identification of meat species in processed foods using mass spectrometry - waters corporation food...
TRANSCRIPT
![Page 1: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/1.jpg)
©2015 Waters Corporation 1
Identification of Meat Species in
Processed Foods using
Mass Spectrometry
![Page 2: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/2.jpg)
©2015 Waters Corporation 2
Presentation Overview
Background
– Food labelling regulations
– Water retaining agents in chicken products
– Use of gelatine
Research Objectives
Proposed solution – Sample preparation procedure
– LC-MS approach
– Data interpretation
Results – Identification of potential peptide markers
– Quantification of markers
Future work using Xevo TQ-S
Conclusions
![Page 3: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/3.jpg)
©2015 Waters Corporation 3
Meat speciation – regulatory requirements
Authenticity of food and the accuracy of package labeling is important
to both consumers and food producers
Within the EC food labeling regulations exist
– ~5 M people in UK have preferences concerning consumption of certain
species
Composition of injection powders?
– Undeclared water-retaining hydrolysed proteins from pork and beef
used in chicken products
– Some chicken products potentially unsuitable for consumers
Need to verify the species of gelatine used in food
![Page 4: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/4.jpg)
©2015 Waters Corporation 4
Injection powders - gelatine
What is it?
– Bi-product from the meat / fish industry
– partial hydrolysis of collagen extracted from skin, bones, connective tissue
Properties of gelatine
– Gelling agent
– Semi-solid colloid gel
– Texture enhancer
Approx annual production:
– Europe: 117kt (70% used in food)
What is it used for?
– Food and Beverages – Drugs and capsules
– Cosmetics
– Photographic film
– Fertilisers…
![Page 5: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/5.jpg)
©2015 Waters Corporation 5
Research objectives and aims
Develop a method to detect species and tissue origin of meat
ingredients present in meat products
1. To identify unequivocal markers that can indicate the presence of
bovine or porcine gelatine
2. To determine whether chicken products have been adulterated
with proteins from other animal species
3. To develop a robust and transferable method
Current limitations…
– Paper trail is not sufficient
– FSA concluded that PCR / IA based strategies are not reliable
• DNA markers damaged by processing conditions
• False negative rate
Possible Solutions?
– LC-MS/MS using a proteomic workflow
![Page 6: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/6.jpg)
©2015 Waters Corporation 6
Alternative strategy =
proteomic based analytical strategy to
identify peptide markers using HR-MS
![Page 7: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/7.jpg)
©2015 Waters Corporation 7
Bottom-up proteomic experiment
1. Enzyme digestion
2. UPLC separation
Precursor ions
MSE product ions
3. MS analysis
4. Data interpretation
![Page 8: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/8.jpg)
©2015 Waters Corporation 8
Meat Speciation Workflow
SAMPLE PREPARATION (1) Tryptic digest (2) ADH addition
DATA ACQUISITION Acquire data-independent MSE Data
SOFTWARE PROCESSING IdentityE and gelatine database (BioArch)
ANALYTICAL SYSTEMS (1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
Nano-scale separations
•Resolution •Peak shape •Number of components / analytical
run
Full scan, accurate
mass
![Page 9: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/9.jpg)
©2015 Waters Corporation 9
Meat Speciation Workflow Sample Preparation
Samples
– Protein tryptic digests;
o pork gelatine
o beef gelatine
o pork & beef gelatine mix
Tryptic digest
– 250 μg of porcine and bovine gelatine were hydrolysed with 5 μg of sequence grade trypsin for 16hr
ADH addition
– Quench reaction with formic acid
– 10 fmol of yeast alcohol dehydrogenase (internal standard) added tryptic digest
SAMPLE PREPARATION (1) Tryptic digest (2) ADH addition
![Page 10: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/10.jpg)
©2015 Waters Corporation 10
UPLC Conditions
System
– NanoACQUITY® UPLC
Column:
– 75 µm x 15 cm BEH C18 column
Gradient:
– 1 to 40% acetonitrile
– 90 min
Flow rate:
– 300 nL/min
Triplicate analysis
MS Conditions
System
– Xevo QTof MS
Mass range:
– m/z 50-1990
Data Acquisition:
– MSE
Collision energy:
– Low energy - 4 eV
– High energy - 12-35 eV
Acquisition scan time:
– 0.9 s/function
Meat Speciation Workflow UPLC-MS conditions
OPTIMISED ANALYTICAL PARAMETERS (1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
![Page 11: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/11.jpg)
©2015 Waters Corporation 11
Meat Speciation Workflow MSE
UPLC-MSE is a data independent parallel process that occurs in
