grit: the power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · the...
TRANSCRIPT
![Page 1: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1.jpg)
![Page 2: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/2.jpg)
PraiseforGrit:ThePowerofPassionandPerseverance
“Profoundly important. Foreons, we’ve been trappedinside the myth of innatetalent. Angela Duckworthshines a bright light into atruer understanding of howwe achieve. We owe her agreatdebt.”
—DavidShenk,authorofTheGeniusinAllofUs:
![Page 3: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/3.jpg)
NewInsightsintoGenetics,Talent,andIQ
“Enlightening . . . Gritteaches that life’s high peaksaren’t necessarily conqueredby the naturally nimble but,rather, by those willing toendure, wait out the storm,andtryagain.”
—EdViesturs,seven-timeclimberofMountEverest
andauthorofNoShortcutstotheTop
![Page 4: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/4.jpg)
“Masterful . . .Grit offers atruly sane perspective: thattrue success comes whenwedevoteourselvestoendeavorsthatgiveusjoyandpurpose.”
—AriannaHuffington,authorofThrive
“Readable, compelling, andtotally persuasive. The ideasinthisbookhavethepotentialto transform education,management, and theway itsreaders live. Angela
![Page 5: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/5.jpg)
Duckworth’s Grit is anationaltreasure.”
—LawrenceH.Summers,formersecretaryofthetreasuryandPresident
EmeritusatHarvardUniversity
“Fascinating. AngelaDuckworth pulls togetherdecades of psychologicalresearch, inspiring successstories from business andsports, and her own unique
![Page 6: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/6.jpg)
personal experience anddistills it all into a set ofpractical strategies to makeyourself and your childrenmore motivated, morepassionate, and morepersistent at work and atschool.”
—PaulTough,authorofHowChildrenSucceed
“A thoughtful and engagingexploration of what predictssuccess. Grit takes on
![Page 7: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/7.jpg)
widespread misconceptionsandpredictorsofwhatmakesus strive harder and pushfurther. . .Duckworth’sownstory, wound throughout herresearch, ends updemonstrating her theorybest: passion andperseverancemakeupgrit.”
—ToryBurch,chairman,CEOanddesignerofTory
Burch
![Page 8: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/8.jpg)
“An important book . . . Inthese pages, the leadingscholarlyexpertonthepowerofgrit (whatmymomcalled‘stick-to-it-iveness’) carriesher message to a wideraudience,usingaptanecdotesand aphorisms to illustratehow we can usefully applyher insights to our own livesandthoseofourkids.”
—RobertD.Putnam,professorofpublicpolicyat
HarvardUniversityand
![Page 9: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/9.jpg)
authorofBowlingAloneandOurKids
“Empowering . . . AngelaDuckworth compels attentionwith her idea that regularindividualswhoexerciseself-control and perseverance canreach as high as those whoare naturally talented—thatyour mindset is as importantasyourmind.”
—SoledadO’Brien,chairmanofStarfishMedia
![Page 10: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/10.jpg)
GroupandformercoanchorofCNN’sAmerican
Morning
“Invaluable . . . In a worldwhereaccesstoknowledgeisunprecedented, this bookdescribes the key trait ofthosewhowilloptimallytakeadvantage of it. Grit willinspireeveryonewhoreadsitto stick to something hardthattheyhaveapassionfor.”
![Page 11: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/11.jpg)
—SalKhan,founderofKhanAcademy
“IloveanideathatchallengesourconventionalwisdomandGrit does just that! Put asidewhat you think you knowabout getting ahead andoutlasting your competition,even if they are moretalented. Getting smarterwon’t help you—stickingwithitwill!”
![Page 12: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/12.jpg)
—SimonSinek,authorofStartWithWhyandLeaders
EatLast
“Incredibly important . . .There is deeply embodiedgrit, which is born of love,purpose, truth to one’s coreunder ferocious heat, and arelentless passion for whatcan only be revealed on therazor’sedge;and there is thecool, patient, disciplinedcultivation and study of
![Page 13: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/13.jpg)
resiliencethatcanteachusallhow to get there. AngelaDuckworth’s masterpiecestraddles both worlds,offeringalevelofnuancethatIhaven’treadbefore.”
—JoshWaitzkin,internationalchessmaster,TaiChiPushHandsworldchampion,andauthorof
TheArtofLearning
“A combination of richscience, compelling stories,
![Page 14: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/14.jpg)
crisp graceful prose, andappealingly personalexamples . . . Without adoubt, this is the mosttransformative, eye-openingbookI’vereadthisyear.”
—SonjaLyubomirsky,professor,Universityof
California,RiversideandauthorofTheHowof
Happiness
“This book gets into yourhead, which is where it
![Page 15: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/15.jpg)
belongs . . . For educatorswho want our kids tosucceed, this is anindispensableread.”
—JoelKlein,formerchancellor,NewYorkCity
publicschools
“Grit delivers! AngelaDuckworthsharesthestories,thescience,andthepositivitybehind sustained success . . .Amust-read.”
![Page 16: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/16.jpg)
—BarbaraFredrickson,authorofPositivityandLove
2.0andpresidentoftheInternationalPositive
PsychologyAssociation
![Page 17: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/17.jpg)
ThankyoufordownloadingthisScribnereBook.
Joinourmailinglistandgetupdatesonnewreleases,deals,bonuscontentandothergreatbooksfromScribnerandSimon
&Schuster.
CLICKHERETOSIGNUP
![Page 18: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/18.jpg)
orvisitusonlinetosignupateBookNews.SimonandSchuster.com
![Page 19: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/19.jpg)
![Page 20: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/20.jpg)
CONTENTS
PREFACE
PARTI:WHATGRITISANDWHYITMATTERS
CHAPTER1:SHOWINGUPCHAPTER2:DISTRACTEDBY
TALENT
![Page 21: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/21.jpg)
CHAPTER3:EFFORTCOUNTSTWICE
CHAPTER4:HOWGRITTYAREYOU?
CHAPTER5:GRITGROWS
PARTII:GROWINGGRITFROMTHEINSIDEOUT
CHAPTER6:INTERESTCHAPTER7:PRACTICECHAPTER8:PURPOSECHAPTER9:HOPE
PARTIII:GROWINGGRITFROMTHEOUTSIDEIN
![Page 22: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/22.jpg)
CHAPTER10:PARENTINGFORGRIT
CHAPTER11:THEPLAYINGFIELDSOFGRIT
CHAPTER12:ACULTUREOFGRIT
CHAPTER13:CONCLUSION
ACKNOWLEDGMENTSRECOMMENDEDREADINGABOUTTHEAUTHORNOTESINDEX
![Page 23: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/23.jpg)
ForJason
![Page 24: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/24.jpg)
PREFACE
Growingup,Iheardthewordgeniusalot.
Itwasalwaysmydadwhobroughtitup.Helikedtosay,apropos of nothing at all,“You know, you’re nogenius!”Thispronouncement
![Page 25: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/25.jpg)
might come in themiddle ofdinner, during a commercialbreak for The Love Boat, orafterhe floppeddownon thecouch with the Wall StreetJournal.
I don’t remember how Iresponded. Maybe Ipretendednottohear.
My dad’s thoughts turnedfrequently to genius, talent,and who had more thanwhom. He was deeplyconcernedwithhowsmarthe
![Page 26: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/26.jpg)
was. He was deeplyconcernedwithhowsmarthisfamilywas.
Iwasn’ttheonlyproblem.My dad didn’t think mybrother and sister weregeniuses, either. By hisyardstick, none of usmeasured up to Einstein.Apparently, this was a greatdisappointment. Dad worriedthat this intellectualhandicapwould limit what we’deventuallyachieveinlife.
![Page 27: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/27.jpg)
Two years ago, I wasfortunate enough to beawarded a MacArthurFellowship,sometimescalledthe“geniusgrant.”Youdon’tapplyfortheMacArthur.Youdon’t ask your friends orcolleagues to nominate you.Instead, a secret committeethatincludesthetoppeopleinyour field decides you’redoing important and creativework.
![Page 28: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/28.jpg)
When I received theunexpectedcalltellingmethenews, my first reaction wasone of gratitude andamazement. Then mythoughts turned to my dadand his offhand diagnoses ofmy intellectual potential. Hewasn’t wrong; I didn’t winthe MacArthur because I’mleagues smarter than myfellowpsychologists. Instead,hehadtherightanswer(“No,she’s not”) to the wrong
![Page 29: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/29.jpg)
question(“Issheagenius?”).There was about a month
between the MacArthur calland its officialannouncement. Apart frommy husband, I wasn’tpermittedtotellanyone.Thatgave me time to ponder theirony of the situation. A girlwho is told repeatedly thatshe’s no genius ends upwinning an award for beingone. The award goes to herbecause she has discovered
![Page 30: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/30.jpg)
that what we eventuallyaccomplishmaydependmoreon our passion andperseverance than on ourinnatetalent.Shehasbythenamassed degrees from somepretty tough schools, but inthethirdgrade,shedidn’ttesthigh enough for the giftedand talented program. Herparents are Chineseimmigrants,butshedidn’tgetlectured on the salvation ofhard work. Against
![Page 31: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/31.jpg)
stereotype, she can’t play anoteofpianoorviolin.
The morning theMacArthurwas announced, Iwalked over to my parents’apartment.Mymomanddadhad already heard the news,and sohad several “aunties,”who were calling in rapidsuccession to offercongratulations. Finally,when the phone stoppedringing,mydadturnedtomeandsaid,“I’mproudofyou.”
![Page 32: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/32.jpg)
I had so much to say inresponse, but instead I justsaid,“Thanks,Dad.”
There was no senserehashing the past. I knewthat, in fact,hewas proudofme.
Still,partofmewantedtotravelback in time towhenIwasayounggirl.I’dtellhimwhatIknownow.
Iwouldsay,“Dad,yousayI’mno genius. Iwon’t arguewiththat.Youknowplentyof
![Page 33: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/33.jpg)
peoplewhoaresmarterthanIam.” I can imagine his headnoddinginsoberagreement.
“But let me tell yousomething.I’mgoingtogrowup to lovemywork asmuchas you love yours. I won’tjust have a job; I’ll have acalling. I’ll challenge myselfevery day. When I getknocked down, I’ll get backup.Imaynotbethesmartestperson in the room, but I’llstrivetobethegrittiest.”
![Page 34: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/34.jpg)
And if he was stilllistening: “In the long run,Dad, grit may matter morethantalent.”
All these years later, Ihave the scientific evidenceto prove my point. What’smore, I know that grit ismutable,notfixed,andIhaveinsights from research abouthowtogrowit.
This book summarizeseverythingI’ve learnedaboutgrit.
![Page 35: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/35.jpg)
WhenIfinishedwritingit,I went to visit my dad.Chapter by chapter, over thecourse of days, I read himeveryline.He’sbeenbattlingParkinson’s disease for thelastdecadeorso,andI’mnotentirely sure how much heunderstood. Still, he seemedto be listening intently, andwhen I was done, he lookedatme.Afterwhatfelt likeaneternity,henoddedonce.Andthenhesmiled.
![Page 36: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/36.jpg)
PartI
WHATGRITISANDWHYITMATTERS
![Page 37: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/37.jpg)
Chapter1
SHOWINGUP
By the time you set foot onthe campus of the United
![Page 38: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/38.jpg)
States Military Academy atWestPoint,you’veearnedit.
The admissions processfor West Point is at least asrigorous as for the mostselective universities. Topscores on the SAT or ACTand outstanding high schoolgrades are amust. Butwhenyou apply to Harvard, youdon’t need to start yourapplication in the eleventhgrade, and you don’t need tosecure a nomination from a
![Page 39: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/39.jpg)
member of Congress, asenator, or the vice presidentof the United States. Youdon’t,forthatmatter,havetoget superlative marks in afitness assessment thatincludes running, push-ups,sit-ups,andpull-ups.
Each year, in their junioryear of high school, morethan 14,000 applicants beginthe admissions process. Thispool is winnowed to just4,000whosucceed ingetting
![Page 40: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/40.jpg)
the required nomination.Slightly more than half ofthose applicants—about2,500—meet West Point’srigorous academic andphysical standards, and fromthat select group just 1,200are admitted and enrolled.Nearly all the men andwomen who come to WestPoint were varsity athletes;mostwereteamcaptains.
Andyet,oneinfivecadetswill drop out before
![Page 41: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/41.jpg)
graduation. What’s moreremarkable is that,historically, a substantialfraction of dropouts leave intheir very first summer,during an intensive seven-week training programnamed, even in officialliterature,BeastBarracks.Or,forshort,justBeast.
Who spends two yearstrying toget intoaplaceandthendropsoutinthefirsttwomonths?
![Page 42: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/42.jpg)
Then again, these are noordinary months. Beast isdescribed in the West Pointhandbook for new cadets as“the most physically andemotionally demanding partof your four years at WestPoint . . . designed to helpyoumake the transition fromnewcadettoSoldier.”
ATypicalDayatBeastBarracks
![Page 43: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/43.jpg)
5:00a.m.
Wake-up
5:30a.m.
ReveilleFormation
5:30to6:55a.m.
PhysicalTraining
6:55to7:25a.m.
PersonalMaintenance
7:30to
Breakfast
![Page 44: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/44.jpg)
8:15a.m.
8:30to12:45p.m.
Training/Classes
1:00to1:45p.m.
Lunch
2:00to3:45p.m.
Training/Classes
![Page 45: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/45.jpg)
4:00to5:30p.m.
OrganizedAthletics
5:30to5:55p.m.
PersonalMaintenance
6:00to6:45p.m.
Dinner
7:00to
Training/Classes
![Page 46: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/46.jpg)
9:00p.m.9:00to10:00p.m.
Commander’sTime
10:00p.m.
Taps
The day begins at 5:00a.m. By 5:30, cadets are information, standing atattention,honoringtheraising
![Page 47: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/47.jpg)
of the United States flag.Then followsahardworkout—running or calisthenics—followed by a nonstoprotation of marching information, classroominstruction,weapons training,andathletics.Lightsout, toamelancholybuglesongcalled“Taps,” occurs at 10:00 p.m.And on the next day theroutine startsoveragain.Oh,and there are no weekends,no breaks other than meals,
![Page 48: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/48.jpg)
and virtually no contactwithfamily and friends outside ofWestPoint.
Onecadet’sdescriptionofBeast:“Youarechallengedina variety of ways in everydevelopmental area—mentally, physically,militarily, and socially. Thesystem will find yourweaknesses, but that’s thepoint—West Point toughensyou.”
![Page 49: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/49.jpg)
So, who makes it throughBeast?
It was 2004 and mysecond year of graduateschool in psychologywhen Iset about answering thatquestion,butfordecades, theU.S. Army has been askingthesamething.Infact,itwasin 1955—almost fifty yearsbefore I began working onthis puzzle—that a youngpsychologist named JerryKagan was drafted into the
![Page 50: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/50.jpg)
army, ordered to report toWest Point, and assigned totest new cadets for thepurpose of identifying whowould stay and who wouldleave.As fatewould have it,Jerry was not only the firstpsychologist to studydropping out at West Point,he was also the firstpsychologistImetincollege.Iendedupworkingpart-timeinhislabfortwoyears.
![Page 51: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/51.jpg)
Jerry described earlyefforts to separate the wheatfrom the chaff atWest Pointas dramatically unsuccessful.He recalled in particularspending hundreds of hoursshowing cadets cards printedwith pictures and asking theyoungmentomakeupstoriesto fit them. This test wasmeanttounearthdeep-seated,unconsciousmotives,and thegeneral idea was that cadetswho visualized noble deeds
![Page 52: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/52.jpg)
and courageousaccomplishments should betheoneswhowouldgraduateinsteadofdroppingout.Likealotofideasthatsoundgoodin principle, this one didn’tworksowellinpractice.Thestories the cadets told werecolorful and fun to listen to,but they had absolutelynothing to do with decisionsthe cadets made in theiractuallives.
![Page 53: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/53.jpg)
Since then, several moregenerations of psychologistsdevoted themselves to theattrition issue, but not oneresearcher could say withmuch certainty why some ofthe most promising cadetsroutinely quit when theirtraininghadjustbegun.
Soon after learning aboutBeast,Ifoundmywaytotheoffice of Mike Matthews, amilitary psychologist who’sbeen a West Point faculty
![Page 54: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/54.jpg)
member for years. MikeexplainedthattheWestPointadmissions processsuccessfully identified menand women who had thepotential to thrive there. Inparticular, admissions staffcalculate for each applicantsomething called the WholeCandidate Score, a weightedaverageofSATorACTexamscores, high school rankadjusted for the number ofstudents in the applicant’s
![Page 55: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/55.jpg)
graduating class, expertappraisals of leadershippotential,andperformanceonobjective measures ofphysicalfitness.
You can think of theWhole Candidate Score asWest Point’s best guess athow much talent applicantshavefor thediverse rigorsofits four-year program. Inother words, it’s an estimateof how easily cadets will
![Page 56: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/56.jpg)
master the many skillsrequiredofamilitaryleader.
The Whole CandidateScore is the single mostimportant factor in WestPoint admissions, and yet itdidn’t reliably predict whowouldmakeitthroughBeast.In fact, cadets with thehighest Whole CandidateScores were just as likely todrop out as those with thelowest. And this was whyMike’sdoorwasopentome.
