guide to professional success

B U T L E R U N I V E R S I T YI n t e r n s h i p a n d C a r e e r S e r v i c e s

Guide to Professional Successresumes · cvs · cover letters · networking · interviewing

Internship and Career Services 4600 Sunset Ave.

Atherton Union 315 Indianapolis, IN 46208

317-940-9383 www.butler.edu/ics

[email protected]

Table of Contents

3 Welcome!

4 Writing an Effective Resume

9 Creating a CV

10 Providing References and Letters of Recommendation

11 Composing a Cover Letter

13 Networking

17 Preparing for an Interview

24 What to Wear

26 Interviews at a Distance

28 After the Interview

29 Success Tips for Interns and Young Professionals

30 Appendices

www.butler.edu/ics 3

The Internship and Career Services (ICS) office at Butler University provides you with a wide array of resources and tools to help you obtain your career goals. Below are some of the services offered by ICS.

Career Advising Visit the ICS office for personalized assistance with your job or internship search or for help in exploring options for your major.

Networking and Career Fairs Attend a networking or career fair on or off campus to connect with employers and learn about internship and career opportunities.

Resume and Cover Letter Critique Our career advisors can help you craft winning resumes and cover letters to help showcase your skills and abilities.

Job and Internship Search Make an appointment with our trained staff and we will help you formulate a strategic plan for finding an internship or full-time position.

Mock Interviews Practice your interviewing skills and receive valuable feedback while learning best practices for selling yourself in an interview.

B.L.U.E. (Butler Links U to Employers) Our online career management system provides access to full-time, part-time, on-campus and internship opportunities. B.L.U.E. is available to all students and alumni.

On-Campus Interviews Interview on campus with companies throughout the year. A calendar of upcoming on-campus interviews is available on the ICS website.

Gap Year Our staff will help you search for a gap year experience that fits your goals and interests.

Self Assessment Resources ICS offers a variety of assessments including the Strong Interest Inventory, Myers-Briggs Type Indicator (MBTI), and StrengthsQuest.

Internship and Career Events ICS hosts a variety of career events each semester. Listings of upcoming offerings, including the Professional Success Series, can be found on the ICS website.

Internship and Career ServicesAtherton Union, room 315

www.butler.edu/[email protected]

Welcome!

4 Internship and Career Services

Writing an Effective ResumeIf you ask ten different people how your resume should be structured, they will tell you ten different ways. The bottom line is that there is no “right way” to create a resume. Your resume should, however, showcase your skills and accomplishments to an employer. Accompanied by a cover letter, its purpose is to help you obtain an interview.

Getting StartedThe reverse chronological resume is a great way to list your work experiences beginning with the most recent first and aligning your dates along the right hand side of the page. This type of resume has a very organized feel, allows the reader to easily scan the resume, and is the most widely used and most preferred by employers.

When formatting your resume, there are strategies that you may use to promote your abilities and capture the reader’s attention. Although there are popular standard formats, your format will depend upon your target audience and the manner in which you want to present yourself.

Most employers look at resumes for only 15 seconds — maybe 30 seconds if they like what they see. Therefore, a resume should not be an exhaustive list of everything you have ever done. The information you include in your resume should support your career objective.

Follow these proven strategies to help create an effective resume.

Heading• Bold your name and use 16-pt. font to help it stand out.• Make sure that the voicemail for the number you provide is professional.• Your email address should be job appropriate. If you are graduating soon, be sure to create a new, professional e-mail

address to place on your resume.• You may place a line underneath your heading to set it apart from the rest of the page.

Career Objective• This is an optional section. However, if you choose to include an objective, be sure to target it towards the type of

position and organization for which you are applying. Also, include a few skills that you can bring to the organization, rather than focusing on what they can do for you. Use the job description to help you choose which skills to include.

Education• List your education in reverse chronological order.• Include your anticipated or earned degree, major, minor, university and expected year of graduation.• Bold the name of your degree and place it on the first line, so that it stands out on the page.• List your GPA, including that of your major if significantly higher than your overall GPA. If your GPA is below 3.0, ask

your career advisor for guidance. • Include honors and awards that represent a composite picture of your strengths.• Add study abroad programs and all other transferred schools if applicable.• Listing relevant coursework is optional, but may be important. Only select the most relevant courses that will help

market your skills.

Experience• Include any employment or internships (including unpaid experiences) that you have obtained.• Include title, name of organization, location and dates for each position.• Write out the month and year for both beginning and end dates (e.g., May 2013–June 2014).• Emphasize your strongest accomplishments, rather than a list of job duties.• Begin each bullet with an action verb. Refrain from using passive phrases such as “responsible for” (See Appendix A for a

list of action verbs).• Refrain from using pronouns.• Spell out numbers one through nine and use numerics for 10 and above.• Keep bullet points short and concise, yet specific.


• Abbreviate states with capital letters (e.g., IN, CA, NY).• Minimize all formatting and only bold the most pertinent pieces of information. For example, if your job titles are your

strongest selling point, place them on the first line and only bold that piece of information so that they stand out on the page.

• Include results when possible. Ask yourself the following questions: How did my work benefit the company? What were my strongest accomplishments? What skills should I highlight that are most relevant to the job?

• Quantify when possible (e.g., Supervised 15 employees, Decreased expenses by 15 percent, Managed a $30,000 budget).• If you have relevant experience in the field, you may title this section to be more specific to the position (e.g., “Non-Profit

Experience” or “Public Relations Experience”). You may then include all relevant experience in this section. You may add an additional “Experience” section underneath it to place any other experiences that are relevant but do not fit into the above section. This helps you highlight your strongest and most relevant experience on the top of the page.

Leadership and Community Service• List activities that you held throughout your college experience. • Note offices held and committee work performed.• Only list activities that you would feel comfortable expanding upon in an interview.• Bold the titles of your positions or the organization so that they stand out on the page. Be sure to be consistent on each

line of this section.• List the corresponding dates on the right hand side of the page, consistent with the rest of the document.

Skills• This is an optional section. You can include specific language, computer or other relevant skills. • Only include skills that are specific to the position for which you are applying.

A few final tips!• Be sure to tailor your resume for each position. Based on the job description, make a list of the skills that are needed to

successfully perform the job duties. Tailor your resume to specifically emphasize those skills. • Do not exaggerate your experiences. Find a position that matches your current skill set. • Absolutely no typos! • Don’t overcrowd the page. Use no less than 11-pt. font and .75 margins. Recommended fonts include Times and Arial. • Avoid acronyms. • Do not include personal information (e.g. relationship status, age, siblings, etc.). • Be consistent in your format (e.g., If you list dates on the right in your experience section, you must list them on the

right for all sections).

Articulating Your Study Abroad Experience ProfessionallyIn a competitive job market you need to highlight everything that might set you apart from other candidates, and your study abroad experience can do just that! It is important to incorporate your experience as well as the valuable skills you gained.

What to IncludeWhen including study abroad on your resume, think about the skills you gained and what you learned while abroad. Did you become proficient in a language? Did you gain research experience? Have you become well versed in some aspect of your host country’s culture? Remember, in your resume—as well as in interviews—you must make the connection to the skills you gained from your experience, as it won’t always be obvious to an employer. Your resume should focus on the “results” of your study abroad experience, not simply where you went or what you did.

Where to Place Your Study Abroad Experience You can include your study abroad experience under education or relevant experience. If your experience was heavily academic (e.g., large course load, research work, etc.), it may be best to include it under education. However, if you completed an internship while abroad, you might choose to include it under relevant work experience. You can also include study and work abroad programs in a separate category titled “International Experience.” This option may be the most appropriate if you have had multiple experiences abroad. Be sure to include key skills you developed through these experiences.

When reading the upcoming section on “Preparing for an Interview,” craft interview answers from your study abroad experiences to answer some of the interview questions provided.


See Appendix B for sample resumes.

Turning Job Duties into AccomplishmentsComposing bullet points can be one of the most challenging parts of creating a strong resume. Be sure to focus your bullet points on your accomplishments instead of just a list of your job duties. Try including at least one of these items in each bullet point, and see the difference that it makes!

WHY?Including why you did a particular task helps showcase how you added value. Merely stating what you did doesn’t allow you to state why your work was important.

HOW?Including how you did something allows for you to expand upon your skills and knowledge, and provides more detail to paint a clear picture of your accomplishment.

RESULTDid you make a change? Did you improve a process? Is there a tangible result of the work that you did? What employer wouldn’t want to hire someone who has proven that they can deliver positive results?

Examples

Tip: If you are having trouble deciding which piece to include, use your job description as a guide. An employer’s job description states what they are looking for in a candidate. Select personal experiences that prove you have the skills that they include in their posting.

Job Duty Assisted with classroom activities for music students

Accomplishment

Exposed students to meaningful musical experiences (WHY?) to enhance their social and academic development

Enhanced students’ social and academic development (HOW?) by exposing them to meaningful musical experiences

Pick the strongest piece and place it at the beginning of the line, in case the employer doesn’t read the full statement.

Additional examples:• Created an interactive learning environment (HOW?) through creative drills and skills practices (WHY?) to increase

engagement• Encouraged participation in reading aloud (WHY?) to increase confidence and enhance pronunciation skills• (RESULT) Improved transfer student rate (HOW?) by implementing events tailored to serve their individual needs

Let’s try an example!1. Write a brief statement about an accomplishment that you had in an internship, campus organization, etc., that relates to

the position for which you are applying.

2. Now, turn your statement into an accomplishment. Determine what the employer would care about the most: Why it was important? How you accomplished it? Or if there was a tangible result?


Tailoring Your ResumeTailoring your resume is a very effective way to align your past experiences with what an employer is looking for in a candidate. An employer's job description is a great way to see exactly what they are looking for, and then brainstorm accomplishments you have had that prove you could do the job well. Below are some examples of pieces of a job description and bullet points tailored to meet those needs.

See Appendix C for the full CV and matching job description.

Let's try an example!1. Pick out a piece of a job description for which you plan to apply.

2. Write down a past experience that aligns with the piece of the job description you selected.

3. Now, using the strategies described on the previous page, turn that thought into a well stated bullet point!

Job Description Provide one-on-one guidance to music students as needed

Bullet Point Provided individual guidance to three students, helping them significantly advance their playing range

Job Description Communicate regularly with parents to create a cooperative relationship to support the child in school

Bullet PointFacilitated open communication with parents to create a supportive and trusting environment for students

Job Description Incorporate the use of solfege (do-re-mi-fa-so-la-ti-do) to teach sight reading basics

Bullet Point Taught sight reading basics by incorporating solfege (do-re-mi-fa-so-la-ti-do) into classroom activities


While most undergraduate students will compose a resume, there are certain fields which may require a CV. A CV is typically required for academic positions including teaching or research positions, as well as pharmacy. If you are required to submit a CV for a position, read below for tips and suggestions to help get you started.

Getting StartedThe great thing about a CV is that you have more room to expand upon your education and past experiences. A resume is typically one page, whereas a CV can be between 2 to 10 pages in length. Typically, as a new professional you will start off with two pages, and it will increase in length as you advance in your career.

ContentThe content that you choose to include in your CV will depend upon your field and the position for which you are applying.

Your CV should begin with your name and contact information including your e-mail address, postal address and a phone number at which you may be reached.

There are three main areas that you will want to target in your CV, which include teaching, research and service. The sections that you include in your CV are subjective, but should definitely include the following pieces of information:

• Education, including all anticipated or earned degrees, major, minor, university and expected year of graduation. You may also include all study abroad experiences.

• All assistantships, fellowships, practicum and student teaching experiences. • All research projects, presentations and publications including thesis and/or dissertation.• Community service/volunteer work.• Professional associations and memberships.• Professional references.

Similar to a resume, you will want to begin each bullet point with an action verb and showcase your strongest accomplishments in each area. Also, quantify when possible and include the results of your actions (e.g. how your work benefited the students or the organization involved).

Below are some examples of section headings.

Creating a CV

See Appendix C for CV samples.

