafficking", The Journal of biological chemistry, vol. 278, no. 19, pp. 17532-17538.
Leung, Y.M., Kang, Y., Xia, F., Sheu, L., Gao, X., Xie, H., Tsushima, R.G. & Gaisano, H.Y. 2005, "Open form of syntaxin-1A is a more potent inhibitor than wild-type syntaxin-1A of Kv2.1 channels", The Biochemical journal, vol. 387, no. Pt 1, pp. 195-202.
Leung, Y.M., Kwan, E.P., Ng, B., Kang, Y. & Gaisano, H.Y. 2007, "SNAREing voltage-gated K+ and ATP-sensitive K+ channels: tuning beta-cell excitability with syntaxin-1A and other exocytotic proteins", Endocrine reviews, vol. 28, no. 6, pp. 653-663.
Liu, Y., Ding, X., Wang, D., Deng, H., Feng, M., Wang, M., Yu, X., Jiang, K., Ward, T., Aikhionbare, F., Guo, Z., Forte, J.G. & Yao, X. 2007, "A mechanism of Munc18b-syntaxin 3-SNAP25 complex assembly in regulated epithelial secretion", FEBS letters, vol. 581, no. 22, pp. 4318-4324.
MacDonald, P.E., Obermuller, S., Vikman, J., Galvanovskis, J., Rorsman, P. & Eliasson, L. 2005, "Regulated exocytosis and kiss-and-run of synaptic-like microvesicles in INS-1 and primary rat beta-cells", Diabetes, vol. 54, no. 3, pp. 736-743.
MacDonald, P.E. & Wheeler, M.B. 2003, "Voltage-dependent K(+) channels in pancreatic beta cells: role, regulation and potential as therapeutic targets", Diabetologia, vol. 46, no. 8, pp. 1046-1062.
Margittai, M., Widengren, J., Schweinberger, E., Schröder, G.F., Felekyan, S., Haustein, E., König, M., Fasshauer, D., Grubmüller, H., Jahn, R. & Seidel, C.A.M. 2003, "Single-molecule fluorescence resonance energy transfer reveals a dynamic equilibrium between closed and open conformations of syntaxin 1", Proceedings of the National Academy of Sciences of the United States of America, vol. 100, no. 26, pp. 15516-15521.
Martin-Martin, B., Nabokina, S., Lazo, P. & Mollinedo, F. 1999, "Co-expression of several human syntaxin genes in neutrophils and differentiating HL-60 cells: variant isoforms and detection of syntaxin 1", Journal of leukocyte biology, vol. 65, no. 3, pp. 397-406.
Mazelova, J., Ransom, N., Astuto-Gribble, L., Wilson, M.C. & Deretic, D. 2009, "Syntaxin 3 and SNAP-25 pairing, regulated by omega-3 docosahexaenoic acid, controls the delivery of rhodopsin for the biogenesis of cilia-derived sensory organelles, the rod outer segments", Journal of cell science, vol. 122, no. Pt 12, pp. 2003-2013.
Medine, C.N., Rickman, C., Chamberlain, L.H. & Duncan, R.R. 2007, "Munc18-1 prevents the formation of ectopic SNARE complexes in living cells", Journal of cell science, vol. 120, no. 24, pp. 4407-4415.
Nagamatsu, S., Fujiwara, T., Nakamichi, Y., Watanabe, T., Katahira, H., Sawa, H. & Akagawa, K. 1996, "Expression and functional role of syntaxin 1/HPC-1 in pancreatic beta cells. Syntaxin 1A, but not
74
1B, plays a negative role in regulatory insulin release pathway.", Journal of Biological Chemistry, vol. 271, no. 2, pp. 1160-1165.
Nagamatsu, S., Nakamichi, Y., Yamamura, C., Matsushima, S., Watanabe, T., Ozawa, S., Furukawa, H. & Ishida, H. 1999, "Decreased expression of t-SNARE, syntaxin 1, and SNAP-25 in pancreatic beta-cells is involved in impaired insulin secretion from diabetic GK rat islets: restoration of decreased t-SNARE proteins improves impaired insulin secretion.", Diabetes, vol. 48, no. 12, pp. 2367-2373.