![Page 57: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/57.jpg)
From his own experiencejoining the air force as ayoungman,Mike had a cluetotheriddle.Whiletherigorsofhisinductionweren’tquiteasharrowingasthoseofWestPoint, there were notablesimilarities. The mostimportant were challengesthat exceeded current skills.For the first time in theirlives, Mike and the otherrecruitswerebeingasked,onan hourly basis, to do things
![Page 58: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/58.jpg)
theycouldn’tyetdo.“Withintwoweeks,”Mike recalls, “Iwas tired, lonely, frustrated,andreadytoquit—aswereallofmyclassmates.”
Some did quit, but Mikedidnot.
WhatstruckMikewasthatrising to the occasion hadalmost nothing to do withtalent. Those who droppedout of training rarely did sofrom lack of ability. Rather,what mattered, Mike said,
![Page 59: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/59.jpg)
was a “never give up”attitude.
Around that time, it wasn’tjustMikeMatthewswhowastalking tomeabout thiskindof hang-in-there posturetoward challenge. As agraduate student justbeginning to probe thepsychologyof success, Iwasinterviewing leaders inbusiness, art, athletics,
![Page 60: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/60.jpg)
journalism, academia,medicine, and law:Who arethe people at the very top ofyour field? What are theylike? What do you thinkmakesthemspecial?
Someofthecharacteristicsthat emerged in theseinterviews were very field-specific. For instance, morethan one businesspersonmentioned an appetite fortaking financial risks:“You’ve got to be able to
![Page 61: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/61.jpg)
make calculated decisionsaboutmillions of dollars andstillgotosleepatnight.”Butthis seemed entirely besidethe point for artists, whoinstead mentioned a drive tocreate:“I likemakingstuff.Idon’tknowwhy,butIdo.”Incontrast,athletesmentionedadifferent kind of motivation,one driven by the thrill ofvictory: “Winners love to gohead-to-head with otherpeople.Winnershatelosing.”
![Page 62: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/62.jpg)
In addition to theseparticulars, there emergedcertain commonalities, andtheywerewhatinterestedmemost.Nomatterthefield,themost successful people werelucky and talented. I’d heardthatbefore,andIdidn’tdoubtit.
But the story of successdidn’tendthere.Manyofthepeople I talked to could alsorecount tales of rising starswho, to everyone’s surprise,
![Page 63: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/63.jpg)
dropped out or lost interestbeforetheycouldrealizetheirpotential.
Apparently, it wascritically important—and notat all easy—to keep goingafter failure: “Some peopleare great when things aregoingwell,buttheyfallapartwhen things aren’t.” Highachievers described in theseinterviewsreallystuck itout:“This one guy, he wasn’tactually thebestwriterat the
![Page 64: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/64.jpg)
beginning.Imean,weusedtoread his stories and have alaughbecausethewritingwasso, you know, clumsy andmelodramatic. But he gotbetterandbetter,andlastyearhewonaGuggenheim.”Andthey were constantly drivento improve: “She’s neversatisfied. You’d think shewould be, by now, but she’sher ownharshest critic.”Thehighly accomplished wereparagonsofperseverance.
![Page 65: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/65.jpg)
Why were the highlyaccomplished so dogged intheirpursuits?Formost,therewas no realistic expectationof ever catching up to theirambitions. In theirowneyes,theywerenevergoodenough.They were the opposite ofcomplacent. And yet, in avery real sense, they weresatisfied being unsatisfied.Each was chasing somethingof unparalleled interest andimportance, and it was the
![Page 66: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/66.jpg)
chase—as much as thecapture—that was gratifying.Even if some of the thingstheyhadtodowereboring,orfrustrating, or even painful,they wouldn’t dream ofgiving up. Their passionwasenduring.
In sum, no matter thedomain,thehighlysuccessfulhad a kind of ferociousdetermination thatplayedoutin two ways. First, theseexemplars were unusually
![Page 67: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/67.jpg)
resilient and hardworking.Second, theyknewinavery,very deep way what it wasthey wanted. They not onlyhad determination, they haddirection.
Itwas thiscombinationofpassionandperseverancethatmade high achievers special.Inaword,theyhadgrit.
Forme,thequestionbecame:How do you measure
![Page 68: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/68.jpg)
something so intangible?Something that decades ofmilitary psychologists hadn’tbeen able to quantify?Something those verysuccessful people I’dinterviewed said they couldrecognize on sight, butcouldn’t think of how todirectlytestfor?
Isatdownandlookedovermy interview notes. And Istartedwriting questions thatcaptured, sometimes
![Page 69: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/69.jpg)
verbatim, descriptions ofwhatitmeanstohavegrit.
Halfofthequestionswereabout perseverance. Theyasked how much you agreewith statements like “I haveovercomesetbackstoconqueran important challenge” and“IfinishwhateverIbegin.”
The other half of thequestionswereaboutpassion.They asked whether your“interestschangefromyeartoyear”andtheextenttowhich
![Page 70: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/70.jpg)
you“havebeenobsessedwithacertainideaorprojectforashort time but later lostinterest.”
What emerged was theGrit Scale—a test that,whentaken honestly, measures theextenttowhichyouapproachlifewithgrit.
In July 2004, on the secondday of Beast, 1,218 West
![Page 71: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/71.jpg)
PointcadetssatdowntotaketheGritScale.
Thedaybefore,cadetshadsaid good-bye to their momsand dads (a farewell forwhich West Point allocatesexactly ninety seconds),gotten their heads shaved(justthemen),changedoutofcivilian clothing and into thefamous gray andwhiteWestPoint uniform, and receivedtheir footlockers, helmets,and other gear. Though they
![Page 72: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/72.jpg)
mayhavemistakenly thoughtthey already knewhow, theywere instructed by a fourth-year cadet in the properwayto stand in line (“Step up tomy line!Notonmy line,notovermy line, not behindmyline.Stepuptomyline!”).
Initially, I looked to seehowgritscoreslinedupwithaptitude. Guess what? Gritscores bore absolutely norelationship to the WholeCandidate Scores that had
![Page 73: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/73.jpg)
been so painstakinglycalculated during theadmissions process. In otherwords, how talented a cadetwas said nothing about theirgrit,andviceversa.
Theseparationofgritfromtalent was consistent withMike’s observations of airforcetraining,butwhenIfirststumbled onto this finding itcameasarealsurprise.Afterall, why shouldn’t thetalented endure? Logically,
![Page 74: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/74.jpg)
the talented should stickaround and try hard, becausewhen they do, they dophenomenally well. At WestPoint, for example, amongcadetswhoultimatelymakeitthrough Beast, the WholeCandidate Score is amarvelous predictor of everymetric West Point tracks. Itnot only predicts academicgrades, but military andphysical fitness marks aswell.
![Page 75: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/75.jpg)
So it’s surprising, really,that talent is no guarantee ofgrit. In this book, we’llexplorethereasonswhy.
By the last day of Beast,seventy-one cadets haddroppedout.
Grit turned out to be anastoundingly reliablepredictor of who made itthroughandwhodidnot.
![Page 76: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/76.jpg)
The next year, I returnedtoWestPointtorunthesamestudy. This time, sixty-twocadets dropped out of Beast,and again grit predicted whowouldstay.
In contrast, stayers andleavers had indistinguishableWhole Candidate Scores. Ilooked a little closer at theindividual components thatmakeupthescore.Again,nodifferences.
![Page 77: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/77.jpg)
So, what matters formakingitthroughBeast?
Not your SAT scores, notyour high school rank, notyour leadership experience,notyourathleticability.
NotyourWholeCandidateScore.
Whatmattersisgrit.
DoesgritmatterbeyondWestPoint? To find out, I lookedfor other situations so
![Page 78: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/78.jpg)
challenging that a lot ofpeople drop out. I wanted toknowwhether itwas just therigorsofBeastthatdemandedgrit, or whether, in general,grit helped people stick totheircommitments.
The next arena where Itestedgrit’spowerwassales,aprofessioninwhichdaily,ifnothourly,rejectionisparforthe course. I asked hundredsofmenandwomenemployedat the same vacation time-
![Page 79: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/79.jpg)
share company to answer abattery of personalityquestionnaires, including theGritScale.Sixmonthslater,Irevisited the company, bywhich time55percentof thesalespeople were gone. Gritpredicted who stayed andwho left.Moreover, no othercommonly measuredpersonality trait—includingextroversion, emotionalstability, andconscientiousness—was as
![Page 80: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/80.jpg)
effective as grit in predictingjobretention.
Around the same time, Ireceived a call from theChicagoPublicSchools.Likethe psychologists at WestPoint, researchers there wereeagertolearnmoreaboutthestudents who wouldsuccessfully earn their highschooldiplomas.Thatspring,thousands of high schooljuniors completed anabbreviatedGrit Scale, along
![Page 81: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/81.jpg)
with a battery of otherquestionnaires. More than ayearlater,12percentofthosestudents failed to graduate.Students who graduated onschedule were grittier, andgrit was a more powerfulpredictor of graduation thanhow much students caredabout school, howconscientioustheywereabouttheir studies, and even howsafetheyfeltatschool.
![Page 82: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/82.jpg)
Likewise, in two largeAmerican samples, I foundthatgrittier adultsweremorelikely to get further in theirformal schooling. Adultswho’dearnedanMBA,PhD,MD, JD, or another graduatedegree were grittier thanthose who’d only graduatedfrom four-year colleges,whowere in turn grittier thanthose who’d accumulatedsome college credits but nodegree. Interestingly, adults
![Page 83: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/83.jpg)
who’d successfully earneddegrees from two-yearcolleges scored slightlyhigherthangraduatesoffour-year colleges. This puzzledmeatfirst,butIsoonlearnedthat the dropout rates atcommunitycollegescanbeashigh as 80 percent. Thosewho defy the odds areespeciallygritty.
In parallel, I started apartnership with the ArmySpecial Operations Forces,
![Page 84: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/84.jpg)
better known as the GreenBerets. These are among thearmy’s best-trained soldiers,assignedsomeofthetoughestandmostdangerousmissions.TrainingfortheGreenBeretsis a grueling, multistageaffair. The stage I studiedcomes after nine weeks ofboot camp, four weeks ofinfantry training, threeweeksof airborne school, and fourweeksofapreparationcoursefocused on land navigation.
![Page 85: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/85.jpg)
Allthesepreliminarytrainingexperiences are very, veryhard,andateverystagethereare men who don’t make itthrough. But the SpecialForces Selection Course iseven harder. In the words ofits commanding general,James Parker, this is “wherewedecidewhowill andwhowillnot”enterthefinalstagesofGreenBerettraining.
The Selection Coursemakes Beast Barracks look
![Page 86: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/86.jpg)
like summer vacation.Startingbeforedawn,traineesgo full-throttle until nine inthe evening. In addition todaytime and nighttimenavigation exercises, thereare four- and six-mile runsand marches, sometimesunder a sixty-five-poundload, and attempts at anobstacle course informallyknown as “Nasty Nick,”which includes crawlingthrough water under barbed
![Page 87: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/87.jpg)
wire, walking on elevatedlogs, negotiating cargo nets,andswingingfromhorizontalladders.
Just getting to theSelection Course is anaccomplishment,butevenso,42percentofthecandidatesIstudied voluntarily withdrewbefore it was over. So whatdistinguished the men whomadeitthrough?Grit.
What else, other thangrit,predicts success in the
![Page 88: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/88.jpg)
military, education, andbusiness? In sales, I foundthat prior experience helps—novicesarelesslikelytokeeptheir jobs than those withexperience. In the Chicagopublic school system, asupportive teacher made itmore likely that studentswould graduate. And foraspiring Green Berets,baseline physical fitness atthe start of training isessential.
![Page 89: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/89.jpg)
But in each of thesedomains, when you comparepeople matched on thesecharacteristics, grit stillpredicts success. Regardlessof specific attributes andadvantagesthathelpsomeonesucceed in each of thesediversedomainsofchallenge,gritmattersinallofthem.
The year I started graduateschool, the documentary
![Page 90: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/90.jpg)
Spellboundwasreleased.Thefilm follows three boys andfive girls as they prepare forand compete in the finals oftheScrippsNationalSpellingBee.Toget to the finals—anadrenaline-filled three-dayaffair staged annually inWashington, DC, andbroadcast live on ESPN,which normally focuses itsprogramming on high-stakessports matchups—these kidsmust first “outspell”
![Page 91: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/91.jpg)
thousands of other studentsfrom hundreds of schoolsacross the country. Thismeans spelling increasinglyobscure words without asingle error, in round afterround, first besting all theother students in thecontestant’s classroom, thenintheirgrade,school,district,andregion.Spellbound got me
wondering:Towhatextentisflawlesslyspellingwordslike
![Page 92: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/92.jpg)
schottische and cymotrichousamatterofprecociousverbaltalent, and to what extent isgritatplay?
I called the Bee’sexecutivedirector,adynamicwoman (and formerchampion speller herself)namedPaigeKimble.Kimblewas as curious as I was tolearn more about thepsychological makeup ofwinners. She agreed to sendout questionnaires to all 273
![Page 93: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/93.jpg)
spellers just as soon as theyqualifiedforthefinals,whichwould take place severalmonthslater.Inreturnfortheprincely rewardof a$25giftcard, about two-thirds of thespellers returned thequestionnairestomylab.Theoldest respondentwas fifteenyears old, the absolute agelimit according tocompetition rules, and theyoungestwasjustseven.
![Page 94: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/94.jpg)
In addition to completingthe Grit Scale, spellersreportedhowmuchtimetheydevoted to spelling practice.On average, they practicedmore than an hour a day onweekdaysandmore than twohoursadayonweekends.Butthere was a lot of variationaround these averages: somespellerswerehardly studyingat all, and some werestudying as much as ninehoursonagivenSaturday!
![Page 95: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/95.jpg)
Separately, I contacted asubsample of spellers andadministered a verbalintelligence test. As a group,the spellers demonstratedunusual verbal ability. Buttherewasa fairlywiderangeof scores, with some kidsscoring at the verbal prodigylevelandothers“average”fortheirage.
WhenESPNairedthefinalrounds of the competition, Iwatched all the way through
![Page 96: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/96.jpg)
totheconcludingsuspensefulmoments when, at last,thirteen-year-old AnuragKashyap correctly spelledA-P-P-O-G-G-I-A-T-U-R-A (amusical term for a kind ofgrace note) to win thechampionship.
Then, with the finalrankings in hand, I analyzedmydata.
Here’s what I found:measurements of grit takenmonths before the final
![Page 97: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/97.jpg)
competition predicted howwell spellers wouldeventually perform. Putsimply, grittier kids wentfurther in competition. Howdid they do it? By studyingmany more hours and, also,by competing in morespellingbees.
What about talent?Verbalintelligence also predictedgettingfurtherincompetition.Buttherewasnorelationshipat all between verbal IQ and
![Page 98: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/98.jpg)
grit. What’s more, verballytalentedspellersdidnotstudyany more than less ablespellers, nor did they have alonger track record ofcompetition.
The separation of grit andtalent emerged again in aseparate study I ran on IvyLeague undergraduates.There, SAT scores and gritwere, in fact, inverselycorrelated. Students in thatselectsamplewhohadhigher
![Page 99: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/99.jpg)
SATscoreswere,onaverage,just slightly less gritty thantheir peers. Putting togetherthis finding with the otherdataI’dcollected,Icametoafundamental insight thatwouldguidemyfuturework:Our potential is one thing.What we do with it is quiteanother.
![Page 100: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/100.jpg)
Chapter2
DISTRACTEDBYTALENT
BeforeIwasapsychologist,Iwas a teacher. It was in the
![Page 101: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/101.jpg)
classroom—years before I’deven heard of Beast—that Ibegantoseethattalentisnotallthereistoachievement.
Iwastwenty-sevenwhenIstartedteachingfull-time.Themonthbefore,I’dquitmyjobat McKinsey, a globalmanagement consulting firmwhoseNewYorkCity officeoccupied several floors of ablue-glass skyscraper inmidtown. My colleagueswere a bit bewildered bymy
![Page 102: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/102.jpg)
decision. Why leave acompany that most of mypeers were dying to join—one regularly singled out asone of the world’s smartestandmostinfluential?
Acquaintances assumed Iwas trading eighty-hourworkweeks for a morerelaxed lifestyle, but ofcourse, anyonewho’s been ateacherknowsthat there’snoharder job in the world. Sowhy leave? In someways, it
![Page 103: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/103.jpg)
was consulting, not teaching,that was the detour.Throughout college, I’dtutored and mentored kidsfromthelocalpublicschools.After graduation, I started atuition-free academicenrichment program and ranit for twoyears.Then Iwentto Oxford and completed adegree in neuroscience,studying the neuralmechanisms of dyslexia. So
![Page 104: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/104.jpg)
whenIstartedteaching,IfeltlikeIwasbackontrack.
Evenso,thetransitionwasabrupt. In a singleweek,mysalarywentfromSeriously?Iactually get paid this much?to Wow! How the heck doteachers in this city makeendsmeet?Dinnerwasnowasandwich eaten hurriedlywhile grading papers, notsushiorderedinattheclient’sexpense.Icommutedtoworkon the same subway line but
![Page 105: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/105.jpg)
stayed on the train pastmidtown,gettingoffsixstopsfarthersouth: theLowerEastSide. Instead of pumps,pearls, and a tailored suit, Iwore sensible shoes I couldstand inalldayanddresses Iwouldn’t mind gettingcoveredinchalk.