AchievementsAffiliationsCareer HighlightsCertificationsCommunity ServiceConferences AttendedDistinctionsEducation

Honors and AwardsInternational ExperienceLanguageLeadershipLeadership InvolvementLicensuresMembershipsPerformances

PresentationsProfessional AssociationsProfessional Development Professional PapersProfessional RecognitionProfessional SummaryProficienciesPrograms and Workshops

PublicationsReferencesResearch ExperienceScholarly PresentationsThesis


Providing ReferencesEmployers typically check your references right before they make you an offer or if they are deciding between you and another candidate. Sometimes they will make an offer contingent upon checking your references and transcripts. References can either make or break the deal, yet many candidates put little thought into selecting their references. Below are some items to consider when choosing your references.

• Selectthreetofivebusinessreferencestoprovidetotheemployer. The individuals you select should be able to expand upon your work (e.g., supervisors, professors, coaches, customers, and people you worked for on volunteer or community projects).

• Choosereferencesthatarereallygoingtosingyourpraises. Choose energetic, positive people who are good communicators. If you have any doubt about what someone might say about you, don’t use them.

• Somereferencesmayworkforcompaniesthathaveapolicythattheywillonlyverifydatesofemploymentandjobtitle. If you want to use someone from a company with this policy, ask the person if they would be willing to provide a phone reference off-site. If not, explain the policy to your prospective employer and provide another reference.

• Askpermissionbeforegivingtheirnameoutasareference.Send them a copy of your resume and explain your career objective and marketing plan. They should be aware of the type of position for which you are applying and the strengths and accomplishments you are emphasizing. They may also have some very good advice and comments about your resume, as well as serve as one of your networking contacts.

• Coachyourreferences. If an employer has asked for references, contact each reference and let them know who will call them, what the position entails and why they are interested in you. Ask your references for the best method and time to be reached.

• Createaseparatereferencesheetthatmatchesyourresumeformat.Placing “References available upon request” on your resume is not necessary. The reference sheet should match the heading on your resume as well as the font and margins.

• Verifythatallcontactinformationiscurrent.You should include: name, title, address, phone number, and email address.• Listyourreferencesinorderofpreference. Employers may start at the top and go down the list.• Finally,letyourreferencesknowwhenandwhereyouhaveacceptedaposition,and thank them for helping you in

the job search process.

Providing Letters of RecommendationA letter of recommendation may be requested by employers or professional programs when applying. These letters provide valuable information to employers and admissions departments in regards to your past experiences. When requesting a letter of recommendation, here are a few tips to assist in the process:

1.Chooseindividualswhocanprovideevidenceofyourpastaccomplishmentsthatprovethatyouhavetheskillsandqualitiesneeded. Past supervisors, professors, mentors, and coaches are all great options. Refrain from asking family members to write recommendations.

2.Giveyourrecommendersplentyoftimetowritetheletter. Share with them the position/program to which you are applying as well as supplemental information that will help them select the experiences to share in the letter. Send along any relevant projects/papers as well as a deadline.

3.Ifpossible,askfortheletterofrecommendationinpersonorbyphone. These methods tend to be more personal than sending an email.

4.Alwaysfollowupwithyourrecommenderswithathankyouletterandupdatethemontheresultsofyourapplication.

TIP: Even if an employer has not requested a letter of recommendation, it could be very beneficial to send one along with your resume and cover letter. Many applicants do not, which could give you a competitive edge!

Providing References and Letters of Recommendation

See Appendix D for a sample reference page.


Including a cover letter with your resume is very beneficial and often requested by employers. A cover letter allows you the opportunity to expand on your experiences, clear up any misconceptions about your resume and explain to the employer exactly how your skills align with the position they are looking to fill. A cover letter should always accompany your resume unless instructed otherwise.

Getting StartedAs you begin to write a cover letter, have a copy of the job description close by. The points highlighted in your letter should align specifically with the skills outlined in the job description. Pick a couple of your strongest experiences and expand on them in your letter. The experiences you choose should coincide specifically with the skills required for the position. Below are some additional tips to keep in mind while writing a cover letter.

• Keep it to one page.• Use a font type and size that matches your resume.• Edit carefully for spelling, punctuation and grammatical errors.• Be direct and demonstrate enthusiasm.• Do not mass produce a cover letter—create one specifically for each job description.• Do not overuse the personal pronoun “I.”

Cover Letter FormatWhile each cover letter will be a little different, there are some proven strategies to help you catch the employer’s attention. Follow the tips below to help create an effective and easy-to-navigate letter.

Address BlocksTypically, at the top left hand side of the page, you should include your street address, followed by the date and the employer's address.

GreetingAddress your cover letter to a specific person. If the name is not listed in the job posting, you may research their website or contact the employer to determine the most appropriate person to address. If you are unable to find a contact person’s name,

“Dear Hiring Manager:” may be used.

Introduction ParagraphThe introduction paragraph should state the purpose for which you are writing. Be specific about the title of the position. If you were referred by a professional contact, you may state their name here. You will also want to include a sentence that grabs the attention of the employer to entice them to keep reading. Tell the reader what you will bring to the position in terms of skills and accomplishments, and how they align with the objectives of the position. Then go on to prove those skills in the following paragraphs.

Body Paragraphs The second and (optional) third paragraphs allow you to elaborate on the skills you mentioned in your introduction. Do not repeat verbatim the information on your resume. Instead, provide good examples of how your skills have been demonstrated. The best predictor of future behavior is past behavior. Thus, describe your past accomplishments and how they predict success in future endeavors.

One of the best ways to organize your accomplishments into a clearly understood paragraph is to use the CAR method. This method is also used to effectively answer behavior-based interview questions. The acronym CAR stands for Circumstance (give them an overview of what you are telling them), Actions (the actions you specifically took) and Results (the end result of your actions, or what you learned from the experience). Using this method to showcase your accomplishments provides proof that you have the skills the employer is looking for in a good candidate. See page 19 for an example.

Composing a Cover Letter


Closing ParagraphThe closing paragraph should provide a smooth transition. Skills are not the only factors that determine success; personal characteristics and the ability to interact with others are equally important. Therefore, complement the skills you highlight by describing personal qualities which will enable you to perform well. Also, ask the employer for an interview and include contact information. Keep in mind that a job search is a communications process. You initiate the process and YOU must follow-up.

See Appendix E for sample cover letters.


Networking is the key to finding internship or job opportunities. Most individuals know how to meet new people and find new contacts through friends, colleagues, mentors or online. However, when it comes to knowing the details of how to network, some are left without much guidance.

Who Do You Know?So, who do you know? The activity below will allow you to realize the many contacts you already have, who your contacts know and how you might begin to connect with them. A few examples have been provided below.

Networking

See Appendix F for sample networking letters.

What it IS What it is NOT

• Talking to people you know such as parents, friends of the family and alumni and/or asking them to introduce you to others.

• Volunteering in your community.

• Visiting with other members of different social or religious groups.

• Asking for a referral

• Striking up a conversation with someone while you are waiting in line.

• Meeting new contacts on LinkedIn, Facebook or other social networks.

• Attending professional or trade association meetings.

• A process of making cold-calls to people to whom you have no connection.

• Handing out as many business cards as you can to anyone who will take them.

• Just about you; it’s a two-way street (be prepared to return the favor).

• Just for professional purpose; it can be beneficial in multiple ways — it’s the act of building alliances.

• A careful choreographed process of meeting and greeting people.

• About quantity; it’s about quality of contacts.

• A onetime activity; it should be an on-going lifelong process.

Informal NetworkingLinking with the people you know

Formal NetworkingParticipating in formal events/opportunities

List all the people you know (e.g., friends, family, professors, community members, etc.).

List a person you might connect with who knows the person to the left of this column.

List events/opportunities and briefly describe how you would connect with people there.

Example 1: DadDad plays golf regularly with Mr. Smith, owner of XYZ company in our home town.

Ask to join them for lunch at the golf course to be introduced to Mr. Smith.

Example 2: Professor XDoes research for Eli Lilly on the side, and has several contacts there.

Make appointment with Professor X to ask about his connections at Eli Lilly.


Skills of a Good NetworkerBelow is a list of skills that good networkers will possess.

• Qualityvs.quantity—The number of people you know does not matter. It is the quality of your contacts that does. Who are the decision makers? Influencers? Who can help you and how?

• Slowdown—Get to know people not only from a business perspective, but also from a personal perspective.• Golowtech—In some cases, a quick phone call can be more efficient than many emails. Pick up the phone and even

find time to meet face-to-face. Email is excellent when sending documents or directions. Don’t overuse it.• Diversity—In the financial community, a diversified portfolio is preferable. The same is true with your network.• Introductionsrule—This is the ultimate in flattery when someone takes time out of their day to make the effort to

introduce you. This separates name droppers from the genuine networkers.• Practice3rdpartynetworking—Take the time to introduce two people so they can benefit from meeting each other.

Doing so will provide you the opportunity to reconnect with someone without any underlying needs. • Avoidlastminutenetworking—When the economy tanked, all of a sudden people discovered “networking.” They

called people in a panic asking for referrals or job leads. Try to build relationships before you need them.• Makerandom“hello”calls—When someone comes up in a conversation or comes to mind, make a random “hello” call.

You don’t need to have an agenda or reason, simply share that they were in your thoughts and you wanted to connect.• Unlearnshyness—If shyness is a challenge for you, start a conversation with a stranger in the elevator just before

you reach your floor. Say something quick—“great tie” or “have a nice day.” Too often shyness is misinterpreted as indifference and you don’t want to send that message. Think friendly.

Using Social Media as a Networking Tool A very high percentage of employers use social media sites such as LinkedIn (www.linkedin.com), Facebook (www.facebook.com) and Twitter (www.twitter.com) to promote job openings and locate qualified candidates. You may utilize these sites to expand your social and professional network, search for jobs and promote your skills and accomplishments. When participating in sites such as these, it will be very important for you to review your profiles to ensure that they convey the message that you would like employers to receive. If you have personal information that may hinder your candidacy, it is highly recommended that you remove these items.

LinkedInLinkedIn has become a highly valuable resource for both employers and students. Employers utilize LinkedIn to search for candidates for both internship and job opportunities, so it is highly recommended to build a complete profile to serve as your online resume. LinkedIn is also a very effective tool for locating individuals who are in organizations in which you are interested. Below are some tips for getting started on LinkedIn:

• Build a complete profile using your resume as a guide (e.g., education, experience, organizations, courses, projects, etc.).• Include a well-written and descriptive summary. • Add connections including professors, supervisors, coaches, teammates, mentors, alumni, etc.• Search your connections for second-degree connections. This is a great way to meet new people in your field and to

expand your professional network. Ask for introductions to individuals of interest.• Be open to introducing others who you feel may benefit from one another.• Join groups of interest, review job boards, and participate in discussions to help connect with others.• Start building your profile early on instead of waiting until you need your network.• Finally, be sure to keep your content professional including all status updates, headlines, and photos.

Facebook and Twitter Tips for Success• Make sure pictures, postings and other items on your Facebook profile are appropriate for employers to see, even if you

have it set to private.• Don’t talk negatively about a past or current employer.• Use these networks to promote your professional experiences, activities and interests.• Remember that employers may not have access to Facebook at work or personal e-mail 24/7; you must have patience

when communicating with them through social networks and sources. Following up through a source such as email or phone is encouraged.


Step-by-StepNetworkingTipsReview the networking tips below (adapted from jobbankusa.com).

• Buildrapport. State, “I was referred by (give name of mutual friend/colleague).” Then you may state, "I’m contacting you about a career matter, but let me assure you that I am not calling to ask you for a job — nor do I expect you to even know of any job openings. Let me start by telling you a bit about myself and my professional background…"

• State“whereyou’vebeen”byusinga“positioningstatement.” This is a succinct verbal statement that explains “who you are” professionally. Example: “I am a senior finance major at Butler University. My strengths include analysis, problem solving, communication and innovation. I have had two financial analyst internships which have further honed my skills and now I am seeking a full-time position after graduation to continue my passion for the financial field.”

• Shareyoursituation. This is a concise explanation of why you’re looking for guidance. Example: “Although I have many resources available here at Butler, I know that meeting directly with someone in my field of interest to gain valuable guidance and insight will be very beneficial to my career management.”