Nemoto, T., Kimura, R., Ito, K., Tachikawa, A., Miyashita, Y., Iino, M. & Kasai, H. 2001, "Sequential-replenishment mechanism of exocytosis in pancreatic acini", Nature cell biology, vol. 3, no. 3, pp. 253-258.
Neshatian, L., Leung, Y.M., Kang, Y., Gao, X., Xie, H., Tsushima, R.G., Gaisano, H.Y. & Diamant, N.E. 2007, "Distinct modulation of Kv1.2 channel gating by wild type, but not open form, of syntaxin-1A", American journal of physiology.Gastrointestinal and liver physiology, vol. 292, no. 5, pp. G1233-42.
Obermuller, S., Lindqvist, A., Karanauskaite, J., Galvanovskis, J., Rorsman, P. & Barg, S. 2005, "Selective nucleotide-release from dense-core granules in insulin-secreting cells", Journal of cell science, vol. 118, no. Pt 18, pp. 4271-4282.
Oh, E., Spurlin, B.A., Pessin, J.E. & Thurmond, D.C. 2005, "Munc18c heterozygous knockout mice display increased susceptibility for severe glucose intolerance", Diabetes, vol. 54, no. 3, pp. 638-647.
Oh, E. & Thurmond, D.C. 2009, "Munc18c depletion selectively impairs the sustained phase of insulin release", Diabetes, vol. 58, no. 5, pp. 1165-1174.
Ohara-Imaizumi, M., Fujiwara, T., Nakamichi, Y., Okamura, T., Akimoto, Y., Kawai, J., Matsushima, S., Kawakami, H., Watanabe, T., Akagawa, K. & Nagamatsu, S. 2007, "Imaging analysis reveals mechanistic differences between first- and second-phase insulin exocytosis", The Journal of cell biology, vol. 177, no. 4, pp. 695-705.
Olofsson, C.S., Gopel, S.O., Barg, S., Galvanovskis, J., Ma, X., Salehi, A., Rorsman, P. & Eliasson, L. 2002, "Fast insulin secretion reflects exocytosis of docked granules in mouse pancreatic B-cells", Pflugers Archiv : European journal of physiology, vol. 444, no. 1-2, pp. 43-51.
Ostenson, C.G., Gaisano, H., Sheu, L., Tibell, A. & Bartfai, T. 2006, "Impaired gene and protein expression of exocytotic soluble N-ethylmaleimide attachment protein receptor complex proteins in pancreatic islets of type 2 diabetic patients", Diabetes, vol. 55, no. 2, pp. 435-440.
Pabst, S., Hazzard, J.W., Antonin, W., Sudhof, T.C., Jahn, R., Rizo, J. & Fasshauer, D. 2000, "Selective interaction of complexin with the neuronal SNARE complex. Determination of the binding regions", The Journal of biological chemistry, vol. 275, no. 26, pp. 19808-19818.
Pabst, S., Margittai, M., Vainius, D., Langen, R., Jahn, R. & Fasshauer, D. 2002, "Rapid and selective binding to the synaptic SNARE complex suggests a modulatory role of complexins in neuroexocytosis", The Journal of biological chemistry, vol. 277, no. 10, pp. 7838-7848.
75
Paddison, P.J., Caudy, A.A., Sachidanandam, R. & Hannon, G.J. 2004, "Short hairpin activated gene silencing in mammalian cells", Methods in molecular biology (Clifton, N.J.), vol. 265, pp. 85-100.
Pasyk, E.A., Kang, Y., Huang, X., Cui, N., Sheu, L. & Gaisano, H.Y. 2004, "Syntaxin-1A binds the nucleotide-binding folds of sulphonylurea receptor 1 to regulate the KATP channel", The Journal of biological chemistry, vol. 279, no. 6, pp. 4234-4240.
Pedersen, M.G. & Sherman, A. 2009, "Newcomer insulin secretory granules as a highly calcium-sensitive pool", Proceedings of the National Academy of Sciences of the United States of America, vol. 106, no. 18, pp. 7432-7436.