My students were twelveand thirteen years old. Mostlived in the housing projectsclusteredbetweenAvenuesAand D. This was before the
![Page 106: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/106.jpg)
neighborhood sprouted hipcafés on every corner. Thefall I started teaching there,ourschoolwaspickedforthesetofamovieaboutarough-and-tumble school in adistressed urbanneighborhood.Myjobwastohelp my students learnseventh-grademath: fractionsand decimals and therudimentary building blocksofalgebraandgeometry.
![Page 107: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/107.jpg)
Eventhatfirstweek,itwasobvious that some of mystudents picked upmathematical concepts moreeasily than their classmates.Teaching the most talentedstudents in the class was ajoy. They were, quiteliterally, “quick studies.”Without much prompting,they saw the underlyingpattern in a series of mathproblems that less ablestudents struggled to grasp.
![Page 108: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/108.jpg)
They’d watch me do aproblem once on the boardand say, “I get it!” and thenwork out the next onecorrectlyontheirown.
Andyet, at the endof thefirst marking period, I wassurprisedtofindthatsomeofthese very able studentsweren’t doing as well as I’dexpected. Some did verywell, of course. But morethan a few of my mosttalented students were
![Page 109: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/109.jpg)
earning lackluster grades orworse.
In contrast, several of thestudents who initiallystruggled were faring betterthan I’d expected. These“overachievers” wouldreliably come to class everyday with everything theyneeded. Instead of playingaround and looking out thewindow, they took notes andasked questions. When theydidn’tget something the first
![Page 110: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/110.jpg)
time around, they tried againandagain,sometimescomingfor extra help during theirlunch period or duringafternoon electives. Theirhard work showed in theirgrades.
Apparently, aptitude didnot guarantee achievement.Talentformathwasdifferentfromexcellinginmathclass.
This came as a surprise.After all, conventionalwisdom says that math is a
![Page 111: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/111.jpg)
subject in which the moretalentedstudentsareexpectedto excel, leaving classmateswho are simply “not mathpeople”behind.Tobehonest,I began the school year withthat very assumption. Itseemed a sure bet that thoseforwhom things came easilywould continue to outpacetheir classmates. In fact, Iexpectedthattheachievementgap separating the naturals
![Page 112: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/112.jpg)
from the rest of the classwouldonlywidenovertime.I’d been distracted by
talent.Gradually, I began to ask
myself hard questions.WhenI taught a lesson and theconceptfailedtogel,coulditbe that the struggling studentneeded to struggle just a bitlonger? Could it be that Ineededtofindadifferentwayto explain what I was tryingtogetacross?Beforejumping
![Page 113: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/113.jpg)
to the conclusion that talentwas destiny, should I beconsideringtheimportanceofeffort? And, as a teacher,wasn’t itmyresponsibilitytofigure out how to sustaineffort—boththestudents’andmyown—justabitlonger?
At the same time, I beganto reflect on how smart evenmyweakeststudentssoundedwhentheytalkedaboutthingsthat genuinely interestedthem. These were
![Page 114: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/114.jpg)
conversations I found almostimpossible to follow:discourses on basketballstatistics, the lyrics to songsthey really liked, andcomplicated plotlines aboutwho was no longer speakingto whom and why. When Igot to know my studentsbetter,Idiscoveredthatallofthem had mastered anynumber of complicated ideasin their very complicateddaily lives. Honestly, was
![Page 115: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/115.jpg)
getting x all by itself in analgebraic equation all thatmuchharder?
My students weren’tequallytalented.Still,whenitcame to learning seventh-grademath,coulditbethatiftheyandImusteredsufficienteffortovertime,they’dgettowhere theyneeded?Surely, Ithought, they were alltalentedenough.
![Page 116: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/116.jpg)
Towardtheendoftheschoolyear, my fiancé became myhusband. For the sake of hisown post-McKinsey career,we packed up and movedfrom New York to SanFrancisco. I found a new jobteachingmathatLowellHighSchool.
Compared to my LowerEast Side classroom, Lowellwasanalternateuniverse.
Tucked away in aperpetually foggy basin near
![Page 117: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/117.jpg)
the Pacific Ocean, Lowell istheonlypublichighschoolinSan Francisco that admitsstudents on the basis ofacademic merit. The largestfeeder to the University ofCalifornia system, Lowellsendsmanyofitsgraduatestothe country’s most selectiveuniversities.
If, like me, you wereraisedontheEastCoast,youcan think of Lowell as theStuyvesant of San Francisco.
![Page 118: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/118.jpg)
Such imagerymight bring tomindwhizkidswhoareleapsand bounds smarter thanthosewho lack the top-notchtest scores and grades to getin.
WhatIdiscoveredwasthatLowell students weredistinguished more by theirwork ethic than by theirintelligence. I once askedstudents in my homeroomhowmuch they studied. Thetypical answer? Hours and
![Page 119: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/119.jpg)
hours.Notinaweek,butinasingleday.
Still, like at any otherschool,therewastremendousvariation in how hardstudents worked and howwelltheyperformed.
Just as I’d found in NewYork, some of the students Iexpected to excel, becausemath came so easy to them,did worse than theirclassmates. On the otherhand, some of my hardest
![Page 120: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/120.jpg)
workerswereconsistentlymyhighest performers on testsandquizzes.
One of these very hardworkerswasDavidLuong.
Davidwasinmyfreshmanalgebraclass.Thereweretwokinds of algebra classes atLowell: the accelerated trackled to Advanced PlacementCalculus by senior year, andtheregulartrack,whichIwasteaching,didn’t.Thestudentsin my class hadn’t scored
![Page 121: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/121.jpg)
high enough on Lowell’smath placement exam to getintotheacceleratedtrack.
David didn’t stand out atfirst. He was quiet and sattoward thebackof the room.Hedidn’traisehishandalot;herarelyvolunteeredtocometo the board to solveproblems.
But I soon noticed thatevery time I graded anassignment,Davidhadturnedin perfectwork.He acedmy
![Page 122: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/122.jpg)
quizzes and tests. When Imarkedoneofhisanswersasincorrect, it was more oftenmyerrorthanhis.And,wow,he was just so hungry tolearn. In class, his attentionwas rapt. After class, he’dstay and ask, politely, forharderassignments.
I began to wonder whattheheckthiskidwasdoinginmyclass.
Once I understood howridiculousthesituationwas,I
![Page 123: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/123.jpg)
marchedDavidintotheofficeof my department chair. Itdidn’t take long to explainwhat was going on.Fortunately, the chair was awise and wonderful teacherwhoplacedahighervalueonkids than on bureaucraticrules. She immediatelystarted the paperwork toswitchDavidoutofmyclassandintotheacceleratedtrack.
My loss was the nextteacher’s gain. Of course,
![Page 124: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/124.jpg)
there were ups and downs,and not all of David’s mathgradeswereA’s.“AfterIleftyour class, and switched intothemoreadvancedone,Iwasa little behind,” David latertoldme. “And the next year,math—it was geometry—continuedtobehard.Ididn’tget an A. I got a B.” In thenext class, his firstmath testcamebackwithaD.
“How did you deal withthat?”Iasked.
![Page 125: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/125.jpg)
“Ididfeelbad—Idid—butIdidn’tdwellonit.Iknewitwas done. I knew I had tofocusonwhattodonext.SoIwenttomyteacherandaskedfor help. I basically tried tofigure out, you know,what Ididwrong.What I needed tododifferently.”
Bysenioryear,Davidwastaking theharderofLowell’stwo honors calculus courses.That spring, he earned a
![Page 126: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/126.jpg)
perfect 5 out of 5 on theAdvancedPlacementexam.
After Lowell, Davidattended SwarthmoreCollege,graduatingwithdualdegrees in engineering andeconomics. I sat with hisparents at his graduation,remembering the quietstudent in the back of myclassroom who ended upprovingthataptitudetestscangetalotofthingswrong.
![Page 127: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/127.jpg)
Two years ago, Davidearned a PhD in mechanicalengineeringfromUCLA.Hisdissertation was on optimalperformance algorithms forthe thermodynamicprocessesin truck engines. In English:David used math to helpmake enginesmore efficient.Today, he is an engineer atthe Aerospace Corporation.Quite literally, the boy whowas deemed “not ready” forharder, fastermath classes is
![Page 128: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/128.jpg)
nowa“rocketscientist.”During the next several
yearsofteaching,Igrewlessandlessconvincedthattalentwas destiny and more andmore intriguedby thereturnsgeneratedbyeffort. Intentonplumbing the depths of thatmystery, I eventually leftteaching to become apsychologist.
![Page 129: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/129.jpg)
When I got to graduateschool, I learned thatpsychologists have longwondered why some peoplesucceed and others fail.Among the earliest wasFrancis Galton, who debatedthetopicwithhishalfcousin,CharlesDarwin.
By all accounts, Galtonwasachildprodigy.Byfour,he could read and write. Bysix, he knew Latin and longdivision and could recite
![Page 130: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/130.jpg)
passages from Shakespearebyheart.Learningcameeasy.
In 1869,Galton publishedhisfirstscientificstudyontheorigins of high achievement.After assembling lists ofwell-known figures inscience, athletics, music,poetry, and law—amongother domains—he gatheredwhatever biographicalinformation he could.Outliers, Galton concluded,areremarkableinthreeways:
![Page 131: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/131.jpg)
they demonstrate unusual“ability” in combinationwithexceptional “zeal” and “thecapacityforhardlabor.”
Afterreadingthefirstfiftypages of Galton’s book,Darwin wrote a letter to hiscousin, expressing surprisethat talentmade theshort listof essential qualities. “Youhave made a convert of anopponentinonesense,”wroteDarwin. “For I have alwaysmaintained that, excepting
![Page 132: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/132.jpg)
fools, men did not differmuchinintellect,onlyinzealand hard work; and I stillthink this is an eminentlyimportantdifference.”
Ofcourse,Darwinhimselfwas the sortofhighachieverGalton was trying tounderstand. Widelyacknowledged as one of themost influential scientists inhistory, Darwin was the firstto explain diversity in plantand animal species as a
![Page 133: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/133.jpg)
consequence of naturalselection. Relatedly, Darwinwas an astute observer, notonly of flora and fauna, butalsoofpeople.Inasense,hisvocation was to observeslight differences that lead,ultimately,tosurvival.
So it’s worth pausing toconsiderDarwin’sopiniononthe determinants ofachievement—that is, hisbeliefthatzealandhardwork
![Page 134: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/134.jpg)
areultimatelymoreimportantthanintellectualability.
On the whole, Darwin’sbiographers don’t claim hepossessed supernaturalintelligence.Hewascertainlyintelligent,butinsightsdidn’tcome to him in lightningflashes.Hewas,inasense,aplodder. Darwin’s ownautobiography corroboratesthis view: “I have no greatquickness of apprehension[that] is so remarkable in
![Page 135: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/135.jpg)
someclevermen,”headmits.“My power to follow a longand purely abstract train ofthought is very limited.” Hewould not havemade a verygood mathematician, hethinks,noraphilosopher,andhismemorywas subpar, too:“So poor in one sense ismymemory that I have neverbeen able to remember formorethanafewdaysasingledateoralineofpoetry.”
![Page 136: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/136.jpg)
Perhaps Darwin was toohumble. But he had noproblempraisinghispowerofobservation and theassiduousness with which heapplied it to understandingthe lawsof nature: “I think Iam superior to the commonrunofmeninnoticingthingswhicheasilyescapeattention,and in observing themcarefully. My industry hasbeen nearly as great as itcould have been in the
![Page 137: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/137.jpg)
observation and collection offacts. What is far moreimportant,myloveofnaturalscience has been steady andardent.”
One biographer describesDarwinassomeonewhokeptthinking about the samequestions long after otherswouldmoveontodifferent—and no doubt easier—problems:
![Page 138: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/138.jpg)
Thenormalresponsetobeing puzzled aboutsomethingistosay,“I’llthink about this later,”and then, in effect,forget about it. WithDarwin, one feels thathe deliberately did notengage in this kind ofsemi-willful forgetting.He kept all thequestions alive at thebackofhismind,readyto be retrieved when a
![Page 139: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/139.jpg)
relevant bit of datapresenteditself.
Fortyyearslater,ontheotherside of the Atlantic, aHarvard psychologist namedWilliam James took up thequestionofhowpeopledifferin their pursuit of goals.Toward the end of his longand distinguished career,Jameswrote an essay on thetopic for Science (then and
![Page 140: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/140.jpg)
now the premier academicjournal, not just forpsychology but for all of thenaturalandsocialsciences).Itwas titled “The Energies ofMen.”
Reflecting on theachievements and failures ofclose friends and colleagues,and how the quality of hisown efforts varied on hisgood and bad days, Jamesobserved:
![Page 141: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/141.jpg)
Compared with whatweought to be,we areonly half awake. Ourfires are damped, ourdrafts are checked.Wearemakinguseof onlya small part of ourpossible mental andphysicalresources.
There is a gap, Jamesdeclared, between potentialand itsactualization.Withoutdenying that our talents vary
![Page 142: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/142.jpg)
—onemightbemoremusicalthan athletic or moreentrepreneurialthanartistic—James asserted that “thehuman individual livesusually far within his limits;he possesses powers ofvarious sorts which hehabitually fails to use. Heenergizes below hismaximum, and he behavesbelowhisoptimum.”
“Of course there arelimits,”Jamesacknowledged.
![Page 143: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/143.jpg)
“Thetreesdon’tgrowintothesky.” But these outerboundariesofwherewewill,eventually, stop improvingare simply irrelevant for thevast majority of us: “Theplain fact remains that menthe world over possessamounts of resource, whichonly very exceptionalindividuals push to theirextremesofuse.”
These words, written in1907, are as true today as
![Page 144: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/144.jpg)
ever. So, why do we placesuchemphasisontalent?Andwhy fixate on the extremelimits of what we might dowhen, in fact,most of us areat the very beginning of ourjourney,sofar,farawayfromthoseouterbounds?Andwhydo we assume that it is ourtalent, rather than our effort,thatwilldecidewhereweendupintheverylongrun?
![Page 145: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/145.jpg)
For years, several nationalsurveyshaveasked:Whichismore important to success—talent or effort? Americansare about twice as likely tosingleouteffort.ThesameistruewhenyouaskAmericansabout athletic ability. Andwhen asked, “If you werehiringanewemployee,whichof the following qualitieswould you think is mostimportant?” Americansendorse “beinghardworking”
![Page 146: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/146.jpg)
nearly five times as often astheyendorse“intelligence.”
The results of thesesurveys are consistent withquestionnaires thatpsychologist Chia-Jung Tsayhasgiven tomusical experts,who, when asked, reliablyendorse effortful training asmore important than naturaltalent.ButwhenChiaprobesattitudesmore indirectly, sheexposes a bias that tips in
![Page 147: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/147.jpg)
exactlytheoppositedirection:welovenaturals.
In Chia’s experiments,professional musicians learnabout two pianists whosebiographies are identical interms of prior achievements.The subjects listen to a shortclip of these individualsplaying piano; unbeknownstto the listeners, a singlepianist is, in fact, playingdifferent parts of the samepiece.Whatvariesisthatone
![Page 148: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/148.jpg)
pianist is described as a“natural”withearly evidenceof innate talent. The other isdescribed as a “striver” withearly evidence of highmotivation and perseverance.Indirectcontradictiontotheirstated beliefs about theimportance of effort versustalent, musicians judge thenatural to be more likely tosucceedandmorehirable.
Asafollow-upstudy,Chiatested whether this same
![Page 149: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/149.jpg)
inconsistency would beevident in a very differentdomainwherehardworkandstriving are celebrated:entrepreneurship. Sherecruited hundreds of adultswith varying levels ofexperience in business andrandomly divided them intotwo groups. Half of herresearch subjects read theprofile of a “striver”entrepreneur, described ashaving achieved success
![Page 150: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/150.jpg)
through hard work, effort,and experience. The otherhalf read the profile of a“natural” entrepreneur,described as having achievedsuccess through innateability. All participantslistened to the same audiorecording of a businessproposal and were told therecording was made by thespecific entrepreneur they’dreadabout.
![Page 151: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/151.jpg)
As in her study ofmusicians, Chia found thatnaturalswereratedhigherforlikelihood of success andbeing hirable, and that theirbusiness proposals werejudgedsuperior inquality. Ina related study, Chia foundthatwhenpeoplewereforcedto choose between backingone of two entrepreneurs—oneidentifiedasastriver,theother a natural—they tendedto favor the natural. In fact,
![Page 152: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/152.jpg)
the point of indifferencebetween a striver and anatural was only reachedwhen the striver had fourmore years of leadershipexperienceand$40,000moreinstart-upcapital.
Chia’s researchpullsbackthe curtain on ourambivalence toward talentand effort. What we say wecare about may notcorrespond with what—deepdown—weactuallybelieveto
![Page 153: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/153.jpg)
bemorevaluable. It’s a littlelike saying we don’t care atall about physicalattractiveness in a romanticpartner and then, when itcomes to actually choosingwhom to date, picking thecuteguyovertheniceone.
The“naturalnessbias”isahidden prejudice againstthose who’ve achieved whatthey have because theyworked for it, and a hiddenpreference for those whom
![Page 154: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/154.jpg)
wethinkarrivedattheirplacein life because they’renaturally talented. We maynot admit to others this biasfornaturals;wemaynotevenadmit it toourselves.But thebias is evident in the choiceswemake.