• Ifyouarealreadyoutintheprofessionalworld, you may use an “exit statement” to explain your situation as to why you left or want to leave your most recent position. Example: “As a result of a merger between two business units, over 1500 positions have been affected, including mine. I now have the opportunity to explore other career options in financial services that will leverage my proven strengths in analysis, problem-solving, communication and innovation.” The “exit statement” must be expressed in positive terms, so there will be no suspicion that you “did something wrong” to lose your job.

• Askforhelp.“Would you be willing to help me?”

• “Decompress.” Take the pressure off. Reassure your contact again that you are not asking for a job. Reiterate, “As I said, I am not asking you for a job, nor do I expect you to know of any appropriate positions. However, I am interested in any advice or guidance that you could offer, in addition to any networking contacts you could provide. (Give name of mutual friend/colleague) told me that you’d be a great person to talk to for this purpose. Would you be willing to review some of my credentials and give me candid feedback?”

• Askagainforhelp—andleveragethenotionof“sixdegreesofseparation.” Ask for contacts from your contacts! And always “come from generosity.” This means you should be on the lookout for opportunities to offer something of value in return. For example, if you hear of an opportunity that matches the skills set of one of your connections, pass the information along with an offer to connect them to someone within that organization. This gesture will let them know that you have them on your mind.

• Suggestatimetomeetandofferasignofthanks. Offer some days and times that are available on your calendar as possible dates to meet. If the contact responds back with a date and time that conflicts with class, work or other commitments, it’s okay to kindly ask if another time or date will work instead. Thank the contact in advance for their time and help. Example: “I know your input will be of great value, and I appreciate your willingness to help.”

• Follow-up. Follow-up after your networking meeting and keep the conversation going with a two-way value exchange; note that if the contact is a “center of influence,” try to have your follow-up discussion face-to-face instead of on the phone, unless the contact is outside your geographic region.

These steps are just a guideline. Feel free to change or add to any of the above steps to create an approach that is most comfortable and appropriate for you.


Ways to Connect at a Networking EventThere are some proven strategies to help you navigate your way through a networking event. Below are tips for how to prepare for such an event, ways to increase your chances of making connections and etiquette for follow-up correspondences.

Event Preparation Ways to Connect The Follow Up

• Review the list of attendees.

• Research their companies to create discussion points.

• Check to see if you know any contacts who work for the participating organizations so you may seek them out at the event.

• Think about your goals. What are you trying to gain from attending the event?

• If food is offered, eat beforehand.

• Bring business cards and copies of your resume.

• Attend the event alone or separate yourself from your friends upon arrival.

• Stand near the registration and/or food table.

• Study name tags, circle the room and scan for potential companies or contacts you want to meet.

• Look for people standing alone and sit next to people you don’t know well.

• E-mail or write a brief hand written note within 48 hours of making contact (See Appendix G).

• Don’t treat your new contact as a best friend. Show restraint in both frequency and length of your messages.

• Follow up from time to time with information or updates on your search to keep your contact active.

• Inform your networking contacts of major activity related to their recommendations.

• Send a revised resume to contacts in order to stay in touch.


A successful interview will be the result of prior preparation and practice. Below are some points to consider as you prepare to sell your strengths and experiences.

• Knowyourself. Analyze your interests, skills and accomplishments, not to mention your passions and dreams. Identify examples of success from your past experiences. You should be able to tell short stories that explain problems or situations you encountered, the action you took to solve those problems and the results of your actions. Present these scenarios to employers by focusing on the skills, abilities and personal traits that allowed you to achieve your successes. Try to make your scenarios relevant to the job for which you are applying. If possible, quantify your achievements.

• Identifytwoorthree“sellingpoints.” Distinguish your employment candidacy from that of others. A selling point could be an example of your strong leadership experience, your role in a meaningful community service project or direct experience in your field of interest. Determine how you will convey these points during the interview using the CAR model (See page 19 for an example).

• Researchtheorganizationpriortotheinterview. Employers expect students to perform research on the organization. Up-to-date information can usually be found on an organization’s website. Key facts to gather before interviewing include:

– Key people in the organization. – Major products or services. – Mission and vision statements. – Core values. – Size in terms of sales and employees. – Locations other than your community. – Organizational structure of the company. – Major competitors. – View of the company by clients, suppliers and competition. – Latest news reports on the company or on local or national news that affects the company.

• Acquireasmuchinformationaspossibleabouttheposition.What skills are required for this position? What are the position responsibilities? You may find it helpful to conduct an informational interview with someone who is currently working in a position similar to the one to which you aspire. Searching LinkedIn may provide you with several alumni and employer contacts that are willing to help.

• Rememberthattheinterviewisatwo-wayexchangeofinformation. Your goal is to discover if the organization is a good fit for you. The goal of the employer is to assess whether you are a good fit for their organization. Be sure to prepare questions about the position and organization.

• ParticipateinaMockInterview. A mock interview is strongly suggested to continually strengthen your interview skills. In a one-on-one setting with a qualified career advisor, your performance will be critiqued and you will receive immediate suggestions for improvement. To request a mock interview, contact the Internship and Career Services office at 317-940-9383 or [email protected].

Preparing for an Interview


Important Tips and Suggestions—Before the InterviewReview the tips below to help you prepare for an interview.

Notes:

Cell phone

• Leave it in your car or turn it off before you enter the building or meeting location to ensure that a call or text message won’t disrupt your important interview.

• Do not be tempted to leave it on and text or use other phone functions while you wait in the lobby for the interview.

Take contact information with you

• Always take the office or employer contact phone number with you. • This will ensure that you can notify the interviewer of your whereabouts if you face

unexpected circumstances such as illness, slow-moving traffic, an accident, flat tire, road closures, etc. However, always plan ahead to allow yourself plenty of time.

Know where you are going

• Make sure you are aware of your meeting location and the best route to get there. • If time allows, practice a “test run” and drive to the location a few days before your

meeting. • Also, determine where you need to park before the day of your interview, especially if it

is a meeting in a location with limited or metered parking.

Take a padfolio

• Carry along a padfolio that will allow you to store extra copies of your resume and references just in case you need them along with other information such as articles or company web pages to review while you are waiting for your interview.

• You can also write down your questions and tuck them in the padfolio to have ready at the close of the interview.

• If you don’t have a padfolio, check with the Butler bookstore or ask to borrow one from a friend or advisor.


Behavior-Based InterviewsA behavior-based interview focuses on experiences, behaviors, knowledge, skills and abilities that are job related. It is premised on the belief that past behavior and performance predicts future behavior and performance.

The CAR model of interview preparation provides you with a systematic way to practice and become familiar with behavior-based interviewing. The CAR system allows you to tell the interviewer a “story” (with a beginning, middle and end) about how you achieved a goal. Use work experience, activities, hobbies, volunteer work, school projects—anything that would be considered strong examples of your past behavior.

You may also follow-up your CAR response with a brief statement explaining the connection between your example and how it aligns with the objectives of the position. This approach is especially helpful if the example isn’t field-specific as it will help demonstrate how your skills and experiences can transfer over to the new position.

Your answers should be approximately 60 seconds in length.

CAR ModelQuestion:Can you tell me about a time when you were faced with an angry person?

C (Circumstance) A (Actions) R (Results)

Provide the interviewer a brief overview of the circumstance you will be telling them about. It is a method for beginning your story.

After setting the stage by describing the circumstance, tell the interviewer the specific actions you took to resolve the problem or situation.

This is the MOST IMPORTANT step of your answer. Your interview goal is to demonstrate a results-oriented background. Connect your accomplishments to the position you are seeking. Even if the results didn’t turn out as you had planned, tell the interviewer what you learned from the experience and what you would do differently next time.

Example:

This past summer, I had an internship at a technology firm and was responsible for answering customer calls and assisting them with their software issues. One particular day I received a call from a client who was very upset. He was yelling at me over the phone because his computer program was not working properly.

Example:

I remained calm and listened carefully to his explanation of the problem and took notes as he explained. Once he was finished, I responded by restat-ing his problem to ensure that I had the correct information and told him how I understood why this was such a serious concern for his business. I then explained the steps that I was going to take next. Rather than having him complete the fix just over the phone, I remotely connected to his computer and talked him through the steps I was taking. When I was finished with the fix, the program appeared to start up properly. However, I asked him if he would send a test through while I was still connected so we could watch it together to ensure everything was working properly.

Example:

His test went through great, and he reassured me that the problem was re-solved. I followed up the next day with a courtesy call to check in with him. He apologized for his initial reaction and thanked me for being so thorough. The client actually went on to purchase additional products from our company.


Behavior-Based Interview QuestionsBelow are some examples of behavior-based interview questions that you may encounter during your next interview.

Organization and Planning Skills• Describe a specific situation which illustrates how you set objectives to reach a goal. • Tell me about a time when you had to choose between two or more important opportunities.• Tell me how you normally schedule your time in order to accomplish your day-to-day tasks. • Describe a situation where you had a major role in organizing an important event. • Think about a lengthy term paper or report that you have written. Describe how you organized, researched and wrote

that report. • Give an example of how you organized notes and other materials in order to study for an important exam. • Describe a time when you reorganized something to be more efficient.

Interaction and Leadership• Tell me about an event in your past which has greatly influenced the way you relate to people. • Give a specific example that best illustrates your ability to deal with an uncooperative person. • Tell me about a time when you had to work with someone who had a negative opinion of you and how you overcame

this. • Recall a time when you participated on a team. • Tell me an important lesson you learned that is useful to you today. • Describe an instance when you reversed a negative situation at school, work or home.• Describe a situation which best illustrates your leadership ability. • Think about someone whose leadership you admire. What qualities impress you?

Assertiveness and Motivation• Describe several work standards that you have set for yourself in past jobs. Why are these important to you? • Tell me about a time when you experienced a lack of motivation and how you overcame this. • Describe a situation where you had to work with someone whom you felt was dishonest. • Describe a situation that made you extremely angry. • Tell me about a time that best illustrates your ability to persevere in a tough situation. • Describe a time when you motivated an unmotivated person to do something you wanted them to do. • Give me an example of when someone tried to take advantage of you and how you reacted.

Decision Making and Problem Solving• Give an example that illustrates your ability to make a tough decision. • Tell me about a decision you made even though you did not have all the facts. • Describe a situation where you had to “stand up” for a decision you made, even though it was unpopular. • Describe a situation where you changed your mind, even after you publicly committed to a decision. • Describe a situation that illustrates your ability to analyze and solve a problem. • Tell me about a time where you acted as a mediator to solve a problem between two other people. • Describe a problem that seemed almost overwhelming to you and how you handled it. • Tell me about a time where you have used a creative or unique approach to solve a tough problem.

Typical Interview Questions• Tell me about yourself. • Why did you attend Butler University? • Why do you want to work for our company?• What do you know about our company?• What led you to choose your major or career field? • What are some issues being faced by our profession?• What college subjects did you like best/least? What did you like/dislike about them? • What has been your greatest challenge in college? • Describe your most rewarding college experience.• If you could change a decision you made while at college, what would you change?


• What campus involvements did you choose? What did you gain/contribute? • What are your plans for continued or graduate study? • What interests you about this position? • What challenges are you looking for in a position? • How have your educational and work experiences prepared you for this position? • What work experiences have been most valuable to you and why? • Why are you interested in our organization? • In what way do you think you can contribute to our company? • What do you consider to be your greatest strength? Weakness?• What accomplishments have given you the most satisfaction? Why? • What are your long-term career objectives? How do you plan to achieve these? • How would you describe your ideal position? • What two or three things are most important to you in your job?

Questions You Can Ask EmployersInterviews are two-way conversations with a purpose. Thus, you need to ask well-formulated, intelligent questions that demonstrate your knowledge, maturity and interest in the organization. Equally important, you need to ask questions that will help you assess your fit with an organization.