Peng, R. & Gallwitz, D. 2002, "Sly1 protein bound to Golgi syntaxin Sed5p allows assembly and contributes to specificity of SNARE fusion complexes", The Journal of cell biology, vol. 157, no. 4, pp. 645-655.
Pickett, J.A., Campos-Toimil, M., Thomas, P. & Edwardson, J.M. 2007, "Identification of SNAREs that mediate zymogen granule exocytosis", Biochemical & Biophysical Research Communications 359(3):599-603, .
Regazzi, R., Wollheim, C.B., Lang, J., Theler, J.M., Rossetto, O., Montecucco, C., Sadoul, K., Weller, U., Palmer, M. & Thorens, B. 1995, "VAMP-2 and cellubrevin are expressed in pancreatic beta-cells and are essential for Ca(2+)-but not for GTP gamma S-induced insulin secretion", The EMBO journal, vol. 14, no. 12, pp. 2723-2730.
Reim, K., Mansour, M., Varoqueaux, F., McMahon, H.T., Sudhof, T.C., Brose, N. & Rosenmund, C. 2001, "Complexins regulate a late step in Ca2+-dependent neurotransmitter release", Cell, vol. 104, no. 1, pp. 71-81.
Rhodes, C.J. & Halban, P.A. 1987, "Newly synthesized proinsulin/insulin and stored insulin are released from pancreatic B cells predominantly via a regulated, rather than a constitutive, pathway", The Journal of cell biology, vol. 105, no. 1, pp. 145-153.
Riento, K., Galli, T., Jansson, S., Ehnholm, C., Lehtonen, E. & Olkkonen, V. 1998, "Interaction of Munc-18-2 with syntaxin 3 controls the association of apical SNAREs in epithelial cells", Journal of cell science, vol. 111, no. 17, pp. 2681-2688.
Roggero, C.M., De Blas, G.A., Dai, H., Tomes, C.N., Rizo, J. & Mayorga, L.S. 2007, "Complexin/synaptotagmin interplay controls acrosomal exocytosis", The Journal of biological chemistry, vol. 282, no. 36, pp. 26335-26343.
Rorsman, P. & Renstrom, E. 2003, "Insulin granule dynamics in pancreatic beta cells", Diabetologia, vol. 46, no. 8, pp. 1029-1045.
Rothman, J.E. 2002, "Lasker Basic Medical Research Award. The machinery and principles of vesicle transport in the cell", Nature medicine, vol. 8, no. 10, pp. 1059-1062.
76
Saito, T., Okada, S., Yamada, E., Ohshima, K., Shimizu, H., Shimomura, K., Sato, M., Pessin, J.E. & Mori, M. 2003, "Syntaxin 4 and Synip (syntaxin 4 interacting protein) regulate insulin secretion in the pancreatic beta HC-9 cell", The Journal of biological chemistry, vol. 278, no. 38, pp. 36718-36725.
Sakiyama, H., Tadokoro, S., Nakanishi, M. & Hirashima, N. 2009, "Membrane fusion between liposomes containing SNARE proteins involved in mast cell exocytosis", Inflammation research : official journal of the European Histamine Research Society ...[et al.], vol. 58, no. 3, pp. 139-142.
Schraw, T.D., Lemons, P.P., Dean, W.L. & Whiteheart, S.W. 2003, "A role for Sec1/Munc18 proteins in platelet exocytosis", The Biochemical journal, vol. 374, no. Pt 1, pp. 207-217.
Schulla, V., Renstrom, E., Feil, R., Feil, S., Franklin, I., Gjinovci, A., Jing, X.J., Laux, D., Lundquist, I., Magnuson, M.A., Obermuller, S., Olofsson, C.S., Salehi, A., Wendt, A., Klugbauer, N., Wollheim, C.B., Rorsman, P. & Hofmann, F. 2003, "Impaired insulin secretion and glucose tolerance in beta cell-selective Ca(v)1.2 Ca2+ channel null mice", The EMBO journal, vol. 22, no. 15, pp. 3844-3854.
Sheng, Z.H., Rettig, J., Cook, T. & Catterall, W.A. 1996, "Calcium-dependent interaction of N-type calcium channels with the synaptic core complex", Nature, vol. 379, no. 6564, pp. 451-454.