Chia’s own life is aninteresting example of thenatural versus striverphenomenon. Now a
![Page 155: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/155.jpg)
professor at UniversityCollege London, shepublishes her scholarly workin the most prestigious ofacademicjournals.Asachild,she attended classes atJuilliard, whose pre-collegeprogram invites students“who exhibit the talent,potential, andaccomplishment to pursue acareer in music” toexperience “an atmosphere
![Page 156: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/156.jpg)
where artistic gifts andtechnicalskillscanflourish.”
ChiaholdsseveraldegreesfromHarvard.Herfirstwasabachelor’s degree inpsychology; she graduatedmagna cum laude withhighest honors. She also hastwomaster’s degrees: one inthehistoryofscienceandtheother in social psychology.And, finally, whilecompleting her PhD inorganizational behavior and
![Page 157: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/157.jpg)
psychology at Harvard, shealso picked up a secondaryPhDinmusic.
Impressed? If not, let meaddthatChiaalsohasdegreesfrom the PeabodyConservatory in pianoperformanceandpedagogy—and yes, she’s performed atCarnegieHall,nottomentionLincolnCenter, theKennedyCenter, and at the palacerecital commemorating the
![Page 158: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/158.jpg)
presidency of the EuropeanUnion.
If you only saw hercredentials,youmightleaptothe conclusion that Chiawasbornmoregiftedthananyoneyouknow:“Mygod!Whatanextraordinarily talentedyoung woman!” And, ifChia’s research is right, thatexplanation would embellishher accomplishments withmore luster, more mystery,and more awe than the
![Page 159: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/159.jpg)
alternative: “My god! Whatan extraordinarily dedicated,hardworkingyoungwoman!”
And then what wouldhappen? There’s a vastamount of research on whathappens when we believe astudent is especially talented.We begin to lavish extraattention on them and holdthem to higher expectations.Weexpectthemtoexcel,andthat expectation becomes aself-fulfillingprophecy.
![Page 160: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/160.jpg)
I’ve asked Chia what shemakes of her own musicalaccomplishments. “Well, Iguess I may have sometalent,” Chia said. “But Ithink,morethanthat,I lovedmusic so much I practicedfour to six hours a day allthroughout childhood.” Andin college, despite apunishingscheduleofclassesand activities, shemade timeto practice almost as much.
![Page 161: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/161.jpg)
So, yes, she has some talent—butshe’sastriver,too.
Why did Chia practice somuch? I wondered. Was itforced on her? Did she haveanychoiceinthematter?
“Oh, it was me. It waswhat I wanted. I wanted toget better and better andbetter. When I practicedpiano, I pictured myselfonstageinfrontofacrowdedaudience. I imagined themclapping.”
![Page 162: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/162.jpg)
Theyear I leftMcKinsey forteaching, three of the firm’spartners published a reportcalled“TheWar for Talent.”The report was widely readandeventuallybecameabest-selling book. The basicargumentwasthatcompaniesin the modern economy riseand fall depending on theirabilitytoattractandretain“Aplayers.”
![Page 163: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/163.jpg)
“What do we mean bytalent?” the McKinseyauthors ask in the book’sopening pages. Answeringtheir own question: “In themost general sense, talent isthesumofaperson’sabilities—his or her intrinsic gifts,skills,knowledge,experience,intelligence, judgment,attitude, character, and drive.It also includes his or herability to learn and grow.”That’s a long list, and it
![Page 164: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/164.jpg)
reveals the struggle most ofushavewhenwetrytodefinetalentwithanyprecision.Butit doesn’t surprise me that“intrinsic gifts” arementionedfirst.
When Fortune magazineput McKinsey on its cover,theleadarticlebegan:“Whenin the presence of a youngMcKinsey partner, one getsthedistinct impression that ifplied with a cocktail or two,hemightwell leanacross the
![Page 165: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/165.jpg)
table and suggest somethingawkward, like comparingSAT scores.” It’s almostimpossible, the journalistobserved, to overestimate“the premium placed withinthe McKinsey culture onanalytic ability, or as itsdenizens say, on being‘bright.’ ”
McKinsey is famous forrecruiting and rewardingsmart men and women—somewithMBAsfromplaces
![Page 166: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/166.jpg)
like Harvard and Stanford,and the rest, like me, whopossesssomeothercredentialthat suggests we must haveverybigbrains.
My interviews withMcKinsey unfolded as mostdo, with a series ofbrainteasers designed to testmy analytic mettle. Oneinterviewer satme down andintroduced himself, thenasked: “How many tennis
![Page 167: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/167.jpg)
balls aremanufactured in theUnitedStatesperyear?”
“I guess there are twoways to approach thatquestion,” I responded. “Thefirst way is to find the rightperson, or maybe tradeorganization,totellyou.”Myinterviewer nodded, but gavemealookthatsaidhewantedtheotherkindofanswer.
“Or you could take somebasic assumptions and do
![Page 168: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/168.jpg)
somemultiplying to figure itout.”
My interviewer smiledbroadly. So I gave himwhathewanted.
“Okay, assume there areabout two hundred fiftymillion people in the UnitedStates. Let’s say the mostactive tennis players arebetween the age of ten andthirty. That’s got to be,roughly speaking, one-fourthofthepopulation.Iguessthat
![Page 169: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/169.jpg)
gives you a little over sixtymillion potential tennisplayers.”
Now my interviewer wasreallyexcited.Icontinuedthelogic game, multiplying anddividing by numbersaccording to my completelyuninformed estimates of howmany people actually playtennis, and how often theyplay on average, and howmanyballstheywoulduseina game, and then how often
![Page 170: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/170.jpg)
they would need to replacedeadorlostones.
I got to some number,which was probably wildlyoff, because at every step Iwas making anotheruninformed assumption thatwas, to some degree oranother, incorrect. Finally, Isaid: “The math here isn’tthathardforme.I’mtutoringa little girl who is practicingher fractions right now, andwe do a lot of mental math
![Page 171: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/171.jpg)
together. But if you want toknowwhat I’d really do if Ineededtoknowtheanswertothatquestion,I’lltellyou:I’djust call someone whoactuallyknows.”
Moresmiling,andthenanassurance that he’d learnedall he needed to from ourinteraction.Andalsofrommyapplication—including mySATscores,whichMcKinseyheavily relies on to do theirearlysortingofcandidates.In
![Page 172: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/172.jpg)
other words, if the advice tocorporateAmericaistocreatea culture that values talentabove all else, McKinseypracticeswhatitpreaches.
Once I accepted the offer tojoin the New York Cityoffice,Iwastoldthatmyfirstmonth would be spent in afancy hotel in Clearwater,Florida. There I joined aboutthree dozen other new hires
![Page 173: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/173.jpg)
who, like me, lacked anytraining in business. Instead,each of us had earned someother academic badge ofhonor.Isatnexttoaguywitha PhD in physics, forexample. On my other sidewasasurgeon,andbehindmeweretwolawyers.
None of us knew muchaboutmanagementingeneral,or about any industry inparticular.Butthatwasabouttochange: ina singlemonth,
![Page 174: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/174.jpg)
we would complete a crashcourse called the “mini-MBA.” Since we were allvetted to be superfastlearners, there was noquestion that we wouldsuccessfullymasteramassiveamount of information in averyshortamountoftime.
Newly equipped with acasualacquaintancewithcashflow, the difference betweenrevenueandprofit, and someother rudimentaryfactsabout
![Page 175: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/175.jpg)
whatInowknewtocall“theprivate sector,” we wereshippedoff toourdesignatedoffices around the world,wherewewouldjointeamsofother consultants and bematched up with corporateclients to solve whateverproblemstheythrewourway.
I soon learned thatMcKinsey’s basic businessproposition isstraightforward. For a verylarge sum of money per
![Page 176: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/176.jpg)
month, companies can hire aMcKinsey team to solveproblems too thorny to besolved by the folks who arealreadyworking on them.Attheendofthis“engagement,”as it was called in the firm,weweresupposedtoproduceareportthatwasdramaticallymoreinsightfulthananythingtheycouldhavegeneratedin-house.
Itoccurredtome,asIwasputting together slides
![Page 177: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/177.jpg)
summarizing bold, sweepingrecommendations for amultibillion-dollar medicalproducts conglomerate, that,really, I had no idea what Iwastalkingabout.Thereweresenior consultants on theteam who may have knownmore, but there were alsomore junior consultantswho,having just graduated fromcollege, surely knew evenless.
![Page 178: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/178.jpg)
Whyhireus, then,atsuchan exorbitant cost?Well, forone thing, we had theadvantage of an outsider’sperspective untainted byinsiderpolitics.Wealsohadamethod for solving businessproblems thatwashypothesisand data driven. There wereprobablylotsofgoodreasonsCEOs brought in McKinsey.Butamongthem,Ithink,wasthat wewere supposed to besharper than the people who
![Page 179: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/179.jpg)
were already on-site. HiringMcKinsey meant hiring thevery“bestandbrightest”—asif being the brightest alsomadeusthebest.
According to The War forTalent, the companies thatexcel are those thataggressively promote themost talented employeeswhile just as aggressivelyculling the least talented. In
![Page 180: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/180.jpg)
such companies, hugedisparities in salary are notonly justified but desirable.Why?Becauseacompetitive,winner-take-all environmentencourages themost talentedto stick around and the leasttalented to find alternativeemployment.
Duff McDonald, thejournalist who’s done themost in-depth research onMcKinsey to date, hassuggested that this particular
![Page 181: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/181.jpg)
businessphilosophywouldbemoreaptly titledTheWaronCommon Sense. McDonaldpointsoutthat thecompanieshighlighted in the originalMcKinsey report asexemplars of their endorsedstrategy didn’t do so well intheyearsafterthatreportwaspublished.
Journalist MalcolmGladwell has also critiquedthe The War for Talent.Enron, he points out,
![Page 182: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/182.jpg)
epitomized the “talentmindset” approach tomanagement advocated byMcKinsey. As we all know,the Enron story doesn’t haveahappyending.Onceoneofthe largest energy tradingcompanies in the world,Enron was named America’sMostInnovativeCompanybyFortune magazine six yearsin a row.Yet, by the end of2001,whenthebusinessfiledforbankruptcy,ithadbecome
![Page 183: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/183.jpg)
clear that the company’sextraordinary profits wereattributable to massive andsystematic accounting fraud.When Enron collapsed,thousands of its employees,whohadnohandatallinthewrongdoing, lost their jobs,health insurance, andretirement savings. At thetime, it was the largestcorporate bankruptcy in U.S.history.
![Page 184: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/184.jpg)
Youcan’tblametheEnrondebacle on a surfeit of IQpoints.Youcan’tblameitona lack of grit, either. ButGladwellarguesconvincinglythat demanding Enronemployees prove that theywere smarter than everyoneelse inadvertentlycontributedto a narcissistic culture,withan overrepresentation ofemployees who were bothincredibly smug and drivenby deep insecurity to keep
![Page 185: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/185.jpg)
showingoff. Itwas a culturethat encouraged short-termperformance but discouragedlong-term learning andgrowth.
The same point comesthrough in the postmortemdocumentaryonEnroncalled,appropriately enough, TheSmartest Guys in the Room.During the company’sascendency, it was a brashand brilliant formerMcKinsey consultant named
![Page 186: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/186.jpg)
Jeff Skilling who wasEnron’s CEO. Skillingdeveloped a performancereviewsystemforEnron thatconsisted of gradingemployees annually andsummarily firing the bottom15percent.Inotherwords,nomatter what your absolutelevel of performance, if youwereweak,relativetoothers,you got fired. Inside Enron,this practice was known as“rank-and-yank.” Skilling
![Page 187: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/187.jpg)
considered itoneof themostimportant strategies hiscompanyhad.Butultimately,it may have contributed to awork environment thatrewarded deception anddiscouragedintegrity.
Is talentabad thing?Areweall equally talented? No andno. The ability to quicklyclimb the learning curve ofany skill is obviously a very
![Page 188: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/188.jpg)
goodthing,and,likeitornot,someofusarebetteratitthanothers.
Sowhy, then, is it such abad thing to favor “naturals”over “strivers”? What’s thedownsideoftelevisionshowslike America’s Got Talent,The X Factor, and ChildGenius? Why shouldn’t weseparatechildrenasyoungasseven or eight into twogroups: those few childrenwhoare“giftedandtalented”
![Page 189: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/189.jpg)
and the many, many morewho aren’t? What harm isthere, really, ina talentshowbeingnameda“talentshow”?
In my view, the biggestreason a preoccupation withtalent can be harmful issimple: By shining ourspotlight on talent, we riskleavingeverythingelseintheshadows. We inadvertentlysend the message that theseother factors—including grit
![Page 190: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/190.jpg)
—don’t matter as much astheyreallydo.
Consider,forexample,thestory of Scott BarryKaufman. Scott’s office isjust two doors down frommine, and he’s a lot like theother academic psychologistsI know: He spends most ofhis waking hours reading,thinking, collecting data,doing statistics, and writing.He publishes his research inscientific journals.He knows
![Page 191: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/191.jpg)
a lot of polysyllabic words.He has degrees fromCarnegie Mellon, CambridgeUniversity, and Yale. Heplaysthecelloforfun.
But as a child, Scott wasconsidered a slow learner—whichwas true. “Basically, Igotalotofearinfectionsasakid,” Scott explains. “Andthat led to this problemwithprocessing information fromsound in real time. I wasalways a step or two behind
![Page 192: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/192.jpg)
the other kids in my class.”So halting was his academicprogress, in fact, that hewasplaced in special educationclasses. He repeated thirdgrade.Aroundthesametime,he met with a schoolpsychologist to take an IQtest. Inananxiety-ridden testsession he describes as“harrowing,”Scottperformedsopoorlythathewassenttoaspecial school for childrenwithlearningdisabilities.
![Page 193: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/193.jpg)
It was not until agefourteen that an observantspecialeducationteachertookScottasideandaskedwhyhewasn’t in more challengingclasses.Until then, Scott hadnever questioned hisintellectual status. Instead,he’dassumedthathis lackoftalent would put a very lowceiling on what he might dowithhislife.
Meeting a teacher whobelievedinhispotentialwasa
![Page 194: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/194.jpg)
critical turning point: a pivotfromThisisallyoucandotoWhoknowswhatyoucando?Atthatmoment,Scottstartedwondering, for the very firsttime: Who am I? Am I alearningdisabledkidwithnoreal future? Or maybesomethingelse?
And then, to find out,Scottsignedupforjustaboutevery challenge his schoolhad tooffer.Latinclass.Theschool musical. Choir. He
![Page 195: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/195.jpg)
didn’t necessarily excel ineverything,buthe learned inall.WhatScottlearnedisthathewasn’thopeless.
Something that Scottfound he did learn fairlyeasily was the cello. Hisgrandfatherhadbeenacellistin the PhiladelphiaOrchestrafor nearly fifty years, andScott had the idea that hisgrandfather could give himlessons. He did, and thesummerthatScottfirstpicked
![Page 196: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/196.jpg)
up the cello, he beganpracticingeightorninehoursa day. He was fiercelydetermined to improve, andnot only because he enjoyedthecello:“Iwassodriven tojust show someone, anyone,that I was intellectuallycapable of anything. At thispoint Ididn’tevencarewhatitwas.”
Improvehedid,andbythefall, he earned a seat in hishigh school orchestra. If the
![Page 197: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/197.jpg)
storyendedthereandthen, itmight not be about grit. Buthere’s what happened next.Scott kept up—and evenincreased—hispracticing.Heskipped lunch to practice.Sometimesheskippedclassestopractice.Bysenioryear,hewassecondchair—hewasthesecond-best cellist in theorchestra—andhewas in thechoir, too, and winning allkinds of awards from themusicdepartment.
![Page 198: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/198.jpg)
Healso starteddoingwellinhisclasses,manyofwhichwere now honors classes.Almostallofhisfriendswerein the gifted and talentedprogram,andScottwantedtojoin them.Hewanted to talkabout Plato and do mentalpuzzles and learn more thanhe was already learning. Ofcourse, with his IQ scoresfromchildhood,therewasnosuch possibility. Heremembers the school
![Page 199: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/199.jpg)
psychologist drawing a bell-shapedcurveonthebackofanapkin and pointing to itspeak—“This is average”—then moving to the right—“This iswhere you’d haveto be for gifted and talentedclasses”—andthenmovingtothe left—“And this is whereyouare.”
“At what point,” Scottasked, “does achievementtrumppotential?”
![Page 200: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/200.jpg)
The school psychologistshook his head and showedScottthedoor.
Thatfall,Scottdecidedhewanted to study this thingcalled “intelligence” andcometohisownconclusions.He applied to the cognitivescience program at CarnegieMellon University. And hewas rejected. The rejectionletterdidnot specifywhy,ofcourse, but given his stellargrades and extracurricular
![Page 201: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/201.jpg)
accomplishments,Scottcouldonly conclude that theimpedimentwashislowSATscores.
“I had this grit,” Scottrecalls.“Isaid, ‘I’mgoing todo it. I don’t care. I’mgoingtofindawaytostudywhatIwant to study.’ ” And thenScottauditionedforCarnegieMellon’s opera program.Why? Because the operaprogram didn’t look veryhard atSAT scores, focusing
![Page 202: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/202.jpg)
instead on musical aptitudeand expression. In his firstyear,Scotttookapsychologycourse as an elective. Soonafter,headdedpsychologyasaminor.Next, he transferredhis major from opera topsychology. And then hegraduatedPhiBetaKappa.