Below are some examples of questions you may ask the employer at the end of an interview.• Please describe the typical career path of a _________ in this department/organization. • What issues or concerns are facing this department/organization? • What are the goals for this department/organization for the near future? • What new projects have this department/organization recently undertaken? • Why do you enjoy working for this organization? • Who are the people with whom I would be working? Can you tell me a little about them? • What professional development opportunities are available in this organization? • What direction do you see this organization going in the future? • What is the relationship of this organization with the local community? • Do you encourage participation in community or professional activities? • How would you describe the most successful employees in this organization? • What characteristics do you possess that have made you successful with this organization? • What do you wish you had known about this organization before you began working?• What do you think differentiates this organization from the competition? • Can you tell me where the process will go from here? (This will help you determine how quickly the company plans to

make a decision)

“Stress” QuestionsIn some cases, employers have been known to ask “stress” questions. The purpose is to catch you off guard and see how you react to an unexpected question or scenario. Typically, there are no right answers to these questions. The keys to successfully answering a “stress” question are to remain calm and justify why you chose your answer.

Sample Stress Questions:• Why is a manhole cover round?• If you could be a tree, what would you be?

Sample Answers:• A manhole cover is round because a manhole is round. The cover fits perfectly and keeps people and cars safe from injury.• If I could be a tree, I would be an apple tree because I would be able to create a product and share it with others.


Handling Illegal Interview QuestionsVarious federal, state and local laws regulate the questions a prospective employer can ask you, the job candidate. An employer’s questions—whether on the job application, in the interview or during the testing process—must be related to the job you are seeking. For the employer, the focus must be: “What do I need to know to decide whether this person can perform the functions of this job?”

If asked an illegal question, you have three options:

• Youcananswerthequestion. You are free to do so, if you wish. However, if you choose to answer an illegal question, remember that you are giving information that isn’t related to the job. In fact, you might be giving the “wrong” answer, which could harm your chances of receiving a job offer.

• Youcanrefusetoanswerthequestion, which is well within your rights. Unfortunately, depending on how you phrase your refusal, you run the risk of appearing uncooperative or confrontational—hardly words an employer would use to describe the “ideal” candidate.

• Youcanexaminethequestion for its intent and respond with an answer as it might apply to the job. For example, if the interviewer asks, “Are you a U.S. citizen?” or “What country are you from?” you’ve been asked an illegal question. You could respond, however, with “I am authorized to work in the United States.” Similarly, let’s say the interviewer asks, “Who is going to take care of your children when you have to travel for the job?” You might answer, “I can meet the travel and work schedule that this job requires.”

* See Appendix H for examples of illegal questions

Tough Interview Questions and Response Starters

Tell me about yourself.This is one of the most common interview questions and also one of the most difficult to answer. It is important that you share the proper information with the employer. This is typically the first question of the interview, so it is your chance to make a great first impression. Refrain from providing personal information and instead start selling your skills right from the start.

To help construct your answer, start by reviewing the job description and pick out two or three of the skills that the employer is looking for that you also possess. Then, provide brief yet convincing examples from your past that proves that you have the skills they are looking for in a candidate.

Example Framework: "If I could describe myself in three qualities, I would say that I am very motivated, an excellent writer and very passionate about the field." Then provide experiences from your past that showcase these qualities. You can follow up your answer with a statement about how possessing these qualities will make you very successful in the position for which you are applying.

What is your greatest weakness?It is important not to respond with an answer that is too incriminating (e.g., I have a hard time staying motivated). Instead, state an area that you have already begun to improve upon. You may briefly state the weakness and then spend a majority of the time discussing the steps you have taken to address it, and your plan going forward to ensure that it is resolved.

Example: I recently found myself getting over-involved in too many activities and I wasn’t able to give 100 percent to all of them. I have started to be more selective in the activities that I become involved in, so I can dedicate more of my attention to the ones I am most passionate about. Going forward, I will continue to work on making a conscious effort to be selective in my involvement and will politely decline an invitation if I know my schedule is already full.

What do you look for in a job?When preparing an answer to this question, first think about what is important to you in a position. Then share the aspects that align with what the employer is looking for in a candidate. The motive behind this question is to see if what you are looking for in a position aligns with what they are looking for in a candidate. To help construct this answer, review the job description and the requirements that they list. This will give you a good starting point for finding those areas that are a match.


How long would it take you to make a meaningful contribution to our organization?When an employer hires you, he/she is making an investment in you and wants to see a return on investment happen quickly. Here, the employer is trying to gauge how quickly you will be able to contribute to their team. Be confident in your response and indicate your skill in learning and applying concepts quickly. You may also provide an example of how you have done so in the past.

Why are you leaving your present position?Never answer with negative reasons (e.g., I didn’t like my boss), even if it is true. Frame your answer positively by answering why you want to move to the target company instead of why you left or want to leave your most recent position. In your approach, be honest. You don’t want something to come up later in your references or a background check that may discredit you. For difficult situations, talk to your career advisor to construct a proper approach to this question.

Why should we hire you?Keep your response brief. Recap any job requirements the interviewer mentioned earlier in the interview, then, point by point, match your skills, abilities, and qualifications to those items. Relate a past experience which represents success in achieving objectives.

For example, "I think I am the ideal candidate because I have the organizational, communication and creative skills you desire along with proven leadership and on-the-job experience." Then recap them and state how each of these items align with the position.

What salary do you expect if we offer this position to you?This is a tough question to address. Ideally, before you go into the interview, you should research the market value of the position based on location and analyze your monthly budget to determine a realistic salary range. Beforehand, prepare a spreadsheet and tuck it away in your padfolio just in case you need to refer to it during the interview. Being prepared and showing the employer that you have done your research will be more impressive than simply suggesting a salary you desire. To answer the initial question, try to avoid giving an actual figure by expressing your interest in the job because it fits your career goals and mention that you would expect a fair salary based on the job responsibilities, your experience and skills and the market value of the position.

Example: If I were offered the position, I would be open to a competitive offer based upon my experience and skills.

If you are asked to provide a salary range, be prepared to provide the research mentioned above to suggest a salary range. You may suggest a range within the 10,000’s such as $30,000–$40,000.

For example, "I have researched the market value of the position based on my experience and determined a reasonable and competitive salary range of $35,000 to $45,000."

If you would like an opportunity to practice these questions in a professional setting, you may contact ICS to schedule a mock interview with a career advisor.


What you wear to an interview as well as your everyday work attire have a large impact on how you are perceived professionally. Below we will discuss what to wear to an interview (or when business professional is required) as well as some tips for business casual, and what exactly that means.

Interview Attire (Business Professional)Wearing inappropriate attire to an interview can form a negative first impression and could certainly cost you the job. It is strongly recommended that candidates wear a suit to an interview. Below are some tips for wearing business professional:

Women• Dark suit (pants or knee-length skirts are acceptable)• A nicely pressed blouse or conservative shirt with appropriate neckline• Closed-toe dress shoes (maximum heel height of three inches)• Neat, well maintained hair and conservative makeup• Minimal or no perfume • Minimal and subtle jewelry • Clean, trimmed fingernails (clear or conservative polish)• Minimal accessories/bags—a small purse and a padfolio is appropriate

Men• Dark suit (e.g., navy, gray, black) • White or light-colored pressed dress shirt with conservative tie• Dark, polished dress shoes, dress socks, and matching belt• Neat, well maintained hair (including facial hair if applicable)• Minimal or no cologne• Clean, trimmed fingernails• Padfolio to carry copies of your resume, business cards, etc.

Business CasualThe term “business casual” can be confusing and should not be mistaken for “casual” dress. Items such as jeans, t-shirts, and flip-flops are not considered to be business casual. Business casual is typically one step below “business professional” dress. For example, this could mean, for a woman, dress pants or skirt (with appropriate length) minus the suit jacket. For men, it may mean forgoing a tie. At some organizations, items such as khaki pants, sweaters, cardigans, and dresses (with appropriate length and neckline) and adding in your personal style/splash of color are appropriate.

Review the company handbook (if applicable) to review the dress code. Also, dress more conservatively the first few days of the job to gauge what others are wearing and then adjust as needed.

Please visit the ICS Pinterest page for examples: www.pinterest.com/butlerics.

What to Wear


Sometimes if a candidate lives a great distance from the offices of the company then it may not be practical to attend preliminary interviews in person. In this case, an interview can be conducted over the phone or via Skype.

Preparing for the Phone InterviewPreparation for a phone interview is as important as preparation before any other form of interview or meeting. The impression you create in the opening moments, and the manner with which you present yourself will determine whether or not you will be successful. Read through the following tips to help you prepare for your next phone interview.

• Findoutasmuchasyoucanaboutthecompanyandthejobdescription.If your telephone interview has been arranged by a third party, you should receive much of this information from them. But in any case, do your own research. Company websites are one of the best sources of information. Find out about the size and structure of the company, its products and its markets.

• Haveanotepadandpenready, along with your calendar.

• Makeanoteofanyquestionsyouwouldliketoask. Have these questions written down. Ask about things if they are important to you, especially if your decision whether to proceed depends upon the answers (e.g., Will I have to relocate?). Otherwise, ask other questions such as ‘What training will be provided?” or “What opportunities are there for advancement?” See the "Questions you can ask employers" section on page 21 for ideas.

• Haveyourresumeathand.In all probability the hiring manager will have a copy of it too, so you probably won’t be asked to describe your background in detail.

• Prepareexamplesofprojectsoralistofactivities.Remember, the interviewer cannot see you. So, why not have important examples of your work in front of you to jog your memory or to remind you to include these examples in your interview?

• Prepareinwriting. Write a very brief plotted history to respond to the “Tell me about yourself ” statement. Managers ask this not because they want the information from your resume, but because they want to listen to you, to find out how communicative you are. This is a great place to introduce the skills/qualities you possess that align with the position.

• Findaquietplacewhere you will not be interrupted or distracted.

• Dressasyouwouldforanin-personinterview.Although the employer won't see you, dressing in interview attire can help you come across more professionally in the interview.

During the Phone Interview• Howtobehave. Speak in a clear voice, answer the interviewers questions precisely, try to elaborate without talking too

much, exude controlled professionalism and smile.

• Bereadytohandlethesurprisecall. Develop some sort of stall tactic (such as “If you don’t mind, I’d like to move to another phone so that we will have more privacy,” or “Let me shut the door”) to allow you a few seconds to relax and collect your thoughts.

• Rehearseyourresponses. Once on the phone, candidates tend to ramble. Be succinct and avoid the urge to over amplify your answers. Remember, the average individual listens for only 30–45 seconds at a time. Therefore, carefully prepare examples that will last no longer then a minute. While being brief, however, avoid yes or no answers, as they give too little information. Make sure to include key points and answer questions directly.

• Role-playtheinterview.During the course of a phone interview, candidates should try to match the interviewer’s voice tone, pitch and delivery speed. Enlist a friend or family member, support group member or other coach to call you at an appointed time and run through the interview. This will only work if both of you agree to be in character during the entire mock interview. After the interview (at least 30 minutes) is completed, de-brief to determine overall impressions and areas for improvement.

Interviews at a Distance


• Beawareofmannerisms, such as repeated phrases (e.g., Ending sentences with “and that,” starting sentences with “like,” “you know” or “I mean,” etc.) or nervous laughs. These mannerisms can be distracting and can hamper professional delivery. Often times individuals with these mannerisms are completely unaware of them. Schedule a mock interview with ICS to help improve the delivery of your interview answers!

• Watchyourmouthwhiletalkingonthephone. Keep your mouth about an inch from the mouthpiece to avoid sounding faint or muffled.

• Selectivelysmileduringthecourseoftheinterview. Though no one can see you, smiling will make your voice sound positive, confident and upbeat.

• Donoteatorchewgumwhileonthephone. The sound carries and will not leave a positive impression.

• Keepupyourendoftheconversation. It is fine to let the interviewer do most of the talking, but be prepared with some questions of your own. Prepare several questions concerning responsibilities, the characteristics that will contribute to success in the position, etc. Write them down and keep them by the phone.

• Takenotesduringtheinterview.These will be tremendously helpful in preparing for future interviews and will help you keep track of points to remember.

• Gofortheclose.The whole point of the phone interview is to move you forward to the next stage of the search process. If the interviewer has not established the next steps by the end of the conversation, it is your turn to take the initiative. Tell him or her how interested you are in the position, how much you could contribute and ask when things might move forward.

Preparing for a Skype InterviewMany of the rules for an in-person and phone interview also apply to a Skype interview. For example, you still want to dress professionally, have good posture, exhibit your interest in the position, and prepare and practice your interview answers beforehand. However, there are some additional tips for this type of meeting.