Sherry, D.M., Mitchell, R., Standifer, K.M. & du Plessis, B. 2006, "Distribution of plasma membrane-associated syntaxins 1 through 4 indicates distinct trafficking functions in the synaptic layers of the mouse retina", BMC Neuroscience 7:54, .
Shibasaki, T., Takahashi, H., Miki, T., Sunaga, Y., Matsumura, K., Yamanaka, M., Zhang, C., Tamamoto, A., Satoh, T., Miyazaki, J.-. & Seino, S. 2007, "Essential role of Epac2/Rap1 signaling in regulation of insulin granule dynamics by cAMP", PNAS, vol. 104, no. 49, pp. 19333-19338.
Sollner, T., Whiteheart, S.W., Brunner, M., Erdjument-Bromage, H., Geromanos, S., Tempst, P. & Rothman, J.E. 1993, "SNAP receptors implicated in vesicle targeting and fusion", Nature, vol. 362, no. 6418, pp. 318-324.
Spurlin, B.A. & Thurmond, D.C. 2006, "Syntaxin 4 facilitates biphasic glucose-stimulated insulin secretion from pancreatic beta-cells.", Molecular Endocrinology, vol. 20, no. 1, pp. 183-193.
Sudhof, T.C. & Rothman, J.E. 2009, "Membrane fusion: grappling with SNARE and SM proteins", Science (New York, N.Y.), vol. 323, no. 5913, pp. 474-477.
Sutton, R.B., Fasshauer, D., Jahn, R. & Brunger, A.T. 1998, "Crystal structure of a SNARE complex involved in synaptic exocytosis at 2.4 A resolution", Nature, vol. 395, no. 6700, pp. 347-353.
Tadokoro, S. 2005, "Complexin II facilitates exocytotic release in mast cells by enhancing CA2 sensitivity of the fusion process", Journal of cell science, vol. 118, no. 10, pp. 2239.
Tadokoro, S., Kurimoto, T., Nakanishi, M. & Hirashima, N. 2007, "Munc18-2 regulates exocytotic membrane fusion positively interacting with syntaxin-3 in RBL-2H3 cells", Molecular Immunology, vol. 44, no. 13, pp. 3427-3433.
77
Tadokoro, S., Nakanishi, M. & Hirashima, N. 2010, "Complexin II regulates degranulation in RBL-2H3 cells by interacting with SNARE complex containing syntaxin-3", Cellular immunology, vol. 261, no. 1, pp. 51-56.
Takahashi, N., Hatakeyama, H., Okado, H., Miwa, A., Kishimoto, T., Kojima, T., Abe, T. & Kasai, H. 2004, "Sequential exocytosis of insulin granules is associated with redistribution of SNAP25", The Journal of cell biology, vol. 165, no. 2, pp. 255-262.
Tellam, J.T., Macaulay, S.L., McIntosh, S., Hewish, D.R., Ward, C.W. & James, D.E. 1997, "Characterization of Munc-18c and syntaxin-4 in 3T3-L1 adipocytes. Putative role in insulin-dependent movement of GLUT-4.", Journal of Biological Chemistry, vol. 272, no. 10, pp. 6179-6186.
Teng, F.Y., Wang, Y. & Tang, B.L. 2001, "The syntaxins", Genome biology, vol. 2, no. 11, pp. REVIEWS3012.
Tokumaru, H. 2001, "SNARE complex oligomerization by synaphin/complexin is essential for synaptic vesicle exocytosis", Cell, vol. 104, no. 3, pp. 421.
Toonen, R.F., de Vries, K.J., Zalm, R., Sudhof, T.C. & Verhage, M. 2005, "Munc18-1 stabilizes syntaxin 1, but is not essential for syntaxin 1 targeting and SNARE complex formation", Journal of neurochemistry, vol. 93, no. 6, pp. 1393-1400.
Tsuboi, T., Ravier, M.A., Parton, L.E. & Rutter, G.A. 2006, "Sustained exposure to high glucose concentrations modifies glucose signaling and the mechanics of secretory vesicle fusion in primary rat pancreatic beta-cells", Diabetes, vol. 55, no. 4, pp. 1057-1065.