Like Scott, I took an IQ testearly in my schooling andwas deemed insufficiently
![Page 203: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/203.jpg)
bright to benefit from giftedand talented classes. Forwhatever reason—maybe ateacher asked that I beretested—I was evaluatedagain thefollowingyear,andI made the cut. I guess youcould say I was borderlinegifted.
Onewaytointerpret thesestories is that talent is great,but tests of talent stink.There’scertainlyanargumenttobemadethattestsoftalent
![Page 204: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/204.jpg)
—and tests of anything elsepsychologists study,including grit—are highlyimperfect.
But another conclusion isthat the focus on talentdistracts us from somethingthat is at least as important,and that is effort. In thenextchapter, I’ll argue that, asmuch as talent counts, effortcountstwice.
![Page 205: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/205.jpg)
Chapter3
EFFORTCOUNTSTWICE
![Page 206: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/206.jpg)
NotadaygoesbythatIdon’tread or hear theword talent.In every section of thenewspaper—from the sportspage to the business section,from profiles of actors andmusicians in the weekendsupplement, to front-pagestories of rising stars inpolitics—allusions to talentabound. It seems that whenanyone accomplishes a featworthwriting about,we rushto anoint that individual as
![Page 207: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/207.jpg)
extraordinarily“talented.”If we overemphasize
talent, we underemphasizeeverything else. In theextreme,it’sasif,deepdown,we hold the following to betrue:
For instance, I recentlylistened to a radiocommentator draw a
![Page 208: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/208.jpg)
comparison between HillaryandBillClinton.Heobservedthat both are unusually goodcommunicators. But whileher husband, Bill, is a giftedpolitician, Hillary has tocontort herself into the role.Bill is a natural; Hillarymerely a striver. The unsaidbut obvious implication is
![Page 209: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/209.jpg)
that she’ll never quite be hisequal.
I’ve caught myself doingit,too.Whensomeonereally,really impresses me, I mightreflexively say to myself:Whatagenius!Ishouldknowbetter. I do. Sowhat’s goingon? Why does anunconscious bias towardtalentpersist?
![Page 210: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/210.jpg)
A few years ago, I read astudy of competitiveswimmers titled “TheMundanity of Excellence.”The title of the articleencapsulates its majorconclusion:themostdazzlinghuman achievements are, infact, the aggregate ofcountlessindividualelements,each ofwhich is, in a sense,ordinary.
Dan Chambliss, thesociologist who completed
![Page 211: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/211.jpg)
the study, observed:“Superlative performance isreallyaconfluenceofdozensof small skills or activities,eachonelearnedorstumbledupon, which have beencarefully drilled into habitandthenarefittedtogetherinasynthesizedwhole.Thereisnothing extraordinary orsuperhuman in any one ofthose actions; only the factthat they are doneconsistently and correctly,
![Page 212: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/212.jpg)
and all together, produceexcellence.”
But mundanity is a hardsell. When finishing up hisanalyses, Dan shared a fewchapters with a colleague.“Youneed to jazz it up,”hisfriend said. “You need tomake these people moreinteresting....”
When I called Dan toprobe a few of hisobservations, I learned thathe’d become fascinated with
![Page 213: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/213.jpg)
the idea of talent—and whatwe really mean by it—as aswimmer himself and, forseveral years afterward, as apart-time coach. As a youngassistant professor, Dandecided to do an in-depth,qualitative study ofswimmers. In total, Dandevoted six years tointerviewing, watching, andsometimes living andtravelingwith swimmers andcoaches at all levels—from
![Page 214: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/214.jpg)
thelocalswimclubtoaneliteteam made up of futureOlympians.
“Talent,” he observed, “isperhaps the most pervasivelay explanation we have forathletic success.” It is as iftalent were some invisible“substancebehindthesurfacerealityofperformance,whichfinally distinguishes the bestamong our athletes.” Andthese great athletes seemblessed “with a special gift,
![Page 215: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/215.jpg)
almost a ‘thing’ inside ofthem,deniedtotherestofus—perhaps physical, genetic,psychological, orphysiological.Somehave‘it,’and some don’t. Some are‘natural athletes,’ and somearen’t.”
I think Dan is exactlyright.Ifwecan’texplainhowan athlete, musician, oranyone else has donesomething jaw-droppinglyamazing, we’re inclined to
![Page 216: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/216.jpg)
throw up our hands and say,“It’sagift!Nobodycanteachyou that.” In other words,whenwecan’teasilyseehowexperience and training gotsomeone to a level ofexcellence that is so clearlybeyond the norm,we defaultto labeling that person a“natural.”
Dan points out that thebiographies of greatswimmersrevealmany,manyfactorsthatcontributetotheir
![Page 217: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/217.jpg)
ultimate success. Forinstance, the mostaccomplished swimmersalmost invariablyhadparentswho were interested in thesport and earned enoughmoney to pay for coaching,traveltoswimmeets,andnotthe least important: access toa pool. And, crucially, therewere the thousands of hoursof practice in the pool overyears and years—all spentrefining the many individual
![Page 218: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/218.jpg)
elementswhose sumcreateasingleflawlessperformance.
Though it seemswrong toassume that talent is acomplete explanation fordazzling performance, it’salso understandable. “It’seasy to do,” Dan explained,“especially if one’s onlyexposure to top athletescomes once every four yearswhilewatching theOlympicson television, or if one onlysees them in performances
![Page 219: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/219.jpg)
rather than in day-to-daytraining.”
Anotherpointhemakes isthat the minimal talentneeded to succeed inswimmingislowerthanmostofusthink.
“Idon’tthinkyoumeantosay that any of us could beMichael Phelps,” I said. “Doyou?”
“No, of course not,” Danreplied.“Tobeginwith,thereare certain anatomical
![Page 220: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/220.jpg)
advantages that you reallycan’ttrainfor.”
“And,” I continued,“wouldn’t you say that someswimmersimprovemorethanothers, even if they’re tryingequally hard and getting thesamecoaching?”
“Yes,butthemainthingisthat greatness is doable.Greatness is many, manyindividual feats, and each ofthemisdoable.”
![Page 221: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/221.jpg)
Dan’s point is that if youhad a time-lapse film of thehours and days and weeksand years that producedexcellence, you could seewhathesaw:thatahighlevelofperformance is, in fact, anaccretion of mundane acts.But does the incrementalmastery of mundaneindividual componentsexplain everything? Iwondered.Isthatallthereis?
![Page 222: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/222.jpg)
“Well,wealllovemysteryand magic,” he said. “I do,too.”
Then Dan told me aboutthe day he got to watchRowdy Gaines and MarkSpitz swim laps. “Spitz wonsevengoldmedals in the ’72Olympics and was the bigthingbeforeMichaelPhelps,”heexplained. “In ’84, twelveyears after retirement, Spitzshowed up. He’s in hismid-thirties.And he gets into the
![Page 223: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/223.jpg)
water with Rowdy Gaines,who at that time held theworld record in the onehundred free. They did somefifties—in other words, twolengths of the pool, justsprints, like little races.Gaineswonmostofthem,butby the time they werehalfway through, the entireteamwasstandingaroundtheedgeofthepooljusttowatchSpitzswim.”
![Page 224: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/224.jpg)
Everyoneon the teamhadbeen training with Gaines,and they knew how good hewas. They knew he wasfavoredtowinOlympicgold.But because of the age gap,nobodyhadswumwithSpitz.
One swimmer turned toDan and said, pointing toSpitz,“Mygod.He’safish.”
IcouldhearthewonderinDan’s voice. Even a studentof mundanity, it seems, iseasily lulled into talent
![Page 225: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/225.jpg)
explanations. Ipressedhimabit.Was that sort ofmajesticperformance somethingdivine?
Dan told me to go readNietzsche.
Nietzsche? Thephilosopher? What would anineteenth-century Germanphilosopher have to say thatmightexplainMarkSpitz?Asit turns out, Nietzsche, too,had thought long and hardaboutthesamequestions.
![Page 226: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/226.jpg)
“With everything perfect,”Nietzsche wrote, “we do notask how it came to be.”Instead, “we rejoice in thepresentfactasthoughitcameoutofthegroundbymagic.”
WhenIreadthatpassage,Ithought of the youngswimmerswatchingtheiriconSpitzexhibitformthatalmostdidn’tseemhuman.
“No one can see in thework of the artist how it has
![Page 227: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/227.jpg)
become,” Nietzsche said.“That is its advantage, forwhereverone can see the actof becoming one growssomewhat cool.” In otherwords, we want to believethat Mark Spitz was born toswiminawaythatnoneofuswere and that none of uscould. We don’t want to siton the pool deck and watchhimprogressfromamateurtoexpert. We prefer our
![Page 228: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/228.jpg)
excellence fully formed. Weprefermysterytomundanity.
But why? What’s thereason for fooling ourselvesinto thinking Mark Spitzdidn’tearnhismastery?
“Ourvanity,ourself-love,promotes the cult of thegenius,”Nietzsche said. “Forif we think of genius assomething magical, we arenot obliged to compareourselves and find ourselveslacking. . . .Tocallsomeone
![Page 229: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/229.jpg)
‘divine’means:‘herethereisnoneedtocompete.’ ”
In other words,mythologizing natural talentletsusalloffthehook.Itletsus relax into the status quo.That’s what undoubtedlyoccurred inmyearlydaysofteaching when I mistakenlyequated talent andachievement, and by doingso, removed effort—bothmystudents’ andmyown—fromfurtherconsideration.
![Page 230: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/230.jpg)
So what is the reality ofgreatness?Nietzschecame tothe same conclusion DanChambliss did. Great thingsare accomplished by those“people whose thinking isactive in one direction, whoemploy everything asmaterial, who alwayszealously observe their owninner life and that of others,who perceive everywheremodels and incentives, whonever tire of combining
![Page 231: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/231.jpg)
together the means availabletothem.”
And what about talent?Nietzsche implored us toconsider exemplars to be,aboveallelse,craftsmen:“Donot talk about giftedness,inborntalents!Onecannamegreat men of all kinds whowere very little gifted. Theyacquired greatness, became‘geniuses’ (asweput it). . . .They all possessed thatseriousness of the efficient
![Page 232: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/232.jpg)
workmanwhichfirstlearnstoconstruct the parts properlybeforeitventurestofashionagreat whole; they allowedthemselves time for it,because they took morepleasure inmaking the little,secondarythingswell thaninthe effect of a dazzlingwhole.”
In my second year ofgraduateschool,Isatdownto
![Page 233: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/233.jpg)
a weekly meeting with myadvisor, Marty Seligman. Iwas more than a littlenervous.Martyhasthateffecton people, especially hisstudents.
Then in his sixties,Martyhad won just about everyaccolade psychology has tooffer. His early research ledto an unprecedentedunderstanding of clinicaldepression.More recently, aspresident of the American
![Page 234: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/234.jpg)
PsychologicalAssociation,hechristened the field ofPositive Psychology, adiscipline that applies thescientificmethodtoquestionsofhumanflourishing.
Marty is barrel-chestedand baritone-voiced.Hemaystudy happiness and well-being, but cheerful is not awordI’dusetodescribehim.
In themiddle ofwhateveritwasIwassaying—areportonwhat I’d done in the past
![Page 235: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/235.jpg)
week, I suppose, or the nextsteps in one of our researchstudies—Marty interrupted.“Youhaven’thadagoodideaintwoyears.”
I stared at him,openmouthed, trying toprocess what he’d just said.ThenIblinked.Twoyears?Ihadn’t even been in graduateschoolfortwoyears!Silence.Thenhe crossedhis arms,
frowned, and said: “You can
![Page 236: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/236.jpg)
do all kinds of fancystatistics. You somehow getevery parent in a school toreturn their consent form.You’vemadeafewinsightfulobservations. But you don’thave a theory. You don’thave a theory for thepsychologyofachievement.”Silence.“What’s a theory?” I
finally asked, havingabsolutelynoclueas towhathewastalkingabout.
![Page 237: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/237.jpg)
Silence.“Stopreadingsomuchand
gothink.”I left his office,went into
mine, and cried. At homewith my husband, I criedmore. I cursed Marty undermybreath—andaloudaswell—forbeingsuchajerk.WhywashetellingmewhatIwasdoingwrong?Whywasn’thepraising me for what I wasdoingright?
![Page 238: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/238.jpg)
You don’t have atheory....
Those words rattledaround inmymind for days.Finally, I dried my tears,stopped my cursing, and satdown at my computer. Iopened the word processorand stared at the blinkingcursor, realizing I hadn’tgotten far beyond the basicobservation that talent wasnotenoughtosucceedinlife.I hadn’t worked out how,
![Page 239: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/239.jpg)
exactly, talent and effort andskill and achievement all fittogether.
Atheoryisanexplanation.Atheory takes a blizzard offacts and observations andexplains, in the most basicterms,whattheheckisgoingon. By necessity, a theory isincomplete. It oversimplifies.But in doing so, it helps usunderstand.
![Page 240: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/240.jpg)
If talent falls short ofexplaining achievement,what’smissing?
I have beenworking on atheory of the psychology ofachievement since Martyscolded me for not havingone. I have pages and pagesofdiagrams,fillingmorethana dozen lab notebooks.Aftermore than a decade ofthinking about it, sometimesalone, and sometimes inpartnership with close
![Page 241: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/241.jpg)
colleagues,IfinallypublishedanarticleinwhichIlaydowntwo simple equations thatexplain how you get fromtalenttoachievement.
Heretheyare:
Talentishowquicklyyourskills improve when youinvest effort. Achievement is
![Page 242: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/242.jpg)
what happenswhen you takeyour acquired skills and usethem. Of course, youropportunities—for example,having a great coach orteacher—mattertremendously,too,andmaybemorethananythingabouttheindividual.Mytheorydoesn’taddress these outside forces,nor does it include luck. It’sabout the psychology ofachievement, but because
![Page 243: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/243.jpg)
psychology isn’t all thatmatters,it’sincomplete.
Still, I think it’s useful.What this theory says is thatwhen you considerindividuals in identicalcircumstances, what eachachievesdependson just twothings, talent and effort.Talent—howfastweimprovein skill—absolutely matters.But effort factors into thecalculations twice, not once.Effortbuildsskill.Atthevery
![Page 244: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/244.jpg)
same time, effortmakes skillproductive.Letmegiveyouafewexamples.
There’s a celebrated potternamed Warren MacKenziewholivesinMinnesota.Nowninety-two years old, he hasbeen at his craft, withoutinterruption, for nearly hisentire adult life.Earlyon,heand his late wife, also anartist, tried a lot of different
![Page 245: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/245.jpg)
things: “You know, whenyou’re young, you think youcan do anything, and wethought, oh,we’ll be potters,we’ll be painters, we’ll betextile designers, we’ll bejewelers, we’ll be a little ofthis, a littleof that.Weweregoing to be the renaissancepeople.”
It soon became clear thatdoing one thing better andbetter might be moresatisfying than staying an
![Page 246: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/246.jpg)
amateur at many differentthings:“Eventuallybothofusgave up the drawing andpainting, gave up the silk-screening,gaveup the textiledesign, and concentrated onceramic work, because thatwas where we felt our trueinterestlay.”
MacKenzie told me “agoodpottercanmakefortyorfifty pots in a day.” Out ofthese, “some of them aregood and some of them are
![Page 247: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/247.jpg)
mediocre and some of themare bad.”Only a fewwill beworth selling, and of those,even fewer “will continue toengage the senses after dailyuse.”
Ofcourse, it’snot just thenumber of good potsMacKenzie makes that hasbrought the art world to hisdoor.It’sthebeautyandformof the pots: “I’m striving tomake things which are themost exciting things I can
![Page 248: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/248.jpg)
make thatwill fit inpeople’shomes.” Still, as asimplification,youmight saythatthenumberofenduringlybeautiful, exquisitely usefulpots MacKenzie is able toproduce,intotal,willbewhathe accomplishes as an artist.Itwouldnotsatisfyhimtobeamong the most masterfulpottersbutonlyproduce,say,one or two pieces in hislifetime.
![Page 249: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/249.jpg)
MacKenzie still throwsclay on thewheel every day,and with effort his skill hasimproved: “I think back tosome of the pots we madewhen we first started ourpottery, and theywere prettyawfulpots.Wethoughtatthetime they were good; theywerethebestwecouldmake,but our thinking was soelemental that the pots hadthat quality also, and so theydon’t have a richness about
![Page 250: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/250.jpg)
themwhich I look for inmyworktoday.”
“The first 10,000 pots aredifficult,” he has said, “andthenitgetsalittlebiteasier.”
As things got easier, andas MacKenzie improved, heproduced more good pots aday:
talentxeffort=skill
![Page 251: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/251.jpg)
At the same time, thenumber of good pots he’sbrought into the worldincreased:
skillxeffort=achievement
With effort, MacKenziehasgottenbetterandbetteratmaking “the most excitingthingsIcanmakethatwillfitin people’s homes.” At the
![Page 252: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/252.jpg)
same time, with the sameinvested effort, he hasbecomemoreaccomplished.
“Garp was a naturalstoryteller.”