• Chooseaprofessionalsettingfortheinterview.Remember that the interviewer is not only going to see you, but also the scenery behind you. Therefore, you may not want to conduct your Skype interview in your residence hall room. Instead, you may choose to reserve a conference room or ask to use an available room in the Internship and Career Services office.

• BecomefamiliarwithSkypebeforetheinterview.Practice a Skype session with a friend before your actual interview to help you get acquainted with the program and how it works. Also, test out your microphone and speakers to ensure there are no known problems and make sure lighting is conducive in the setting.

• Turnoffanyapplicationsonyourcomputerthatdistributesound.For example, close Outlook so that the notification sound doesn't alert you each time an email arrives.

• Maintaineyecontact.The same rule applies to in-person interviews, but it's slightly different in a Skype interview. Remember, the camera is their eyes in this case. So if you watch their face as you are speaking, on their end you may appear to be looking down. Instead, look into the camera as you speak to give the perception of making eye contact.


Immediately following the interview it is important to submit a simple thank you letter. Thank you letters are an easy way to show gratitude to the interviewer for the time spent discussing your interests and opportunity with the company. These letters can go far in showing professionalism, interest, and enthusiasm.

Thank you letters should be clear and concise. They should include a brief statement about when and where the interview occurred, and your expressed thoughts of appreciation. This letter is also a good time to sell yourself one more time to the company. Reiterate a couple of your skills or specifics that you learned during your time at the interview. When faced with multiple interviewers, be sure to follow-up with each of them with a personalized letter.

Send your thank you letter promptly, preferably within 24 hours of the interview. If you choose to send your letter via postal mail, keep in mind the delivery time of the mail as well as the time line of the company’s hiring process. You want to ensure that your letter arrives prior to their final decision. One option is to e-mail a thank you letter right after the interview, and follow up with a hand written or typed letter.

After the Interview

See Appendix G for a sample thank you letter.

A small percentage

of candidates send

thank you letters,

so taking the

initiative to send

these personalized

correspondences

can certainly help

set you apart!


As you enter into a new workplace, whether it’s an internship or your first full-time position as a new graduate, below are some suggestions for making a great first impression and for gaining the most from the opportunity.

1.Helpwhereneeded,withouthesitation. Don’t avoid or complain about some of the less glamorous parts of the position. Most professionals have had to incorporate different types of tasks into their daily roles, some that aren’t very exciting. However, every task has value. Take a moment to see how it fits in with the bigger picture. As you master tasks and show that you are willing to help where needed, chances are your responsibilities will increase. Having a positive attitude will take you far in the workplace!

2.Volunteerforprojects.Take the initiative and ask for additional work if you find yourself having excess time after completing your regular role. Look for ways to be innovative and find creative ways of helping the company succeed. Doing so shows employers that you want to fully utilize your time at their organization and it will help make a great impression. Just make sure you don’t volunteer for too many projects and get overwhelmed. Carry a healthy balance of assignments that allows you to produce quality work.

3.Gettoknowyourco-workers.During the first few weeks, see if you can set up meetings with individuals in your office to learn more about their role in the organization. This will allow you to see how the office works and also provide you an opportunity to get to know the team you will be working with. You may also receive helpful tips on how to succeed in the organization.

4.Learnaboutyourindustry. It is very helpful to learn about the industry in which you are working. Learn the history, the language, and any other important pieces of information. The more you know your industry, the more prepared you will feel for your line of work.

5.Findamentor.Seek out individuals in the organization who have achieved some of the goals that you would also like to reach. Reach out to them for guidance and advice throughout your time at the company. Later in your career, you may then choose to become a mentor to those just entering the field.

Below are some quick tips on what to avoid in the workplace:• Being late to work• Texting and personal internet browsing• Dressing too casually• Sharing too much personal information• Using offensive language• Dating a co-worker• Talking negatively about co-workers, past supervisors, etc.• Gossiping

Success Tips for Interns and Young Professionals


Appendix A: Action VerbsThe words in bold are especially good for pointing out accomplishments.

Management Skills

Communication Skills

Research Skills

Creative Skills

Clerical or Detail Skills

administeredanalyzedassignedattainedchairedconsolidatedcontractedcoordinateddelegateddevelopeddirectedevaluatedexecutedimprovedincreasedorganizedoversawplannedprioritizedproducedrecommendedreviewedscheduledstrengthenedsupervised

addressedarbitratedauthoredcollaboratedconvincedcorrespondeddevelopeddirecteddraftededitedenlistedfacilitatedformulatedinfluencedinterpretedlecturedmediatedmoderatednegotiatedpersuadedpromotedpublicizedreconciledrecruitedtranslated

clarifiedcollectedcritiqueddiagnosedevaluatedexaminedextractedidentifiedinspectedinterpretedinterviewedinvestigatedorganizedreviewedsummarizedsurveyedsystematized

actedconceptualizedcreatedcustomizeddesigneddevelopeddirectedestablishedfashionedfoundedillustratedinitiatedinstitutedintegratedintroducedinventedoriginatedperformedplannedrevitalizedshaped

approvedarrangedcataloguedclassifiedcollectedcompileddispatchedexecutedgeneratedimplementedinspectedmonitoredoperatedorganizedpreparedprocessedpurchasedrecordedretrievedscreenedspecifiedsystematizedtabulatedvalidated

Financial Skills

Technical Skills

Teaching Skills

Helping Skills

More Accomplishments

administeredallocatedanalyzedappraisedauditedbalancedbudgetedcalculatedcomputeddevelopedforecastedmanagedmarketedplannedprojectedresearched

assembledbuiltcalculatedcomputeddesigneddevisedengineeredfabricatedmaintainedoperatedoverhauledprogrammedremodeledrepairedsolvedupgraded

adaptedadvisedclarifiedcoachedcommunicatedcoordinateddevelopedenabledencouragedevaluatedfacilitatedguidedinformedinstructedpersuadedstimulatedtrained

assessedassistedclarifiedcoachedcounseleddemonstrateddiagnosededucatedexpeditedfacilitatedfamiliarizedguidedmotivatedreferredrehabilitatedrepresented

achievedexpandedimprovedreducedresolvedrestoredspearheadedtransformed


Appendix B: Sample Resume—LAS Student

Marcel [email protected]

4600 Sunset Ave, Indianapolis, IN 46208(317) 940-9383

OBJECTIVESeeking a full-time position in collegiate admissions where I may utilize my strong assessment skills, recruiting capabilities, and program coordinator experience to increase new student retention.

EDUCATIONBachelor of Arts in Psychology May 2014Butler University, Indianapolis, INGPA: 3.63/4.0Honors: Cum Laude, Honors in French, Pi Delta Phi, Student Employee of the Year Award

HIGHER EDUCATION AND LEADERSHIP EXPERIENCETransfer Student Advisor August 2010–PresentLearning Resource Center, Butler University• Contact students prior to their transfer to provide instructions for placement exams and registration• Administer detailed information for each student according to their individual major and interests• Guide students through each step of the transfer process in order to ease their transition to a new campus

Peer-Tutor Program Coordinator January 2014–June 2014Learning Resource Center, Butler University • Recruited tutors through academic departments and provided detailed information about the program• Conducted interviews with tutors and trained them on effective study and note-taking techniques• Liaised between professor and student regarding study plan to further academic success of the student

Academic Program Researcher August 2010–June 2014Learning Resource Center, Butler University• Increased student retention 40 percent by creating designated transfer wings in the residence halls• Improvedefficiencybydispersingnewstudentregistrationsoveraseriesofnineseparatesessions• Co-createdsocialactivitiesforfirst-yearstudentsinordertoestablishaninteractiveenvironment

Transfer Student Program Coordinator August 2010–June 2014Learning Resource Center, Butler University• Improved transfer student retention rates by implementing events tailored to serve their individual needs• Designed a campus guide containing resources and contact information to help familiarize transfer students

with the administrative, academic and social aspects of Butler• Organized multiple social gatherings between new and current transfer students in an effort to create new

friendships as well as aid them in seeking their niche on campus

VOLUNTEER EXPERIENCEFreshman Experience Committee Member, Butler University September 2011–April 2014Red Cup Culture Facilitator, Butler University September 2010–May 2013ECO Student Organization, Butler University September 2010–May 2013

PROFESSIONAL WORK HISTORYWebsite Administrator, Learning Resource Center, Butler University September 2012–June 2014Program Evaluations Coordinator, Learning Resource Center, Butler University July 2012–June 2014


Appendix B: Sample Resume—Media Arts

OBJECTIVESeeking a full-time position in audio or video production where I may utilize my proven skills and experience in digital audio editing, production, and design.

EDUCATIONBachelor of Arts in Media Arts May 2013Butler University, Indianapolis, INConcentration: Recording Industry StudiesGPA: 3.7/4.0

Coursework Included: Audio Track Production, Theories and Techniques in Recording, Multi Track Recording, Legal Issues in Recording and Music, Audio for Film and Video

Honors: Dean’s List, Bulldog Blue Ribbon Award, Mortar Board, and Golden Key Honor Society

TECHNICAL SKILLSExperience with Pro Tools, Peak, Digital Performer, Adobe Audition, and Digidesign digital interfaces

MEDIA ARTS EXPERIENCERadio Production Intern May 2012–July 2012Radio Station, Indianapolis, IN• Produced 60 second radio spots by cutting, editing, and processing sound effects using Pro Tools• Trainedandsupervisedfivevolunteerstohelpproducebroadcastqualityaudioforlisteners• Assemble and created promotions and on-air programs tailored toward target audiences• Maintained website by creating and editing content including both audio and visual elements

President September 2010–August 2011Butler University Recording Industry Club, Indianapolis, IN • Developed and maintained strong relationships with entertainment industry professionals to help increase

the organization's professional network• Contributedtoplanningandpromotingprofessionalconferencesandbenefitconcertstoincreaseattendees• Provided leadership and support to successfully achieve the goals and learning objectives of the

organizationEXPERIENCE

Office Manager August 2009–PresentABC Company, Indianapolis, IN• Createdafilingsystemfordonors,resultinginasubstantialtimesavingsforstaffmembers• Collectedandanalyzedcustomersatisfactionsurveytohelpimprovememberbenefitsandservices• Supervisedandtrainedfivevolunteersoncommunityserviceprojecttohelpraiseover$3,000forthe

American Red CrossLEADERSHIP AND COMMUNITY SERVICE

Mentor, College Mentors for Kids August 2010–PresentVice President, Alpha Chi Omega January 2009–PresentActive Member, Peers Advocating Wellness (PAWS) September 2009–PresentVolunteer, Riley Children’s Hospital March 2009–August 2009

Jo [email protected]



Appendix B: Sample Resume—Experienced Computer Science

Landen [email protected]


OBJECTIVESeekingaleadershippositioninanon-profitorganizationthatwillallowmetoutilizemyadvancedtechnicalskills, management abilities, and strong work ethic.

EDUCATIONBachelor of Science in Computer Science May 2009Butler University, Indianapolis, INMinor: SpanishGPA: 3.8/4.0

TECHNICAL SKILLSProficientinHTML,CSS,XML,XSL,XSLT,XSD,KML,JavaScript,Java,PHP,MSSQL,MySQL,FlashAction Script, Microsoft and Linux operating systems

TECHNOLOGY EXPERIENCETechnology Specialist May 2013–PresentTechnology Company LLC, Chicago, IL • Design internal business process plans to maintain proper change request management system• Advisemanagementoftechnologypurchasingneedsinexcessof$1,000,000peryear• Negotiate discounts with top vendors to reduce business operation costs a minimum of 10%• Developed an internal strategic implementation plan to integrate existing data center into a three tier, high

security, high availability network architecture

Network Consultant September 2011–April 2013Independent Contractor, Indianapolis, IN• Guided the decision making process for the redesign of an organization's network infrastructure• Administered a 24/7 secured data warehouse to ensure 99% reliability for over 3,000 end users• Designed an implementation plan to facilitate a seamless transition to a self-reliant infrastructure• ImplementedandmaintainedaVOIPphonesystemwhichresultedinacostreductionof$40,000peryear

Network Analyst May 2009–September 2011Independent Contractor, Indianapolis, IN• Managed an international network with over 200 end users, allowing reliable and secure connectivity• Controlledtechnologyrelatedpurchasesof$500,000peryearandnegotiateddiscountswithvendors• Administered400userPBXphonesystemensuring99.9%reliabilityatalltimes• Developedover15automationtoolswhichincreasedproductivityandreducedtheriskoferrors

VOLUNTEER EXPERIENCEWebsite Administrator Volunteer, Helping Hands Community Center May 2012–PresentDatabase Design Volunteer, Southport Heights Elementary School June 2011–PresentVolunteer, Habitat for Humanity Summer 2009, 2010, 2011Youth Volunteer, YMCA of Indianapolis April 2009–June 2010


Appendix B: Sample Resume—Dance

Jennifer [email protected]


OBJECTIVESeeking a dance instructor position at the collegiate level where I may utilize my solid ballet foundation, diverse pedagogy, and strong advising skills to prepare future dancers, choreographers, and dance administrators.