the collision cell
The instrument is operated in an alternative scanning mode
providing two MS scan functions for data acquisition in one
analytical run
– Function 1 = low collision energy (precursor ions) Function 2 =
high energy (fragment ions)
DATA ACQUISITION Acquire data-independent MSE Data
![Page 12: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/12.jpg)
©2015 Waters Corporation 12
Meat Speciation Workflow Software processing
SOFTWARE PROCESSING PLGS and IdentityE
Positive matches referenced to database library
Increasing confidence in assignment of peptides
![Page 13: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/13.jpg)
©2015 Waters Corporation 13
Results and Discussion
![Page 14: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/14.jpg)
©2015 Waters Corporation 14
nanoACQUITY replicate injections (n=3) Beef gelatine
Repeatable results
Overlay low energy MSE chromatograms
![Page 15: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/15.jpg)
©2015 Waters Corporation 15
Meat Speciation Workflow Software processing
High energy product ion data gives increased confidence in peptide sequence identification
Low energy data can be displayed as a mass spectrum or a chromatogram
Markers originated from a SINGLE protein
Unique marker peptides sequences listed here
![Page 16: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/16.jpg)
©2015 Waters Corporation 16
Discovery & Identification Total Marker Peptides
Aim to obtain a peptide marker that is unmodified (if possible)
Over 60 collagen peptides were identified in samples of both bovine and
porcine gelatines
IdentityE did not identify peptides from any other proteins
– Collagen
– Yeast ADH
Indicates the samples were 100% gelatine
Multiple forms of the
peptides identified
Species peptide Peptide mass Type of peptide modification
Bovine
GYPGNPGPAGAAGAP 1235.58 Non-tryptic cleavage product
GYPGNPGPAGAAGAPGPQGAVGPAGK 2173.08 Unmodified peptide
GYPGNPGPAGAAGAPGPQGAVGPAGK 2189.07 Hydroxyl of single proline
GYPGNPGPAGAAGAPGPQGAVGPAGK 2205.07 Hydroxylation of prolines 3 and 15
GYPGNPGPAGAAGAPGPQGAVGPAGK 2221.06 Three hydroxyprolines
GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2653.3 Missed tryptic cleavage hydroxylation of proline 29
GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2669.29 Missed cleavage plus two proline hydroxylations
Porcine
IGQPGAVGPAGIR 1192.68 Deamidation + Q3
IGQPGAVGPAGIR 1193.66 Hydroxyl + DKNP 4
IGQPGAVGPAGIR 1208.67
IGQPGAVGPAGIR 1209.66 Deamidation +Q3; Hydroxyl+DKNP9
![Page 17: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/17.jpg)
©2015 Waters Corporation 17
Discovery & Identification Unique Unmodified Marker Peptides
Bovine peptide marker IGQPGAVAPAGIR
Porcine peptide marker TGQPGAVAPAGIR
Comparison of high energy MSE fragment ion spectra
Differences in b and y
ions formed
![Page 18: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/18.jpg)
©2015 Waters Corporation 18
Quantification Porcine and bovine gelatine
Use of ADH enabled quantification of proteins in sample
Removes need to use labelling systems for peptide and
protein quantification
Test mix was prepared
Addition of 15%(w/w) bovine gelatine in porcine gelatine
Results
Three bovine and porcine peptides were selected - relative
bovine gelatine content of ~ 16.8%
![Page 19: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/19.jpg)
©2015 Waters Corporation 19
Conclusions
Highly processed food proteins, such as gelatine, that
are devoid of DNA signature can be speciated using
LC-MS
Protein sequence database analysis identified peptide
sequences within the protein that are species specific
Waters Xevo Qtof MS was able to identify these
sequences, even after significant modification of the
amino acids
The interrogation of the total protein complement of
the sample also provided potential information on
non-gelatine proteins in the samples
![Page 20: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/20.jpg)
©2015 Waters Corporation 20
Further Work
Preliminary data suggests the method can
be used to quantify the species in mixtures
of gelatines
Investigate the contribution that type III
collagen (from skin and connective tissue)
might make to the quantitative analysis
of gelatines
![Page 21: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/21.jpg)
©2015 Waters Corporation 21
Future Work
Method transfer to routine analysis using tandem quad MS/MS
![Page 22: Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research](https://reader030.vdocuments.site/reader030/viewer/2022032616/55a7424f1a28ab64018b4827/html5/thumbnails/22.jpg)
©2015 Waters Corporation 22
Acknowledgments
Helen Grundy - Food and Environment Research Agency, York, UK
BioArCh, University of York, UK
Thank you for your attention
Any Questions?