This is a line from JohnIrving’s fourth novel, TheWorld According to Garp.Like that novel’s fictionalprotagonist, Irving tells agreat story. He has beenlauded as “the great
![Page 253: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/253.jpg)
storyteller of Americanliterature today.” To date,he’s written more than adozen novels,most ofwhichhave been best sellers andhalfofwhichhavebeenmadeinto movies. The WorldAccording to Garp won theNational Book Award, andIrving’s screenplay for TheCider House Rules won anAcademyAward.
But unlike Garp, Irvingwasnotanatural.WhileGarp
![Page 254: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/254.jpg)
“could make things up, onerightaftertheother,andtheyseemedtofit,”Irvingrewritesdraftafterdraftofhisnovels.Of his early attempts atwriting, Irving has said,“Most of all, I rewroteeverything...Ibegantotakemylackoftalentseriously.”
IrvingrecallsearningaC–in high school English. HisSATverbalscorewas475outof 800, which means almosttwo-thirds of the students
![Page 255: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/255.jpg)
who took theSATdid betterthan him. He needed to stayin high school an extra yearto have enough credits tograduate. Irving recalls thathis teachers thought he wasboth“lazy”and“stupid.”
Irvingwasneitherlazynorstupid. But he was severelydyslexic: “I was anunderdog. . . . If myclassmates could read ourhistoryassignmentinanhour,Iallowedmyselftwoorthree.
![Page 256: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/256.jpg)
If I couldn’t learn to spell, Iwouldkeepalistofmymostfrequentlymisspelledwords.”When his own son wasdiagnosed with dyslexia,Irvingfinallyunderstoodwhyhe, himself, had been such apoor student. Irving’s sonread noticeably slower thanhis classmates, “with hisfinger following the sentence—as I read, as I still read.Unless I’ve written it, I read
![Page 257: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/257.jpg)
whatever‘it’isveryslowly—andwithmyfinger.”
Since reading and writingdidn’t come easily, Irvinglearned that “to do anythingreally well, you have tooverextend yourself. . . . Inmy case, I learned that I justhad to pay twice as muchattention.Icametoappreciatethat in doing something overand over again, somethingthat was never naturalbecomes almost second
![Page 258: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/258.jpg)
nature. You learn that youhavethecapacityforthat,andthat it doesn’t comeovernight.”
Do the precociouslytalentedlearnthatlesson?Dothey discover that thecapacitytodosomethingoverandoveragain,tostruggle,tohave patience, can bemastered—butnotovernight?
Some might. But thosewhostruggleearlymay learnit better: “One reason I have
![Page 259: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/259.jpg)
confidenceinwritingthekindofnovelsIwrite,”Irvingsaid,“is that I have confidence inmy stamina to go oversomethingagainandagainnomatter how difficult it is.”After his tenth novel, Irvingobserved,“Rewriting iswhatIdobest as awriter. I spendmoretimerevisinganovelorscreenplaythanItaketowritethefirstdraft.”
“It’s become anadvantage,” Irving has
![Page 260: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/260.jpg)
observed of his inability toread and spell as fluently asothers.“Inwritinganovel, itdoesn’thurtanybody tohaveto go slowly. It doesn’t hurtanyoneasawriter tohave togo over something again andagain.”
With daily effort, Irvingbecame one of the mostmasterful and prolificwritersin history. With effort, hebecame a master, and witheffort, his mastery produced
![Page 261: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/261.jpg)
stories that have touchedmillions of people, includingme.
Grammy Award–winningmusician and Oscar-nominated actor Will Smithhasthoughtalotabouttalent,effort,skill,andachievement.“I’ve never really viewedmyself as particularlytalented,” he once observed.
![Page 262: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/262.jpg)
“Where I excel is ridiculous,sickeningworkethic.”
Accomplishment,inWill’seyes, is very much aboutgoing the distance. Asked toexplainhisascendancytotheentertainmentelite,Willsaid:
The only thing that Isee that is distinctlydifferent about me is:I’mnotafraidtodieonatreadmill.Iwillnotbeoutworked,period.You
![Page 263: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/263.jpg)
might havemore talentthan me, you might besmarter than me, youmight be sexier thanme.Youmightbeallofthosethings.Yougotiton me in ninecategories. But if weget on the treadmilltogether, there’s twothings: You’re gettingofffirst,orI’mgoingtodie. It’s really thatsimple.
![Page 264: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/264.jpg)
In 1940, researchers atHarvard University had thesame idea. In a studydesigned to understand the“characteristics of healthyyoungmen”inorderto“helppeople live happier, moresuccessful lives,” 130sophomores were asked torun on a treadmill for up tofive minutes. The treadmillwas set at sucha steepangleandcrankeduptosuchafastspeed that the average man
![Page 265: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/265.jpg)
heldonforonlyfourminutes.Somelastedforonlyaminuteandahalf.
By design, the TreadmillTestwasexhausting.Notjustphysically but mentally. Bymeasuringand thenadjustingfor baseline physical fitness,the researchers designed theTreadmill Test to gauge“stamina and strength ofwill.” In particular, Harvardresearchersknewthatrunninghard was not just a function
![Page 266: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/266.jpg)
of aerobic capacity andmuscle strength but also theextent to which “a subject iswillingtopushhimselforhasa tendency to quit before thepunishment becomes toosevere.”
Decades later, apsychiatrist named GeorgeVaillant followed up on theyoung men in the originalTreadmillTest.Then in theirsixties, these men had beencontacted by researchers
![Page 267: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/267.jpg)
every two years sincegraduating from college, andfor each there was acorresponding file folder atHarvard literally burstingwith questionnaires,correspondence, and notesfromin-depthinterviews.Forinstance, researchers notedfor each man his income,career advancement, sickdays, social activities, self-reported satisfaction withwork and marriage, visits to
![Page 268: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/268.jpg)
psychiatrists, and use ofmood-altering drugs liketranquilizers. All thisinformation went intocomposite estimates of themen’s overall psychologicaladjustmentinadulthood.
Itturnsoutthatruntimeinthe Treadmill Test at agetwenty was a surprisinglyreliable predictor ofpsychological adjustmentthroughoutadulthood.Georgeand his team considered that
![Page 269: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/269.jpg)
staying on the treadmill wasalso a function of howphysicallyfit thesemenwerein their youth, and that thisfindingmerely indicated thatphysicalhealthpredictedlaterpsychological well-being.However, they found thatadjusting for baselinephysical fitness “had littleeffect on the correlation ofrunning time with mentalhealth.”
![Page 270: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/270.jpg)
Inotherwords,WillSmithis on to something. When itcomes to howwe fare in themarathonoflife,effortcountstremendously.
“How long would youhave stayed on thetreadmill?” I asked Georgerecently. I wanted to knowbecause, inmy eyes, Georgeis himself a paragon of grit.Early in his career, not longaftercompletinghisresidencyin psychiatry, George
![Page 271: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/271.jpg)
discoveredthetreadmilldata,along with all the otherinformation on the mencollectedtothatpoint.Likeabaton, the study had beenhanded from one researchteam to another, withdwindling interest andenergy.Untilitgottohim.
George revived the study.Hereestablishedcontactwiththe men by mail and phoneand, in addition, interviewedeach in person, traveling to
![Page 272: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/272.jpg)
allcornersoftheworldtodoso. Now in his eighties,George has outlived most ofthemenintheoriginalstudy.He is currently writing hisfourth book on what is bynow the longest continuousstudy of human developmenteverundertaken.
In answer to my questionabout his own treadmillperseverance,Georgereplied,“Oh, I’m not all thatpersistent. When I do
![Page 273: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/273.jpg)
crossword puzzles on theairplane, I always lookat theanswerswhenIamalittlebitfrustrated.”
So,notverygrittywhenitcomestocrosswordpuzzles.
“And when something isbroken in thehouse, I turn itovertomywife,andshefixesit.”
“Soyoudon’tthinkyou’regritty?”Iasked.
“The reason why theHarvardstudyworksis thatI
![Page 274: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/274.jpg)
havebeendoingitconstantlyand persistently. It’s the oneball I’ve kept my eye on.Because I’m totallyfascinated by it. There isnothingmore interesting thanwatchingpeoplegrow.”
And then, after a shortpause, George recalled hisdaysatprepschool,where,asa varsity track athlete, hecompetedinpolevaulting.Toimprove, he and the othervaulters did pull-ups, which
![Page 275: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/275.jpg)
hecalls“chins,”becauseyoustartbyhangingoffabarandthenpullyourselfuptowhereyour chin hovers just above,then you drop down again,andrepeat.
“I could do more chinsthan anyone. And it wasn’tbecauseIwasveryathletic—Iwasn’t.The reason is that Idid a lot of chin-ups. Ipracticed.”
![Page 276: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/276.jpg)
The prolific writer anddirector Woody Allen, whenasked about his advice foryoungartists,oncesaid:
My observation wasthat once a personactually completed aplay or a novel hewaswell on his way togetting it produced orpublished, as opposedto a vast majority ofpeople who tell me
![Page 277: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/277.jpg)
their ambition is towrite, but who strikeout on the very firstlevel and indeed neverwritetheplayorbook.
Or, in Allen’s snappierformulation, “Eighty percentof success in life is showingup.”
Back in the 1980s, bothGeorge H. W. Bush andMario Cuomo frequentlyrepeatedthisbitofwisdomin
![Page 278: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/278.jpg)
speech after speech, turningthesayingintosomethingofameme. So, while theseleadersoftheRepublicanandDemocraticpartiesmusthavedisagreed on a great manythings,theywereincompleteconsensus on the importanceoffollowingthroughonwhatonehasstarted.
ItoldGeorgeVaillantthat,if I’d been on the Harvardresearch team in 1940, Iwould have made a
![Page 279: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/279.jpg)
suggestion. I would haveallowed the young men tocome back the next day, ifthey wanted, and try theTreadmill Test again. Isuspectthatsomewouldhavecome back to see if theycouldstayonlonger,whereasothers would have beencontent with their first timedeffort. Maybe some wouldask the researchers whetherthey knew of any strategies,physicalormental,inorderto
![Page 280: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/280.jpg)
last longer.Andmaybe thesefellows would even beinterestedinathirdtry,andafourth. . . . Then I wouldcreate a grit score based onhow many times menvoluntarily returned to see iftheycouldimprove.
Stayingonthetreadmill isone thing, and Ido think it’srelated to staying true to ourcommitments even whenwe’re not comfortable. Butgetting back on the treadmill
![Page 281: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/281.jpg)
the next day, eager to tryagain, is in my view evenmore reflective of grit.Because when you don’tcome back the next day—when you permanently turnyour back on a commitment—your effort plummets tozero.Asaconsequence,yourskills stop improving, and atthe same time, you stopproducing anything withwhateverskillsyouhave.
![Page 282: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/282.jpg)
Thetreadmillis,infact,anappropriate metaphor. Bysome estimates, about 40percent of people who buyhome exercise equipmentlatersaytheyendedupusingit less than they’d expected.Howhardwepushourselvesinagivenworkoutmatters,ofcourse,but I think thebiggerimpediment to progress isthat sometimes we stopworking out altogether. Asany coach or athletewill tell
![Page 283: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/283.jpg)
you, consistency of effortover the long run iseverything.
Howoftendopeople startdownapathandthengiveupon it entirely? How manytreadmills,exercisebikes,andweight sets are at this verymoment gathering dust inbasements across thecountry? How many kids goout for a sport and then quiteven before the season isover? How many of us vow
![Page 284: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/284.jpg)
toknitsweatersforallofourfriends but onlymanage halfa sleeve before putting downthe needles? Ditto for homevegetable gardens, compostbins,anddiets.Howmanyofus start something new, fullof excitement and goodintentions,andthengiveup—permanently—when weencounter the first realobstacle,thefirstlongplateauinprogress?
![Page 285: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/285.jpg)
Manyofus, it seems,quitwhat we start far too earlyand far toooften.Evenmorethantheeffortagrittypersonputs inona singleday,whatmatters is that they wake upthe next day, and the next,ready togeton that treadmillandkeepgoing.
If I have the mathapproximately right, thensomeonetwiceastalentedbut
![Page 286: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/286.jpg)
half as hardworking asanother person might reachthesamelevelofskillbutstillproduce dramatically lessover time.This is because asstriversareimprovinginskill,they are also employing thatskill—to make pots, writebooks, direct movies, giveconcerts. If the quality andquantityofthosepots,books,movies,andconcertsarewhatcount, then the striver whoequals the person who is a
![Page 287: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/287.jpg)
natural in skill by workingharder will, in the long run,accomplishmore.
“The separation of talentand skill,”Will Smith pointsout, “is one of the greatestmisunderstood concepts forpeople who are trying toexcel,whohavedreams,whowanttodothings.Talentyouhave naturally. Skill is onlydevelopedbyhoursandhoursandhoursofbeatingonyourcraft.”
![Page 288: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/288.jpg)
I would add that skill isnot the same thing asachievement, either. Withouteffort, your talent is nothingmore than your unmetpotential.Withouteffort,yourskill is nothing more thanwhatyoucouldhavedonebutdidn’t. With effort, talentbecomesskilland,attheverysame time, effortmakes skillproductive.
![Page 289: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/289.jpg)
Chapter4
HOWGRITTYAREYOU?
I recently gave a lecture ongrit to undergraduates at the
![Page 290: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/290.jpg)
WhartonSchool ofBusiness.Even before I’d cleared mynotes from the podium, anaspiring entrepreneur rushedtointroducehimself.
Hewas charming—full ofthe energy and enthusiasmthat makes teaching youngpeople so rewarding.Breathlessly, he told me astory meant to illustrate hisown prodigious grit. Earlierthat year, he’d raisedthousands of dollars for his
![Page 291: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/291.jpg)
start-up, going to heroiclengths to do so, and pullingseveral all-nighters in theprocess.
I was impressed and saidso.ButIhastenedtoaddthatgrit is more about staminathan intensity. “So, if you’reworking on that project withthe same energy in a year ortwo,emailme.Icansaymoreaboutyourgritthen.”
He was puzzled. “Well, Imight not beworking on the
![Page 292: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/292.jpg)
samethinginafewyears.”Good point. Lots of
ventures that seempromisingat the start turn out badly.Lots of optimistic businessplans end up in the discardbin.
“Okay, so maybe thisparticular start-up won’t bewhat you’reworkingon.Butif you’re not working in thesameindustry,ifyou’reontosome totally unrelated
![Page 293: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/293.jpg)
pursuit, then I’m not sureyourstoryillustratesgrit.”
“You mean, stay in onecompany?”heasked.
“Not necessarily. Butskipping around from onekind of pursuit to another—from one skill set to anentirely different one—that’snotwhatgrittypeopledo.”
“But what if I movearound a lot and, while I’mdoing that, I’m workingincrediblyhard?”
![Page 294: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/294.jpg)
“Grit isn’t just workingincredibly hard. That’s onlypartofit.”
Pause.“Why?”“Well,foronething, there
arenoshortcutstoexcellence.Developing real expertise,figuring out really hardproblems, it all takes time—longer than most peopleimagine. And then, youknow, you’ve got to applythose skills and produce
![Page 295: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/295.jpg)
goods or services that arevaluable to people. Romewasn’tbuiltinaday.”
He was listening, so Icontinued.
“And here’s the reallyimportant thing.Grit isaboutworking on something youcare about so much thatyou’rewillingtostayloyaltoit.”
“It’sdoingwhatyou love.Igetthat.”
![Page 296: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/296.jpg)
“Right, it’s doing whatyou love, but not just fallinginlove—stayinginlove.”
Howgrittyareyou?Belowisa version of the Grit Scale Ideveloped for my study atWestPoint andwhich Iusedin other studies described inthisbook.Readeachsentenceand, on the right, check offthe box that makes sense.Don’t overthink the
![Page 297: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/297.jpg)
questions. Instead, just askyourself howyou compare—not just to your coworkers,friends, or family—but to“mostpeople.”
Notatalllikeme
Notmuchlikeme
Somewhatlikeme
1.Newideasandprojects
5 4
![Page 298: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/298.jpg)
sometimesdistractmefrompreviousones.
2.Setbacksdon’tdiscourageme.Idon’tgiveupeasily.
1 2
3.Ioftensetagoal
5 4
![Page 299: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/299.jpg)
butlaterchoosetopursueadifferentone.
4.Iamahardworker.
1 2
5.Ihavedifficultymaintainingmyfocusonprojects
5 4
![Page 300: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/300.jpg)
thattakemorethanafewmonthstocomplete.
6.IfinishwhateverIbegin.
1 2
7.Myinterestschangefromyeartoyear.
5 4
![Page 301: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/301.jpg)
8.Iamdiligent.Inevergiveup.
1 2
9.Ihavebeenobsessedwithacertainideaorprojectforashorttime
5 4
![Page 302: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/302.jpg)
butlaterlostinterest.
10.Ihaveovercomesetbackstoconqueranimportantchallenge.
1 2
Tocalculateyourtotalgritscore, add up all the points
![Page 303: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/303.jpg)
for the boxes you checkedand divide by 10. Themaximumscoreon this scaleis 5 (extremely gritty), andthelowestpossiblescoreis1(notatallgritty).