EDUCATIONBachelor of Arts in Dance Pedagogy May 2010Butler University, Indianapolis, INGPA: 3.84/4.0Coursework Included: Ballet Technique, Pointe, Pas de Deux, Jazz, Modern, Teaching Practicum

Honors: Cum Laude, Arts Council of Indianapolis Fellowship, Chataqua Dance Festival Scholarship

DANCE PEDAGOGY AND CHOREOGRAPHY EXPERIENCECo-Artistic Director, Ballet Instructor June 2012–PresentIndianapolis School of Ballet, Indianapolis, IN• Develop original and engaging works for the company repertoire in an effort to introduce pre-professional

students to performance methods in ballet, modern, and jazz• Mentor and coach advanced students during weekly rehearsal of classical ballets to imbue a deeper

appreciation of ballet's origins and thereby strengthen their performance skills• Improveballettechniqueforbeginningthroughadvancedlevelsbytargetingspecificlearningstyles

Ballet and Pilates Instructor September 2010–May 2012Jordan College Academy of Dance, Indianapolis, IN• Taught and inspired pre-professional dancers ages four to eighteen to achieve their fullest potential • Prepared weekly lesson plans complete with musical accompaniment for ballet and pointe techniques• Alleviated injuries and increased strength and physiological alignment through pilates mat classes

Student Choreographer August 2009–May 2010Butler Ballet, Indianapolis, IN• Collaborated with fellow dancers to create original ballet and modern pieces for Butler Ballet repertoire• Choreographed modern solo for pre-professional student dancing in Indianapolis Prelude Competition• Created a unique Pas de Trois in collaboration with Butler cellist for the annual Penrod Arts Fair

DANCE PERFORMANCE EXPERIENCEButler Ballet, Indianapolis, IN August 2006–May 2010Ballet West Summer Intensive, Seattle, WA July 2009–August 2009Chataqua Dance Festival, Chataqua, NY June 2008–August 2008Hubbard Street Summer Intensive Showing, Chicago, IL July 2007–August 2007

LEADERSHIP AND COMMUNITY SERVICELead Teacher, Dance for Parkinson's, Indianapolis, IN September 2012–PresentYoung Alumni Board Member, Butler University, Indianapolis, IN June 2010–Present

DANCE CERTIFICATIONSPilates Reformer and Mat Method, Indianapolis, IN July 2010


Appendix B: Sample Resume—Chemistry

Liam [email protected]


OBJECTIVESeekingalaboratorybasedinternshipforthesummerof2015whereImayutilizemyfoundationalchemistryknowledge, lab experience, and attention to detail.

EDUCATIONBachelor of Science in Chemistry May 2016Butler University, Indianapolis, INMinor:Biology GPA:3.5/4.0Honors: Dean's List, National Chemistry Honorary Society NomineeRelevant Courses: Organic Chemistry, Analytical Chemistry, General Chemistry, Biochemistry, Calculus I, II

CHEMISTRY EXPERIENCEChemistry Lab Assistant January 2014–PresentButler University, Indianapolis, IN • Teach and monitor laboratory procedures to ensure safety and prevent chemical contamination• Reviewconceptsandprovideclarificationstostudentstoverifyunderstandingoflecturematerial• Assist students in applying meaningful connections from concepts discussed in lecture to lab work• Evaluate assignments and ensure students are able to draw conclusions from their work

Laboratory Coursework August 2013–PresentButler University, Indianapolis, IN• Analyze chemical compounds using various techniques such as HNMR, CNMR, and Mass Spectroscopy• Maintain detailed and accurate recordings and generate standard calibration curves for comparisons• GainedexperiencewithvariousinstrumentationmethodsincludingGC,ICP-MS,HPLC,gelfiltration

chromatograph, and UV-VIS spectrophotometer• Analyze unknown samples using a variety of experimental techniques including titrations, SDS-PAGE,

Native-PAGE, and gel electrophoresis• Designedanexperimentthatresultedintheidentificationofanunknownorganiccompound• Acquiredskillsinthesynthesisandpurificationofchemicalcompoundsinahands-onsetting

RELATED VOLUNTEER EXPERIENCEScience Exhibit Volunteer, WonderLab, Bloomington, IN Summer 2014• Encouraged visitors to interact with hands-on exhibits including the science of sound, investigating light,

color and gravity, and exhibits related to health and the human body• Demonstrated the properties of light through an interactive exhibit of colored and frozen shadows

Chemistry Tutor, Perry Meridian High School, Greenwood, IN September 2012–June 2014• Tutored beginning chemistry students to ensure they understood the content presented by the instructor• Increasedstudentunderstandingwhichresultedinhighertestscoresandincreasedconfidence• Posed open ended questions and created hypothetical situations to help students investigate problems

LEADERSHIP AND STUDENT ACTIVITIESBoard Member, Internship and Career Services Student Advisory Board September 2013–PresentMentor, Big Brothers Big Sisters of Central Indiana August 2013–PresentMember, Timmy Foundation January 2012–PresentVolunteer, Relay for Life Spring 2011


Appendix B: Sample Resume—Finance

OBJECTIVESeekingafinancialanalystpositioninaninternationalfirmwhereImayutilizemyanalyticalskills,internationalexperienceandfinancialbackground.

EDUCATIONBachelor of Science in Business May 2013Butler University, Indianapolis, INConcentrations: Finance, AccountingGPA: 3.67/4.0

Study Abroad Experience Summer 2012Alcalá de Henares, Spain

•Immersed into a new culture by living with a native host family and attending a Spanish University •Enhanced language competency by communicating and interacting with locals in their native language

FINANCE EXPERIENCEFinancial Analyst Intern September 2011–December 2011Merrill Lynch, Indianapolis, IN

•Developed mutual fund recommendations for clients based upon their risk tolerance•Assistedfinancialplannerswithresearchingfundsanddevelopingadiverseclientdatabase•Researched international stock opportunities and provided personalized recommendations to clients•Analyzed interest rate trends through research, which was utilized for reporting purposes•Createdandmaintainedrelationaldatabasesofover1000clientsand$25,000,000inassets

Finance Intern May 2010–August 2010Chase Bank, Milford, CT

•Audited150+accountsforloanrepayments,collectingapproximately$100,000indelinquentpayments•Analyzed market trends for 200 client portfolios and made recommendations for loan consideration•Developed spreadsheet analysis of business opportunities in the metropolitan area and made

recommendations to management for loan approvals

ADDITIONAL PROFESSIONAL EXPERIENCEVolunteer Coordinator August 2008–May 2010Butler University, Indianapolis, IN

•Developedandsecured50volunteeropportunitiesforstudents,resultinginover$70,000indonations•Designed brochures in InDesign to effectively market opportunities to incoming students •Trained volunteers by creating a detailed training guide which included processes and procedures and served

as a mentor and role model during their service period

LEADERSHIP AND COMMUNITY SERVICEVice President, Tau Epsilon Pi August 2011–PresentStudent Athlete, Butler University Baseball Fall 2009–PresentMember, Union Board Committee September 2009–PresentVolunteer, Indianapolis Council on Domestic Abuse May 2009–August 2010

Randy [email protected]

555EHamptonDr,Indianapolis,IN46206(317) 940-1234


Appendix C: Sample CV—Education with Job Description

Emily [email protected]


OBJECTIVE

Seeking a music teaching position in an elementary school where I may utilize my passion for music, strong teachingskills,anddedicationtothefield.

EDUCATION

Bachelor of Science in Education May 2014Bachelor of Arts in SpanishButler University, Indianapolis, INGPA:3.75/4.0

Honors: Dean's List, Student Employee of the Year, National Society of Collegiate Scholars, Butler University Top 100 Student Recognition, Pi Kappa Lambda National Honorary Music Society

LICENSURE

Indiana Teaching License, K-12 Music Education: Instrumental May 2014

TEACHING EXPERIENCE

Student Teacher, Elementary School Music March 2014–May 2014Whiteland Elementary School, Whiteland, IN

•Emphasized critical thinking skills and clear expectations during music theory lessons to help students develop skills that can be transferred to their music as well as the outside world

•Providedindividualguidancetothreestudents,helpingthemsignificantlyadvancetheirplayingrange•Introduced online tools including mp3 accompaniments and interactive music software to enhance the

student learning experience

Student Teacher, Elementary School Music January 2014–March 2014Pleasant Grove Elementary School, Greenwood, IN

•Provided one-on-one and small group assistance to provide guidance on note values, names, and counts•Taught sight reading basics by incorporating solfege (do-re-mi-fa-so-la-ti-do) into classroom activities•Created an interactive learning environment which incorporated singing, dancing, and learning games•Exposed students to meaningful musical experiences to enhance their social and academic development•Enhanced learning experience by incorporating new and innovative lessons to exercise students' minds

Elementary Band Practicum Student March 2012–December 2012Southport Elementary School, Indianapolis, IN

•Developedshortandlongtermgoalswithbandstudentstohelpinstillconfidenceandmotivation•Increased skill levels of students through interactive and challenging lesson plans to help obtain goals•Designed and implemented developmentally appropriate lesson plans using a variety of learning styles•Created an enriching and positive learning environment to facilitate student learning and engagement

Third Grade Practicum Student March 2012–December 2012Edgewood Elementary School, Bloomington, IN

•Encouraged students to become lifelong learners through group discussions and interactive lesson plans



•Facilitated open communication with parents to create a supportive and trusting environment for students•Improved student learning through the instruction of tailored lesson plans and activities which incorporated

ideas generated by the students

RELATED WORK EXPERIENCE

Youth Group Leader Summer 2013Southport Youth Center, Greenwood IN

•Conductedreadinggroupsfor15pre-teenstoencourageaninterestinliteratureandreading•Facilitated discussions of the characters, events, and plot sequence to help develop critical thinking skills•Encouragedparticipationinreadingaloudtohelpincreaseconfidenceandenhancepronunciationskills•Selected appropriate educational materials including book selection and corresponding discussion questions

to foster enriching reading experiences

Camp Counselor Summer 2012SpringfieldYouthCamp,Springfield,IL

•Counseledapproximately50campersageseighttotenduringafourweekinteractivesummerdaycamp•Served as a role model and provided emotional encouragement to campers in absence of their parents•Collaborated with other camp counselors to create a fun and enriching experience for the participants•Facilitated team building activities including sports, quiz bowls, and water games to promote the social and

emotional growth of the campers

Assistant Youth Soccer Coach Fall 2011Greenwood Community Center, Greenwood, IN

•Collaborated with head coach during games and practices to teach soccer fundamentals to youth•Created a fun learning environment through creative drills and skills practices to increase engagement•Created healthy food guidelines to encourage parents to bring a nutritious snack for the children•Facilitated open communication with parents regarding practice times and game schedules as well as

coordinated the logistics for team picture day

PROFESSIONAL MEMBERSHIPS

Pi Kappa Lambda, National Honorary Music Society May 2013–PresentIndiana Music Educators Association (IMEA) May 2012–PresentNational Association for Music Education May 2011–Present

PROFESSIONAL CONFERENCES

Beginning Music Teacher Workshop, IMEA November 2013Collegiate Leadership Pre-Conference Program, IMEA January 2012Professional Development Conference, IMEA January 2012

LEADERSHIP AND COMMUNITY SERVICE

Big Sister, Big Brothers Big Sisters of Central Indiana August 2012–PresentChild Care Provider, Jones Family August 2012–PresentVolunteer, Riley Children's Hospital August 2011–December 2013Youth Recreation Volunteer, Greenwood Park and Recreation Summer 2012, 2013 Food Service Volunteer, Mary's Soup Kitchen Fall 2012, 2013Youth Volunteer, YMCA of Indianapolis Summer 2011



JOB DESCRIPTION

Elementary School Music TeacherJob Functions and responsibilities include:

• Teach music fundamentals such as note values and names, time signatures and how to count• Incorporate the use of solfege (do-re-mi-fa-so-la-ti-do) to teach sight reading basics• Focus on learning through music• Use technology, information and other tools to create dynamic lesson plans• Use critical thinking, decision-making, and problem solving skills• Provide one-on-one guidance to students as needed• Engage learners in differentiated learning experiences for a range of skill levels and developmental needs • Provide a nurturing, supportive, and positive classroom climate that encourages student responsibility• Communicate regularly with parents, seeking their support and advice, so as to create a cooperative

relationship to support the child in the school• Assess and interpret the social needs, emotional needs and learning styles of students, using a variety of

assessment techniques and data

This CV and corresponding job description is an example of how a candidate should tailor their resume to specifically meet the needs of the employer. This candidate incorporated all of their teaching experiences that aligned with what the employer specified in the job description. Instead of focusing merely on their duties or responsibilities, they pulled out their accomplishments that really focused on the areas in the new role, showing that they have already been successful at implementing some of these techniques! Tailoring one's resume helps the employer align the candidates past experiences with the needs of the position. In this case, the position and the job description align very well and increases the candidate's chances of receiving an interview.