Tsuk, S., Lvov, A., Michaelevski, I., Chikvashvili, D. & Lotan, I. 2008, "Formation of the full SNARE complex eliminates interactions of its individual protein components with the Kv2.1 channel", Biochemistry, vol. 47, no. 32, pp. 8342-8349.
Tsuk, S., Michaelevski, I., Bentley, G.N., Joho, R.H., Chikvashvili, D. & Lotan, I. 2005, "Kv2.1 Channel Activation and Inactivation Is Influenced by Physical Interactions of Both Syntaxin 1A and the Syntaxin 1A/Soluble N-Ethylmaleimide-Sensitive Factor-25 (t-SNARE) Complex with the C Terminus of the Channel", Molecular pharmacology, vol. 67, no. 2, pp. 480-488.
Ungar, D. & Hughson, F.M. 2003, "SNARE protein structure and function", Annual Review of Cell and Developmental Biology, vol. 19, pp. 493-517.
Verhage, M., Maia, A.S., Plomp, J.J., Brussaard, A.B., Heeroma, J.H., Vermeer, H., Toonen, R.F., Hammer, R.E., van den Berg, T.K., Missler, M., Geuze, H.J. & Sudhof, T.C. 2000, "Synaptic assembly of the brain in the absence of neurotransmitter secretion", Science (New York, N.Y.), vol. 287, no. 5454, pp. 864-869.
Vikman, J., Ma, X., Hockerman, G.H., Rorsman, P. & Eliasson, L. 2006, "Antibody inhibition of synaptosomal protein of 25 kDa (SNAP-25) and syntaxin 1 reduces rapid exocytosis in insulin-secreting cells.", Journal of Molecular Endocrinology, vol. 36, no. 3, pp. 503-515.
78
79
Voets, T., Toonen, R.F., Brian, E.C., de Wit, H., Moser, T., Rettig, J., Sudhof, T.C., Neher, E. & Verhage, M. 2001, "Munc18-1 promotes large dense-core vesicle docking", Neuron, vol. 31, no. 4, pp. 581-591.
Wasle, B. & Edwardson, J.M. 2002, "The regulation of exocytosis in the pancreatic acinar cell", Cellular signalling, vol. 14, no. 3, pp. 191-197.
Wheeler, M.B., Sheu, L., Ghai, M., Bouquillon, A., Grondin, G., Weller, U., Beaudoin, A.R., Bennett, M.K., Trimble, W.S. & Gaisano, H.Y. 1996, "Characterization of SNARE protein expression in beta cell lines and pancreatic islets", Endocrinology, vol. 137, no. 4, pp. 1340-1348.
Xue, M., Reim, K., Chen, X., Chao, H.T., Deng, H., Rizo, J., Brose, N. & Rosenmund, C. 2007, "Distinct domains of complexin I differentially regulate neurotransmitter release", Nature structural & molecular biology, vol. 14, no. 10, pp. 949-958.
Yang, S.N. & Berggren, P.O. 2006, "The role of voltage-gated calcium channels in pancreatic beta-cell physiology and pathophysiology", Endocrine reviews, vol. 27, no. 6, pp. 621-676.
Yang, S.N., Larsson, O., Branstrom, R., Bertorello, A.M., Leibiger, B., Leibiger, I.B., Moede, T., Kohler, M., Meister, B. & Berggren, P.O. 1999, "Syntaxin 1 interacts with the L(D) subtype of voltage-gated Ca(2+) channels in pancreatic beta cells", Proceedings of the National Academy of Sciences of the United States of America, vol. 96, no. 18, pp. 10164-10169.
Zilly, F.E., Sorensen, J.B., Jahn, R. & Lang, T. 2006, "Munc18-bound syntaxin readily forms SNARE complexes with synaptobrevin in native plasma membranes", PLoS biology, vol. 4, no. 10, pp. e330.
Zufferey, R., Nagy, D., Mandel, R.J., Naldini, L. & Trono, D. 1997, "Multiply attenuated lentiviral vector achieves efficient gene delivery in vivo", Nature biotechnology, vol. 15, no. 9, pp. 871-875.