You can use the chartbelowtoseehowyourscorescompare toa largesampleofAmericanadults.I
Percentile GritScore
10% 2.5
![Page 304: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/304.jpg)
20% 3.0
30% 3.3
40% 3.5
50% 3.8
60% 3.9
70% 4.1
80% 4.3
90% 4.5
![Page 305: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/305.jpg)
95% 4.7
99% 4.9
Keepinmindthatyourscoreisareflectionofhowyouseeyourself right now. Howgrittyyouare at thispoint inyour life might be differentfrom how gritty you werewhenyouwereyounger.Andif you take the Grit Scaleagain later, you might get a
![Page 306: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/306.jpg)
different score. As this bookwillcontinuetoshow,thereisevery reason to believe thatgritcanchange.
Grit has two components:passion and perseverance. Ifyou want to dig a littledeeper, you can calculateseparate scores for eachcomponent: For your passionscore, addupyourpoints forthe odd-numbered items anddivide by 5. For yourperseverance score, add up
![Page 307: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/307.jpg)
your points for the even-numbered items and divideby5.
If you scored high onpassion, you probably scoredhigh on perseverance, too.Andviceversa.Still,I’lltakea guess that yourperseverance score is a weebit higher than your passionscore. This isn’t true for allpeople, but it’s true formostpeople I’ve studied. Forinstance, I took the scale
![Page 308: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/308.jpg)
while writing this chapter,and I scored 4.6 overall.Myperseverance score was 5.0,and my passion score wasonly4.2.Strangeasitsounds,staying focusedonconsistentgoals over time ismore of astruggle forme thanworkinghardandbouncingbackfromsetbacks.
This consistent pattern—perseverance scores moreoften topping passion scores—is a clue that passion and
![Page 309: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/309.jpg)
perseverance aren’t exactlythesame thing. In the restofthis chapter, I’ll explain howthey differ and show how tounderstand themas twopartsofawhole.
While taking the Grit Scale,you might have noticed thatnoneofthepassionquestionsasked how intensely you’recommittedtoyourgoals.Thismay seem odd, because the
![Page 310: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/310.jpg)
wordpassion isoftenusedtodescribe intense emotions.Foralotofpeople,passionissynonymous with infatuationor obsession. But ininterviewsaboutwhatittakesto succeed, high achieversoften talk about commitmentof a different kind. Ratherthanintensity,whatcomesupagain and again in theirremarks is the idea ofconsistencyovertime.
![Page 311: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/311.jpg)
Forinstance,I’veheardofchefswho grew upwatchingJulia Child on television andremained fascinated withcooking into adulthood. I’veheard of investors whosecuriosity about the financialmarkets is as keen in theirfourth or fifth decade ofinvesting as it was on theirveryfirstdayof trading.I’veheardofmathematicianswhowork on a problem—thesameproblem—dayandnight
![Page 312: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/312.jpg)
for years, without oncedeciding, “Oh, to heck withthis theorem! I’mmoving onto something else.” Andthat’swhy the questions thatgenerate your passion scoreask you to reflect on howsteadily you hold to goalsovertime.Ispassiontherightword to describe sustained,enduring devotion? Somemight say I should find abetter word. Maybe so. Buttheimportantthingistheidea
![Page 313: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/313.jpg)
itself: Enthusiasm iscommon.Enduranceisrare.
Consider, for example,Jeffrey Gettleman. For abouta decade, Jeff has been theEast Africa bureau chief fortheNewYorkTimes.In2012,hewon thePulitzerPrize forInternational Reporting forhis coverage of conflict inEast Africa. He’s a bit of acelebrity in the world ofinternational journalism,widely admired for his
![Page 314: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/314.jpg)
couragetopursuestoriesthatput his life at risk and, also,for his willingness tounflinchingly report eventsthatareunthinkablyhorrific.
ImetJeffwhenwewereinour early twenties. At thetime, both of us werepursuing master’s degrees atOxford University. For me,this was before McKinsey,before teaching, and beforebecomingapsychologist.ForJeff, this was before he’d
![Page 315: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/315.jpg)
writtenhis first news story. Ithinkit’sfairtosaythat,backthen,neitherofusknewquitewhat we wanted to be whenwe grew up—and we wereboth trying desperately tofigureitout.
I caught up with Jeff onthephonerecently.HewasinNairobi, his home basebetweentripstootherpartsofAfrica. Every few minutes,we had to ask each other ifwecouldstillbeheard.After
![Page 316: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/316.jpg)
reminiscing about ourclassmates and trading newsabout our children, I askedJeff to reflect on the idea ofpassionandhowithadplayedoutinhislife.
“Foraverylongtime,I’vehad a very clear sense ofwhere I wanted to be,” Jefftoldme.“Andthatpassionisto live and work in EastAfrica.”
“Oh, I didn’t know—Iassumed your passion was
![Page 317: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/317.jpg)
journalism,notacertainareaof the world. If you couldonly be a journalist or onlylive in East Africa, whichwouldyouchoose?”
I expected Jeff to pickjournalism.Hedidn’t.
“Look, journalism is agreat fit for me. I’ve alwaysgravitated towards writing.I’ve always been okay beingin new situations. Even theconfrontational side ofjournalism—that speaks to
![Page 318: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/318.jpg)
my personality. I like tochallenge authority. But Ithink journalismhasbeen, inasense,ameanstoanend.”
Jeff’s passion emergedoveraperiodofyears.Anditwasn’t just a process ofpassive discovery—ofunearthingalittlegemhiddeninside his psyche—but ratherof active construction. Jeffdidn’t just go looking forhispassion—hehelpedcreateit.
![Page 319: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/319.jpg)
Moving to Ithaca, NewYork,fromEvanston,Illinois,Jeff, at eighteen years old,could not have predicted hisfuture career. At Cornell, heended up majoring inphilosophy, in part because“it was the easiest to fulfillthe requirements.” Then, thesummer after freshman year,he visited East Africa. Andthatwas thebeginningof thebeginning: “I don’t knowhow to explain it. This place
![Page 320: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/320.jpg)
just blew my mind. TherewasaspiritherethatIwantedtoconnectwith,andIwantedtomakeitapartofmylife.”
Assoonashegotback toCornell, Jeff started takingcourses in Swahili, and aftersophomore year, he took ayear off to backpack aroundtheworld.Duringthattrip,hereturned to East Africa,experiencing the samewonderhe’dfeltthefirsttimehevisited.
![Page 321: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/321.jpg)
Still, it wasn’t clear howhe’d make a life there. Howdidhehit on journalismas acareerpath?Aprofessorwhoadmired Jeff’s writingsuggested as much, and Jeffremembers thinking, “That isthe dumbest idea I hadheard...whowantstoworkfor a boring newspaper?” (Iremember thinking the samething once about becoming aprofessor:Whowants tobeaboring professor?)
![Page 322: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/322.jpg)
Eventually, Jeff didwork forthestudentpaper,theCornellDaily Sun—but as aphotographer,notawriter.
“When I got to Oxford, Iwas pretty lost academically.ItwasshockingtotheOxfordprofessors that Ididn’t reallyknow what I wanted to do.Theywerelike,‘Whyareyouhere?This is a seriousplace.Youshouldhaveafirmsenseofwhatyouwant tostudyoryoushouldn’tbehere.’ ”
![Page 323: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/323.jpg)
My guess at the timewasthat Jeff would pursuephotojournalism. Hereminded me of RobertKincaid, the worldly, wisephotographerplayedbyClintEastwood in The Bridges ofMadison County, which wasreleased around the time webecamefriends.Infact,Icanstill remember thephotographs Jeff showed metwenty years ago. I thoughtthey were from National
![Page 324: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/324.jpg)
Geographic,buthe’dactuallytakenthemhimself.
By his second year atOxford, he figured out thatjournalismwasanevenbetterfit: “Once I learned moreabout being a journalist andhowthatcouldgetmebacktoAfrica, andhow that actuallywould be fun, and I couldwrite more creatively than Ifirst imagined journalismwas, then I was like, ‘Screwit, this is what I’m going to
![Page 325: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/325.jpg)
do.’Isetoutaverydeliberatepath that was possible,because the journalismindustry was veryhierarchical, and it was clearhowtoget fromAtoB toCtoD,etcetera.”
Step A was writing forOxford’s student newspaper,Cherwell. Step B was asummer internship at a smallpaper in Wisconsin. Step Cwas theSt.PetersburgTimesinFloridaon theMetrobeat.
![Page 326: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/326.jpg)
Step D was the Los AngelesTimes. Step E was the NewYork Times as a nationalcorrespondent in Atlanta.Step F was being sentoverseastocoverwarstories,and in 2006—just over adecadesincehe’dsethimselfthe goal—he finally reachedstep G: becoming the NewYork Times’ East Africabureauchief.
“It was a really windingroadthattookmetoallkinds
![Page 327: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/327.jpg)
of places. And it wasdifficult, and discouraging,and demoralizing, and scary,and all the rest. Buteventually, I got here. I gotexactly where I wanted tobe.”
As for somany other gritparagons, the commonmetaphor of passion asfireworksdoesn’tmakesensewhen you think of whatpassion means to JeffGettleman.Fireworkseruptin
![Page 328: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/328.jpg)
a blaze of glory but quicklyfizzle, leaving just wisps ofsmokeandamemoryofwhatwas once spectacular. WhatJeff’s journey suggestsinstead is passion as acompass—that thing thattakesyousometimetobuild,tinker with, and finally getright, and that then guidesyouonyourlongandwindingroadtowhere,ultimately,youwanttobe.
![Page 329: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/329.jpg)
Seattle Seahawks coach PeteCarroll puts it thisway: “Doyouhavealifephilosophy?”
For some of us, thequestionmakesnosense.Wemight say:Well, I have a lotof things I’m pursuing. A lotof goals. A lot of projects.Whichdoyoumean?
But others have noproblem answering withconviction: This is what Iwant.
![Page 330: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/330.jpg)
Everything becomes a bitclearer when you understandthe level of the goal Pete isaskingabout.He’snotaskingabout what you want to getdone today, specifically, oreven this year. He’s askingwhatyou’re trying togetoutof life. In grit terms, he’saskingaboutyourpassion.
Pete’s philosophy is: Dothings better than they haveever been done before. Likewith Jeff, it took a while to
![Page 331: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/331.jpg)
figure out what, in thebroadersense,hewasaimingfor. The pivotal momentcame at a low point in hiscoaching career: just aftergettingfiredasheadcoachofthe New England Patriots.This was the first and onlyyear in his life when Petewasn’t playing or coachingfootball.Atthatjuncture,oneofhisgoodfriendsurgedhimto consider something moreabstract than which job to
![Page 332: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/332.jpg)
take next: “You’ve got tohaveaphilosophy.”
Pete realized he didn’thaveoneandneededto:“IfIwas ever going to get thechancetorunanorganizationagain, I would have to beprepared with a philosophythat would drive all myactions.” Pete did a lot ofthinking and reflecting: “Mylife in the next weeks andmonths was filled withwriting notes and filling
![Page 333: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/333.jpg)
binders.” At the same time,he was devouring the booksof John Wooden, thelegendary UCLA basketballcoach who won a record-setting ten nationalchampionships.
Likealotofcoaches,Petehad already read Wooden.Butthistime,hewasreadingWooden and understanding,at amuchdeeper level,whatthecoachingiconhadtosay.Andthemostimportantthing
![Page 334: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/334.jpg)
Woodensaidwasthat,thougha team has to do a millionthings well, figuring out theoverarching vision is ofutmostimportance.
Pete realized in thatmoment that particular goals—winningaparticulargame,or even a seasonalchampionship,orfiguringoutthis element of the offensivelineup, or the way to talk toplayers—neededcoordination,neededpurpose:
![Page 335: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/335.jpg)
“A clear, well-definedphilosophy gives you theguidelines and boundariesthat keep you on track,” hesaid.
Oneway to understandwhatPete is talking about is toenvisiongoalsinahierarchy.
![Page 336: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/336.jpg)
At the bottom of thishierarchy are our mostconcreteandspecificgoals—the tasks we have on ourshort-termto-dolist:Iwanttoget out the door today byeight a.m. I want to call mybusinesspartnerback. Iwant
![Page 337: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/337.jpg)
to finish writing the email Istartedyesterday.These low-level goals exist merely asmeans to ends. We want toaccomplish them onlybecause they get ussomething else we want. Incontrast, the higher the goalin this hierarchy, the moreabstract, general, andimportantitis.Thehigherthegoal, themore it’s an end initself,andthelessit’smerelyameanstoanend.
![Page 338: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/338.jpg)
In the diagram I’vesketched out here, there arejust three levels. That’s anoversimplification. Betweenthe lowest and the highestlevel might be several layersof mid-level goals. Forinstance,gettingout thedoorby eight a.m. is a low-levelgoal. It onlymatters becauseof a mid-level goal: arrivingatworkontime.Whydoyoucareabout that?Becauseyouwant tobepunctual.Whydo
![Page 339: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/339.jpg)
youcareabout that?Becausebeingpunctual shows respectforthepeoplewithwhomyouwork.Whyisthat important?Because you strive to be agoodleader.
If in the course of askingyourself these “Why?”questions your answer issimply “Just because!” thenyou know you’ve gotten tothe top of a goal hierarchy.The top-level goal is not ameanstoanyotherend.It is,
![Page 340: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/340.jpg)
instead,anendinitself.Somepsychologists like tocall thisan “ultimate concern.”Myself, I think of this top-level goal as a compass thatgives direction and meaningtoallthegoalsbelowit.
Consider Hall of FamepitcherTomSeaver.Whenheretired in 1987 at the age offorty-two,he’dcompiled311wins; 3,640 strikeouts; 61shutouts; and a 2.86 earnedrun average. In 1992, when
![Page 341: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/341.jpg)
SeaverwaselectedtotheHallof Fame, he received thehighest-ever percentage ofvotes: 98.8 percent. Duringhis twenty-year professionalbaseballcareer,Seaveraimedto pitch “the best I possiblycan day after day, year afteryear.” Here is how thatintention gave meaning andstructure to all his lower-ordergoals:
![Page 342: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/342.jpg)
Pitching...determineswhatIeat,whenIgotobed, what I do whenI’m awake. ItdetermineshowIspendmy life when I’m notpitching. If it means IhavetocometoFloridaand can’t get tannedbecause I might get aburn that would keepmefromthrowingforafew days, then I nevergo shirtless in the
![Page 343: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/343.jpg)
sun. . . . If it means Ihave to remind myselftopetdogswithmylefthand or throw logs onthe fire with my lefthand, then I do that,too. If it means in thewinter I eat cottagecheese instead ofchocolate chip cookiesin order to keep myweightdown,thenIeatcottagecheese.
![Page 344: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/344.jpg)
The life Seaver describedsounds grim. But that’s nothow Seaver saw things:“Pitching is what makes mehappy. I’ve devoted my lifeto it. . . . I’ve made up mymindwhat Iwant to do. I’mhappywhen Ipitchwell so Ionly do things that help mebehappy.”
WhatImeanbypassionisnot just that you havesomething you care about.What Imean is thatyoucare
![Page 345: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/345.jpg)
aboutthatsameultimategoalin an abiding, loyal, steadyway.You are not capricious.Each day, you wake upthinkingof thequestionsyoufell asleep thinking about.You are, in a sense, pointingin the same direction, evereager to take even thesmallest step forward than totakeasteptotheside,towardsomeotherdestination.Attheextreme, onemight call yourfocusobsessive.Mostofyour
![Page 346: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/346.jpg)
actions derive theirsignificance from theirallegiance to your ultimateconcern,yourlifephilosophy.
Youhaveyourprioritiesinorder.
Gritisaboutholdingthesametop-levelgoalforaverylongtime. Furthermore, this “lifephilosophy,” as Pete Carrollmight put it, is so interestingand important that it
![Page 347: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/347.jpg)
organizesagreatdealofyourwakingactivity.Inverygrittypeople, most mid-level andlow-level goals are, in somewayoranother,relatedtothatultimate goal. In contrast, alack of grit can come fromhaving less coherent goalstructures.
Hereareafewwaysalackof grit can show itself. I’vemetmanyyoungpeoplewhocan articulate a dream—forexample, tobeadoctoror to
![Page 348: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/348.jpg)
playbasketballintheNBA—andcanvividly imaginehowwonderful thatwouldbe, butthey can’t point to the mid-level and lower-level goalsthatwillgetthemthere.Theirgoalhierarchyhasatop-levelgoal but no supporting mid-levelorlow-levelgoals:
![Page 349: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/349.jpg)
This is what my goodfriend and fellowpsychologist GabrieleOettingen calls “positivefantasizing.” Gabriele’sresearch suggests thatindulging in visions of apositive future withoutfiguringouthowtogetthere,chiefly by considering whatobstacles stand in the way,has short-term payoffs butlong-termcosts. In the short-term, you feel pretty great
![Page 350: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/350.jpg)
about your aspiration to be adoctor. In the long-term, youlive with the disappointmentof not having achieved yourgoal.
Even more common, Ithink, is having a bunch ofmid-level goals that don’tcorrespond to any unifying,top-levelgoal:
![Page 351: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/351.jpg)
Or having a fewcompeting goal hierarchiesthat aren’t in any wayconnectedwitheachother:
To some extent, goalconflictisanecessaryfeatureof human existence. Forinstance, I have one goalhierarchy as a professionaland another as a mother.
![Page 352: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/352.jpg)
EvenTomSeaveradmitsthatthe travel and practiceschedule of a professionalbaseball player made it hardto spend as much time withhis wife and children as hewouldhaveliked.So, thoughpitchingwas his professionalpassion,therewereothergoalhierarchies that obviouslymatteredtohim.