This method of tailoring your resume is a very effective way to help your resume stand out amongst the competition!

*See Page 7 for specific comparisons of the job description and matching bullet points


Appendix C: Sample CV—Communication Sciences and Disorders Appendix C: Sample CV—Communication Sciences and Disorders

EDUCATION

Bachelor of Arts in Communication Sciences and Disorders (CSD) May2015Butler University, Indianapolis, INMinor: PsychologyGPA: 3.9/4.0

Honors: Dean’s List (eight semesters), Alpha Lambda Delta Academic Fraternity, Top 10 Student Award, Lilly Endowment Scholarship

CSD EXPERIENCE

Research Assistant, Babytalk Research Lab August 2014–PresentRiley Children’s Hospital, Indiana School of Medicine, Indianapolis, IN

•Assisted researchers with studies of infant language by recording audio and visual stimuli •Transcribed infant language utterances using SALT (Systematic Analysis of Language Transcripts)•Developed positive rapport with participating families to help maintain lab’s professional network •Gained knowledge of current techniques used to assess language development of normal hearing versus

hearing impaired infants by attending lab meetings and colloquiums

Aphasia Community Student Clinician August 2014–December 2014Butler University, Indianapolis, IN

•Facilitated group therapy for patients with aphasia to promote effective communication in various settings •Applied the Life Participation Approach to Aphasia (LPAA) to stimulate successful communication •Experiencedfirst-handhowaphasiaimpactsallmodalitiesofcommunicationinindividuals•Collaborated with classmates to advocate for aphasia awareness by encouraging community involvement

Speech Pathology Student Assistant Summer 2014Butler University, Indianapolis, IN

•Gathered individualized therapy materials for speech pathologists to assist in client therapy •Improved accessibility of treatment materials, handouts, standardized tests and supplemental information by organizingadisorderspecificfilingsystem

•Created and administered a pediatric treatment activity to encourage development of expressive and receptive language skills

Speech Pathology Student Clinician January 2014–May 2014Butler University, Indianapolis, IN

•Provided therapy to a seven-year old girl with mild articulation errors and language impairment using direct imitation, auditory discrimination, and tactile feedback via Speech Buddy device

•Collected and evaluated data to work towards the client’s mastery of therapy objectives•Collaborated with parents on a weekly basis to plan appropriate lessons for upcoming sessions•Developed short-and-long term goals to reach clients’ age-appropriate speech and language skills

Language Development Teaching Assistant January 2014–May 2014Butler University, Indianapolis, IN

•Delivered a lecture on preschool pragmatic and semantic development to facilitate class discussion•Designed activities and assignments to engage students in their study of language development•Educated students on language development models to translate theory to practice

Olivia [email protected]

4600 Sunset Ave. Indianapolis, IN 46208(317) 940-9383


ADDITIONAL CSD EXPERIENCE

Student Screener Spring2015Butler University, Indianapolis, IN

•Scheduled to administer speech and language tests, pure-tone audiometric testing, and impedance audiometry to preschool aged children

•Will apply knowledge gained through academics to evaluate typical and disordered communication skills•Plantocollaboratewithteachersandadministrators,collectaccuratedata,andhavepositiveandinfluential

interactions with school aged children

Student Observer (30 hours) June 2013–Present Various Locations in Indiana and Ohio

•Observed a videostroboscopy to look at the vocal folds of a patient with a repaired cleft palate•Gained exposure to how bedside swallows are performed to see if patients had signs of aspiration•Learned about the decision making process in patient evaluations by observing the process of evaluating

patient histories and assessment results•Attended an assessment that utilized pictures to aid in helping a patient with Global Apraxia remember

details about her life

CSD MEMBERSHIPS AND ACTIVITIES

Indiana Speech Language Hearing Association (ISHA), Active Member January 2014–Present

American Sign Language (ASL) Club, Active Member August 2013–Present

National Student Speech Language Hearing Association (NSSLHA), Active Member August 2012–Present

American Speech Language Hearing Association Conference (ASHA), Attendee Fall 2014

Indiana Speech Language Hearing Association (ISHA) Conference, Volunteer Spring 2014

CERTIFICATIONS

HIPPA Confidentiality Certification September 2014–Present

CPR Certification, American Red Cross August 2012–Present

LEADERSHIP AND COMMUNITY SERVICE

Treasurer, National Student Speech Language and Hearing Association (NSSLHA) August 2013–Present

Sophomore Member of Social Standards, Delta Gamma Sorority, Butler University April 2012–Present

Youth Volunteer, Indiana School for the Blind and Visually Impaired January 2012–Present

Volunteer Mentor, College Mentors for Kids September 2012–Present

Active Member, ALS Association, Butler University August 2013–Present

Dance Marathon Volunteer, Butler University and Riley Hospital Fall 2012

Volunteer, Indiana School for the Deaf August 2011–May 2012

Appendix C: Sample CV—Communication Sciences and Disorders Appendix C: Sample CV—Communication Sciences and Disorders


Appendix C: Sample CV—Pharmacy

EDUCATIONDoctor of Pharmacy May2015Butler University, Indianapolis, INResearch Advisor: Professor Jon Smith

Bachelor of Science in Chemistry May2005Indiana University, Bloomington, INMinor: Spanish

LICENSURES AND CERTIFICATIONSPharmacy Intern/Extern, State of Indiana, 12312312A April 2011–PresentCPR/AED, American Red Cross August 2010–PresentBLS for Health Care Providers, American Heart Association December 2014

ADVANCED PHARMACY PRACTICE EXPERIENCEClinical Community, Kroger Pharmacy, Indianapolis, IN July 2014–August 2014Preceptor: Fred Smith, RPh• Counseled patients on prescription and OTC medications and provided individualized recommendations• Performed patient screenings for osteoporosis, providing exceptional customer care during the process• Further developed prescription dispensing skills in a high-volume community pharmacy• Contactedhospitals,insurancecompaniesandphysicianofficestopromptlyresolveissuesforpatients

Ambulatory Care, Community Hospital East, Indianapolis, IN June 2014–July 2014Preceptor: Kathleen Blanton, PharmD• Acquired experience in patient interviewing and counseling through gathering medical histories• Reviewed drug regimens and made recommendations on medications as well as monitoring• Presented a journal club on lifestyle change in type 2 diabetes mellitus to help improve patient health

Pediatrics, Community North Hospital, Indianapolis, IN May 2014–June 2014Preceptor: Jeremy Wilson• Provided discharge counseling to all patients and their parents/guardians regarding necessary medications• Monitored drug therapy for Neonatal Intensive Care Unit (NICU) patients to ensure proper patient care• Appliedidentifiedpatientpharmacokineticdifferencestomedicalselectionanddosageamounts

Upcoming Rotations:Psychology, Community Hospital North, Indianapolis, IN September 2014–October 2014Preceptor: Jane Doe, PharmD

General Medicine, Clarian/Methodist Hospital, Indianapolis, IN October 2014–November 2014Preceptor: John Doe, PharmD

Alternative/Complimentary Medicine, Complementary Medicine Center, Indianapolis, January 2015Preceptor: John Doe, PharmD

Oncology, Clarian/Methodist Hospital, Indianapolis, IN January 2015–February 2015Preceptor: Jane Doe, PharmD

Jasper O’[email protected]



Long Term Care, Cornerstone Pharmacy Services, Indianapolis, IN February 2015–March 2015Preceptor: Jane Doe, PharmD

Underserved Clinic, Alivio Medical Center, Indianapolis, IN March 2015–April 2015Preceptor: Jane Doe, PharmD

PROFESSIONAL EXPERIENCEPharmacy Intern May 2012–August 2013CVS Pharmacy, Indianapolis, IN• Increased patient safety by ensuring the accuracy of prescription and patient names on all orders• Counseled patients on their new medications as well as disease state management to promote wellness• Managed inventory including receiving and inter-store transfers, bookwork and ordering maintenance

Pharmacy Technician June 2011–May 2012Weis Pharmacy, Reading, PA• Assistedpharmacistsbyaccuratelyenteringdataandfilingnewandrefilledprescriptionsforcustomers• Introduced to patient counseling and observed effective techniques and procedures to assist patients

RESEARCH EXPERIENCEButler University, Indianapolis, IN October 2012–May 2014• SynthesisandChemistryofLowValentFeandCrComplexes:SyntheticApproachestoAlkaneComplexes.

IndianaUniversity,Bloomington,IN September2004–May2005• TheSubstituentEffectofPentamethylcyclopentadieneonthe1,2-AlkyltoIronMigrationwithConcomitantCarbeneFormation.

PRESENTATIONSPoster Presentations: O’Neal J.W., Smith K, SynthesisandReactivityoftheCyclopentadienyl-ironDicarbonylPhenylTriflate

Carbenecomplex American Chemical Society 39th Midwest Regional Meeting, Chicago, IL, November 10 2014.

Oral Presentations:O’Neal J.W., Smith K, SynthesisandReactivityofethaneTricarbonylIron. American Chemical Society

National Meeting, Washington, DC, September 21-26, 2013. O’Neal J.W., Smith K, PerfluorinatedAlkylPhosphineSubstitutedTransitionMetalComplexes. Departmental

Seminar, University of North Carolina at Chapel Hill, February 23, 2013. O’Neal J.W., Smith K, TheRapidIntroductionofFluorineintoOrganicMolecules. Departmental Seminar,

Butler University, No 19, June 2010.

LEADERSHIP AND COMMUNITY SERVICEVolunteer, Julian Center, Domestic Violence Shelter June 2009–August 2013Board Member, Student Advisory Board September 2009–May 2013Chemistry Representative,ProfessionalStudentFederation August2005–May2009Lab Volunteer,IndianaUniversityChemistryDepartment August2003–May2005

CONFERENCES ATTENDEDAmerican Chemical Society 39th Midwest Regional Meeting, Chicago, IL November 2014NCPA Annual Conference, Ft. Myers, FL February 2014ASHP Midyear Clinical Meeting, New Orleans, LA December 2013

Appendix C: Sample CV—Pharmacy


Appendix D: Sample Reference Sheet

REFERENCES

Dr. Jennifer SmithAssociate Professor of English, Butler University541JordanHallIndianapolis, IN 46208(317)[email protected]

Dr. Lyman JonesChair, Philosophy Department, Butler University595JordanHallIndianapolis, IN 46208(317)[email protected]

Carrie WatsonManager, Watson Clothing Company, Inc1111 W. 86th StPalatine, IL 60621(630)[email protected]

Mona BensonDirector of Volunteer Services, Big Brothers Big Sisters2135CollinsAve,Suite260Northbrook,IL62415(847)[email protected]

Jane [email protected]


*Seepage10fortipsonprovidingprofessionalreferences


Appendix E: Sample Cover Letters

4600 Sunset AvenueIndianapolis, IN 46208(317) 940-9383

March 9, 2014

John SmithIndianapolis Symphony Orchestra32 E. Washington Street, Suite 600Indianapolis, IN 46204

Dear John Smith:

Please consider me for the Artistic Coordinator position at the Indianapolis Symphony Orchestra (ISO). My communication skills, leadership abilities, and passion for the arts make me a strong candidate for this position.

During the summer of 2012, I worked with the ISO as an intern in the marketing department. Although my experience was brief, the time spent with the organization gave me a deeper understanding of the symphony's structure, history, and importance to the community of Indianapolis. I was a part of the busiest and most labor intensiveportionoftheISOyear,SymphonyonthePrairie.Irecognizedtheimportanceoftimeliness,flexibility,and responsiveness when working independently or with a team in order to produce symphonic music performed at the highest artistic level.

As a student in Butler University's Arts Administration program, my education taught me the best practices utilized by successful arts organizations. Presenting the Arts, a course that relates heavily to this position, provided insight into the complexities of obtaining artists for performance venues. Working with authentic artist riders, I grew to understand that contracts are more than a list of requirements; they are the foundation of an ongoing relationship developed between an artist and an organization. When executed properly, they lead to an admired success shared amongst the company, visiting artist, and patrons.

As the marketing and communications intern for the American Dance Festival, I had the opportunity to collaborate with members of the local and national press along with internationally recognized choreographers and dance companies. When a fast-paced environment is combined with a variety of contrasting personalities, it can easily become stressful. However, these are the times when it is most important to remain calm, positive, and professional; one's personal message is often considered a direct representation of the organization as a whole. As an essential member of the Artistic Department, I will diligently work to ensure that guest artists are provided a productive environment for producing music that upholds the ISO's mission.

My self-motivated personality and attention to detail along with my organizational and communication skills make me a viable candidate for this position. I would like to meet with you to further discuss my skills and qualifications.Youmayreachmeat(317)[email protected].

Sincerely,

Ellie Freedman

This letter begins by stating three of the skills and qualities that the employer is looking for in a candidate. It then goes on to provide specific examples from relevant past experiences that proves she has these skills. It pulls examples from internships as well as coursework and ties it back to the original job description; therefore showing that the individual is truly a strong candidate for the position!



122 Meehan LaneHudson, IN 46747(219)555-2345

March 1, 2014

Mark MayottaDirector, Boys and Girls Club909 Jefferson StreetValparaiso, IN 46363

Dear Mark Mayotta:

Please consider me for the advertised position of Summer Sports Counselor. I have excelled in sports my whole life,andpossesstheskillsneededtoteachandmotivatechildrentolearnaboutthejoysandbenefitsassociatedwith team sports.

I have wanted to teach sports to children since I was in sixth grade. My elementary school teacher showed me a love for sports that was contagious. I saw how much he loved to teach children, and believe I have the same passion. I have already been able to impart this love of sports to children at my previous summer jobs. As a camp counselor at my hometown YMCA, I enjoyed working with children of all ages and from a diversity of backgrounds. Through the active sessions I planned each day, camp participants enjoyed the activities and were able to learn important life lessons.

Sadly, I have observed people who have made children dislike team sports by their inappropriate emphasis on winning at all costs. I want to change that and hope you provide me the opportunity to do so.

Enclosed is my resume. Please consider my candidacy for the summer counselor position. Thank you.

Sincerely,

(Sign here)

John GipperEnclosure

This letter shows a strong passion for the job and demonstrates past experiences that match the employer’s need for skills in sports and an ability to motivate children. Employers are looking for people who love their work. Ask yourself, “What work would I love and how can I convey my passion?”



9423 Rogers Point WayFishers, IN 46038(317)555-1234

May5,2014

Mary Ellen JohnsonKimberly Clark Corporation2100 Winchester RoadNeenah,WI54956

Dear Mary Ellen Johnson:

Thomas Moore, a sales manager at Kimberly Clark referred your name to me and suggested I apply for your Sales Management Trainee Program. My background is one of selling ideas, concepts and programs and of motivating myself and others to realize our potential.

"Attitudes predict behavior"–or so goes the saying in sales. If this holds true, I am sure to be as successful in sales management with Kimberly Clark as I am in my college endeavors. My unceasing optimism, self-determination and ability to set goals have allowed me to achieve academic and personal objectives.

With a single-minded pursuit, I challenged myself to excel in the classroom as well as in my resident advisor role. It is one thing to be a double major at Butler University. It is quite another feat to both double major and devote 20–30 hours per week time commitment to a job. That’s precisely what I did in being a residence hall advisor to students over the past two years. Implementing residence life programs, mediating between conflictingroommatesandhelpingstudentsadjusttocollegelifearejustasampleofmyresidentadvisorcontributions. The most important contribution was my imparting an enthusiasm and belief in oneself to others.

ThesesamegoalsettingandcommunicationskillswillensuremycontributingsignificantlytoKimberlyClark.Because of my “can do” attitude, sales will provide the challenge and opportunity to continue my successful history of setting and achieving goals.

Please allow me the opportunity to elaborate on how my background predicts sales success. I guarantee that you will be providing your corporation with an outstanding sales management trainee. Thank you for your attention. I will call you next week.

Sincerely,

(Sign here)

Carmen Viagas

Enclosure

“Sell!, Sell!, Sell!” is the name of the game for this student. She begins by talking about her background in sales and never lets up. Make sure YOUR personal style is reflected through your writing. A message of confidence and aggressiveness can be conveyed through different writing styles. The personal qualities and styles reflected in a cover letter will be the same benchmarks sought from the interview. Therefore, adapt a style that suits your personality.


Appendix F: Sample Networking Letters

October 12, 2014

Cynthia S. KennedyManagerJones, Smith, and Doe, P.C.CertifiedPublicAccountants1400 Washington StreetIndianapolis, IN 46203

Dear Cynthia Kennedy:

Dr. Carr, professor of accounting at Butler University, suggested that I contact you. He thought that you would be in an excellent position as an alumna to assist me with a career decision.

As an accounting student, I am exploring which career path to pursue. Public accounting, management accounting and IRS work all sound interesting to me at this point, but I want to go into my campus interviews next semester with a clear sense of direction. I would like to get your advice on the long-term career implications of each path as well as a better handle on the day-to-day activities of a CPA.

I will call you next week to see if we can arrange a brief meeting at your convenience. Thank you for considering my request.

Sincerely,

(Sign here)

Ruth Ovid Butler(317) [email protected]


Appendix F: Sample Networking Letters

To: [email protected]: Job Search Advice

Dear John Doe:

My name is Jane Smith and your contact information was given to me by my advertising professor, Dr. William Smith. I will be graduating from Butler University in May with a degree in Public Relations and have started the job search process.

I have done some research regarding positions in account coordination and client services and wanted to know if you would have time in the next couple of weeks to meet and provide me with some advice and tips for my search. I am available on Wednesdays and Fridays after 1:00 and can meet you at a location that is convenient for you. I would really appreciate any help and guidance you can provide. Thank you for your time and consideration.

Sincerely,

Jane Smith(317) [email protected]

Example where networking contact was referred by someone you know.


Appendix G: Sample Thank You Letter

564FranklinStreet Indianapolis,IN59120 (317)555-5555

January 30, 2014

Mike Holland Director of Human Resources ABC Warehouse Inc. 1111 N 126th Street Indianapolis,IN59125

Dear Mike Holland:

ThankyouformeetingwithmeonJanuary28todiscussmyqualificationsfortheWarehouseManagerposition.After meeting with you and your staff members, I am even more excited about the prospect of joining your team. I especially enjoyed the tour of the facilities. It provided me insight into the company culture and your dedication to the growth and development of your employees.

I believe that my communication skills and my past experience with solving complex problems align well with the objectives of this position. I am eager to prove myself as an asset to your team and believe that I am capable of playing an instrumental role in your vision for the future of ABC Warehouse.

Again, thank you for your time. I look forward to speaking with you again soon.

Sincerely,

(Sign here)

Jane Butler


Appendix H: Illegal Interview Questions

Inquiry Area Illegal Questions Legal Questions

National Origin/Citizenship

• Are you a U.S. citizen? • Where were you or your parents born? • What is your “native tongue?”

• Are you authorized to work in the United States?

• What languages do you read/speak/write fluently? (This question is okay only if relevant to the performance of the job.)

Age• How old are you? • When did you graduate? • What is your birth date?

• Are you over the age of 18?

Marital/Family Status

• What is your marital status? • With whom do you live? • Do you plan to have a family? When? • How many kids do you have? • What are your childcare arrangements?

• Would you be willing to relocate if necessary? • Would you be able and willing to travel as

needed for the job? (This question is okay if asked of all applicants for the job.)

• Would you be able and willing to work overtime as necessary? (This question is okay if asked of all applicants for the job.)

Personal

• How tall are you? • How much do you weigh?

(Questions about height and weight are not acceptable unless minimum standards are essential for the safe performance of the job.)

• Are you able to lift a 50-pound weight and carry it 100 yards, as that is part of the job?

Disabilities

• Do you have any disabilities? • Please complete the following medical history. • Have you had any recent or past illnesses or

operations? If yes, list them and give dates when these occurred.

• What was the date of your last physical exam? • How’s your family’s health? • When did you lose your eyesight? How? • Do you need an accommodation to perform the

job? (This question can be asked only after a job offer has been made.)

• Are you able to perform the essential functions of this job? (This question is okay if the interviewer has thoroughly described the job.)

• Can you demonstrate how you would perform the following job-related functions?

• As part of the hiring process, after a job offer has been made, you will be required to undergo a medical exam.

(Exam results must be kept strictly confidential. Medical/safety personnel may be informed if emergency medical treatment is required. Supervisors may be informed about necessary job accommodations, based on exam results.)

Arrest Record• Have you ever been arrested? • Have you ever been convicted of _____? (The

crime named should be reasonably related to the performance of the job.)

Military

• Were you honorably discharged? • In what branch of the Armed Forces did you serve?

• What type of training or education did you receive in the military?


BULLDOGS FOREVERThe Alumni Association builds the relationship between Butler and our graduates. The time, talent, and treasure that our alumni give back to the University enhance the current student experience.

As a graduate you• are invited to special events and gatherings in your area.

• have access to career assistance through Butler.

• receive access to Bulldog Nation, Butler’s online community exclusively for alumni.

• receive special discounts and benefits in the Indianapolis area and beyond!

Graduates can also stay connected to the University and to each other through alumni chapter programming. Chapters are currently located in Atlanta, Bay Area (San Francisco, Oakland, Sacramento), Central Indiana, Cincinnati, Chicago, Greater Detriot, Fort Wayne, Greater New York, St. Louis, and Washington, DC.

Learn more by visiting www.butler.edu/alumni, or by contacting the Alumni Office at 800-368-6852, ext. 9946 or [email protected].

Data-driven digital marketingCatapult Rotational Program (for new grads)

Slingshot Internship Program (for students)

Start your career with the global leader in

Apply Today: exacttarget.com/careers

Where your talent makes an impactWe are 2,500 individuals in more than 10 countries. Our people are valued as much for who they are as what they do.

Praxair Surface Technologies is a multi-million dollar global company that applies and markets the most advanced protective coatings for aviation, energy, and industrial applications. As a growing company, we are always looking for talented, energetic, and ambitious people to join our high-performing team.

Find out where your talent makes an impactvisit Praxair.com/careers

B U T L E R U N I V E R S I T YI n t e r n s h i p a n d C a r e e r S e r v i c e s

Guide to Professional Successresumes · cvs · cover letters · networking · interviewing

Internship and Career Services 4600 Sunset Ave.

Atherton Union 315 Indianapolis, IN 46208

317-940-9383 www.butler.edu/ics

[email protected]

guide to professional success

Documents