Like Seaver, I have onegoal hierarchy forwork:Usepsychological science tohelp
![Page 353: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/353.jpg)
kids thrive. But I have aseparate goal hierarchy thatinvolves being the bestmother I can be to my twodaughters. As any workingparent knows, having two“ultimate concerns” isn’teasy.Thereseemsnevertobeenough time, energy, orattention to go around. I’vedecided to live with thattension.Asayoungwoman,Iconsidered alternatives—nothaving my career or not
![Page 354: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/354.jpg)
raisingafamily—anddecidedthat, morally, there was no“right decision,” only adecision that was right forme.
So, the idea that everywaking moment in our livesshouldbeguidedbyonetop-level goal is an idealizedextreme that may not bedesirableevenforthegrittiestofus.Still,Iwouldarguethatit’s possible to pare downlong lists of mid-level and
![Page 355: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/355.jpg)
low-level work goalsaccordingtohowtheyserveagoal of supreme importance.And I think one top-levelprofessional goal, rather thananyothernumber,isideal.
In sum, the more unified,aligned, and coordinated ourgoalhierarchies,thebetter.
Warren Buffett—the self-made multibillionaire whosepersonal wealth, acquired
![Page 356: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/356.jpg)
entirely within his ownlifetime, is roughly twice thesize of Harvard University’sendowment—reportedly gavehis pilot a simple three-stepprocessforprioritizing.
The story goes like this:Buffett turns to his faithfulpilot and says that he musthave dreams greater thanflying Buffett around towhere he needs to go. Thepilot confesses that, yes, he
![Page 357: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/357.jpg)
does. And then Buffett takeshimthroughthreesteps.
First,youwritedownalistoftwenty-fivecareergoals.
Second,youdosomesoul-searching and circle the fivehighest-priority goals. Justfive.
Third, you take a goodhard lookat the twentygoalsyou didn’t circle. These youavoid at all costs. They’rewhat distract you; they eatawaytimeandenergy,taking
![Page 358: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/358.jpg)
your eye from the goals thatmattermore.
When I first heard thisstory, I thought, Who couldhave as many as twenty-fivedifferentcareergoals?That’skind of ridiculous, isn’t it?Then I started writing downon a piece of lined paper allof the projects I’m currentlyworking on. When I got tolinethirty-two,IrealizedthatI could benefit from thisexercise.
![Page 359: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/359.jpg)
Interestingly, most of thegoalsIspontaneouslythoughtof were mid-level goals.People generally default tothat level of goal whenthey’reaskedtowritedownanumberofgoals,notjustone.
To help me prioritize, Iadded columns that allowedmetosortouthowinterestingand important these projectswere. I rated each goal on ascalefrom1to10,fromleastto most interesting and then
![Page 360: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/360.jpg)
again from least to mostimportant. I multiplied thesenumbers together to get anumber from1 to 100.Noneofmygoalshadan“interestximportance”ratingashighas
![Page 361: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/361.jpg)
100,butnonewereaslowas1,either.
Then I tried to takeBuffett’s advice and circlejust a few of the mostinteresting and importantgoals, relegating the rest totheavoid-at-all-costcategory.
I tried, but I just couldn’tdoit.
After a day or so ofwondering who was right—me or Warren Buffett—Irealizedthatalotofmygoals
![Page 362: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/362.jpg)
were, in fact, related to oneanother.Themajority,infact,were means to ends, settingme up to make progresstoward one ultimate goal:helping kids achieve andthrive.Therewereonlyafewprofessional goals for whichthis wasn’t true. Reluctantly,I decided to put thoseon theavoid-at-all-costlist.
Now, if I could ever sitdown with Buffett and gothrough my list with him
![Page 363: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/363.jpg)
(which is unlikely, since Idoubt my needs rate a placein his goal hierarchy), hewould surely tellme that thepoint of this exercise is toface the fact that time andenergy are limited. Anysuccessful person has todecidewhat to do in part bydecidingwhatnottodo.Igetthat. And I still have awaystogoonthatcount.
But I would also say thatconventionalprioritizingisn’t
![Page 364: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/364.jpg)
enough. When you have todivide your actions among anumber of very differenthigh-level career goals,you’re extremely conflicted.You need one internalcompass—not two, three,four,orfive.
![Page 365: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/365.jpg)
FrankModell,theNewYorker,July7,1962,TheNewYorkerCollection/TheCartoonBank.
![Page 366: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/366.jpg)
So, to Buffett’s three-stepexercise in prioritizing, Iwouldaddanadditionalstep:Askyourself,Towhat extentdo these goals serve acommon purpose? The morethey’repart of the samegoalhierarchy—importantbecausethey then serve the sameultimate concern—the morefocusedyourpassion.
If you follow thismethodof prioritization, will youbecome a Hall of Fame
![Page 367: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/367.jpg)
pitcher or earn more moneythan anyone else in history?Probablynot.Butyou’llstanda better chance of gettingsomewhere you care about—a better chance of movingcloser to where youwant tobe.
When you see your goalsorganized inahierarchy,yourealize that grit is not at allabout stubbornly pursuing—
![Page 368: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/368.jpg)
at all costs and ad infinitum—every single low-levelgoalon your list. In fact, you canexpect to abandon a few ofthe things you’re workingveryhardonat thismoment.Notallofthemwillworkout.Sure, you should try hard—even a little longer than youmight think necessary. Butdon’t beat your head againstthewall attempting to followthroughonsomething that is,
![Page 369: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/369.jpg)
merely, a means to a moreimportantend.
I thought about howimportant it is to know howlow-level goals fit into one’soverall hierarchy when Ilistened to Roz Chast, thecelebrated New Yorkercartoonist, give a talk at thelocal library. She told us herrejection rate is, at this stagein her career, about 90percent. She claimed that it
![Page 370: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/370.jpg)
used to be much, muchhigher.
I calledBobMankoff, thecartoon editor for the NewYorker, to ask how typicalthat number is. To me, itseemedshockinglyhigh.Bobtoldme thatRozwas indeedananomaly.Phew!Ithought.I didn’t want to think aboutall the cartoonists in theworld getting rejected ninetimesoutoften.ButthenBobtoldme thatmost cartoonists
![Page 371: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/371.jpg)
livewithevenmorerejection.At his magazine, “contractcartoonists,” who havedramatically better odds ofgettingpublishedthananyoneelse, collectively submitabout five hundred cartoonseveryweek. Inagiven issue,there is only room, onaverage, for about seventeenofthem.Ididthemath:that’sa rejection rate ofmore than96percent.
![Page 372: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/372.jpg)
“Holy smokes! Whowould keep going when theoddsarethatgrim?”
Well, for one: Bobhimself.
Bob’s story reveals a lotabout how doggedperseverance toward a top-level goal requires,paradoxically perhaps, someflexibility at lower levels inthe goal hierarchy. It’s as ifthe highest-level goal getswritten in ink, once you’ve
![Page 373: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/373.jpg)
done enough living andreflecting to know what thatgoal is, and the lower-levelgoalsgetwritteninpencil,soyou can revise them andsometimes erase themaltogether,andthenfigureoutnewonestotaketheirplace.
Here’s my not-at-all-NewYorker–quality drawing toshowwhatImean:
![Page 374: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/374.jpg)
The low-level goal withthe angry-looking X throughit has been blocked. It’s arejection slip, a setback, adeadend,afailure.Thegrittyperson will be disappointed,
![Page 375: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/375.jpg)
or even heartbroken, but notforlong.
Soon enough, the grittyperson identifies a new low-level goal—draws anothercartoon, for example—thatservesthesamepurpose.
![Page 376: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/376.jpg)
One of the mottos of theGreen Berets is: “Improvise,adapt,overcome.”Alotofuswere told as children, “If atfirst you don’t succeed, try,tryagain.”Soundadvice,butas they say “try, try again,thentrysomethingdifferent.”At lower levels of a goalhierarchy, that’s exactlywhat’sneeded.
Here’s Bob Mankoff’sstory:
![Page 377: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/377.jpg)
Like Jeff Gettleman, theNew York Times East Africabureau chief, Bob didn’talwayshaveaclearlydefinedpassion.Asachild,Boblikedto draw, and instead ofattending his local highschool in theBronx,hewenttotheLaGuardiaHighSchoolof Music and Art, laterfictionalized in the movieFame.Oncethere,though,hegot a lookat the competitionandwasintimidated.
![Page 378: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/378.jpg)
“Being exposed to realdrawing talent,” Bob recalls,“made mine wither. I didn’ttouch a pen, pencil, orpaintbrush for three yearsafter graduating.” Instead, heenrolled at SyracuseUniversity, where he studiedphilosophyandpsychology.
In his senior year, hebought a book calledLearning to Cartoon by thelegendary Syd Hoff, anexemplarofthe“effortcounts
![Page 379: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/379.jpg)
twice” maxim. Over hislifetime,Hoffcontributed571cartoons to the New Yorker,wrote and illustrated morethan sixty children’s books,drew two syndicated comicstrips, and contributedliterally thousands ofdrawings and cartoons toother publications. Hoff’sbook opens cheerilywith “Isit hard becoming acartoonist? No, it isn’t. Andto prove it, I’ve written this
![Page 380: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/380.jpg)
book. . . .” It ends with achapter called “How toSurvive Rejection Slips.” Inbetween are lessons oncomposition, perspective, thehuman figure, facialexpressions,andsoon.
BobusedHoff’sadvice tocreate twenty-sevencartoons.He walked from onemagazinetoanother,tryingtomakeasale—butnottheNewYorker, which didn’t seecartoonists inperson.Andhe
![Page 381: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/381.jpg)
was, of course, summarilyrejected by every editor hesaw. Most asked him to tryagain, with more cartoons,the nextweek. “More?”Bobwondered. “How couldanyonedomorethantwenty-sevencartoons?”
Before he could rereadHoff’s last chapter onrejection slips, Bob receivednotice that hewas eligible tobe drafted for combat inVietnam. He had no great
![Page 382: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/382.jpg)
desiretogo;infact,hehadagreat desire not to. So herepurposed himself—quickly—as a graduate student inexperimental psychology.Over the next few years,while running rats in mazes,he found time, when hecould, to draw. Then, justbefore earning his doctorate,he had the realization thatresearch psychology wasn’this calling: “I rememberthinking that my defining
![Page 383: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/383.jpg)
personality characteristicwassomething else. I’m thefunniest guy you evermet—that’s the way I thought ofmyself—I’mfunny.”
For a while, Bobconsidered two ways ofmaking humor his career: “Isaid, okay, I’m going to dostand-up,orI’mgoingtobeacartoonist.”Hethrewhimselfintobothwithgusto:“AlldayI would write routines andthen, at night, I would draw
![Page 384: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/384.jpg)
cartoons.”Butovertime,oneof these two mid-level goalsbecame more attractive thanthe other: “Stand-up wasdifferent back then. Thereweren’t really comedy clubs.I’dhave togo to theBorschtBelt, and Ididn’t reallywantto....Iknewmyhumorwasnot going to work like Iwantedittoforthesepeople.”
So Bob dropped stand-upcomedy and devoted hisentire energy to cartoons.
![Page 385: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/385.jpg)
“After two years ofsubmitting, all I had to showfor it were enough NewYorker rejection slips towallpaper my bathroom.”Therewere small victories—cartoons sold to othermagazines—but by that timeBob’s top-level goal hadbecome a whole lot morespecific and ambitious: Hedidn’t just want to be funnyfor a living, hewanted to beamong thebestcartoonists in
![Page 386: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/386.jpg)
the world. “The New Yorkerwas to cartooning what theNew York Yankees were tobaseball—the Best Team,”Bob explains. “If you couldmakethatteam,youtoowereoneofthebest.”
ThepilesofrejectionslipssuggestedtoBobthat“try,tryagain” was not working. Hedecided to do somethingdifferent. “Iwent to theNewYork Public Library and Ilooked up all the cartoons
![Page 387: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/387.jpg)
back to 1925 that had everbeen printed in the NewYorker.” At first, he thoughtmaybe he didn’t draw wellenough, but it was plain toseethatsomeverysuccessfulNew Yorker cartoonists werethird-rate draftsmen. ThenBob thought that somethingmightbeawrywiththelengthof his captions—too short ortoo long—but thatpossibilitywasn’t supported, either.Captions were generally
![Page 388: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/388.jpg)
brief, but not always, andanyway, Bob’s didn’t seemunusual in that respect. ThenBob thought maybe he wasmissing the mark with histype of humor. No again:some successful cartoonswere whimsical, somesatirical, some philosophical,andsomejustinteresting.
The one thing all thecartoonshad incommonwasthis: they made the readerthink.
![Page 389: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/389.jpg)
And here was anothercommon thread: everycartoonist had a personalstyle that was distinctivelytheir own. There was nosingle “best” style. On thecontrary, what mattered wasthat style was, in some verydeep and idiosyncratic way,an expression of theindividualcartoonist.
Paging through, literally,everycartoontheNewYorkerhad ever published, Bob
![Page 390: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/390.jpg)
knewhecoulddoaswell.Orbetter. “I thought, ‘I can dothis, I can do this.’ I hadcomplete confidence.” Heknewhecoulddrawcartoonsthat would make peoplethink, and he knew he coulddevelop his own style: “Iworked through variousstyles. Eventually I did mydot style.” The now-famousdotstyleofBob’scartoonsiscalledstippling,andBobhadoriginally tried it outback in
![Page 391: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/391.jpg)
high school, when hediscovered the FrenchimpressionistGeorgesSeurat.
Aftergettingrejectedfromthe New Yorker about twothousandtimesbetween1974and 1977, Bob sent in thecartoon, below. It wasaccepted.
![Page 392: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/392.jpg)
RobertMankoff,theNewYorker,June20,1977,TheNewYorkerCollection/TheCartoonBank.
![Page 393: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/393.jpg)
The next year, he soldthirteen cartoons to the NewYorker, then twenty-five thefollowing year, then twenty-seven. In1981,Bobreceiveda letter from the magazineasking if he’d considerbecoming a contractcartoonist.Hesaidyes.
In his role as editor andmentor,Bob advises aspiringcartoonists to submit their
![Page 394: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/394.jpg)
drawings in batches of ten,“because in cartooning, as inlife, nine out of ten thingsneverworkout.”
Indeed, giving up onlower-level goals is not onlyforgivable, it’s sometimesabsolutely necessary. Youshould give up when onelower-level goal can beswapped for another that ismore feasible. It also makessense to switch your pathwhen a different lower-level
![Page 395: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/395.jpg)
goal—a different means tothe same end—is just moreefficient, ormore fun, or forwhatever reasonmakesmoresensethanyouroriginalplan.
On any long journey,detoursaretobeexpected.
However, the higher-levelthe goal, the more it makessense to be stubborn.Personally,Itrynottogettoohung up on a particularrejected grant application,academic paper, or failed
![Page 396: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/396.jpg)
experiment.Thepainofthosefailures is real, but I don’tdwellonthemforlongbeforemoving on. In contrast, Idon’t give up as easily onmid-level goals, and frankly,I can’t imagine anything thatwould change my ultimateaim, my life philosophy, asPetemightsay.Mycompass,onceIfoundallthepartsandputittogether,keepspointingme in the same direction,weekaftermonthafteryear.
![Page 397: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/397.jpg)
Long before I conducted thefirstinterviewsthatputmeonthe trail of grit, a Stanfordpsychologist namedCatharine Cox was, herself,cataloging the characteristicsofhighachievers.
In 1926, Cox publishedher findings, based on thebiographical details of 301exceptionally accomplishedhistorical figures. Theseeminent individuals included
![Page 398: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/398.jpg)
poets, political and religiousleaders, scientists, soldiers,philosophers, artists, andmusicians.All livedanddiedin the four centuries prior toCox’s investigation, and allleft behind records ofaccomplishment worthy ofdocumentation in six popularencyclopedias.
Cox’s initial goal was toestimate how smart each ofthese individuals were, bothrelative to one another and
![Page 399: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/399.jpg)
also compared to the rest ofhumanity. In pursuit of thoseestimates, she combedthrough the availableevidence, searching for signsofintellectualprecocity—andfrom the age and superiorityoftheseaccomplishmentsshereckoned each person’schildhood IQ. The publishedsummary of this study—ifyou can call a book ofmorethan eight hundred pages asummary—includes a case
![Page 400: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/400.jpg)
historyforeachofCox’s301,arranged in order from leasttomostintelligent.
According to Cox, thevery smartest in the bunchwas the philosopher JohnStuart Mill, who earned anestimatedchildhood IQscoreof 190 by learning Greek atagethree,writingahistoryofRomeatagesix,andassistinghis father in correcting theproofsofahistoryofIndiaatage twelve. The least
![Page 401: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/401.jpg)
intelligentinCox’sranking—whose estimated childhoodIQs of 100 to 110 are just ahair above average forhumanity—included thefounder of modernastronomy, NicolausCopernicus; the chemist andphysicist Michael Faraday;and the Spanish poet andnovelistMigueldeCervantes.Isaac Newton ranks squarelyin themiddle, with an IQ of130—the bareminimum that
![Page 402: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/402.jpg)
a child needs in order toqualify for many of today’sgiftedandtalentedprograms.
From these IQ estimates,Cox concluded that, as agroup, accomplishedhistorical figures are smarterthanmost of us. No surprisethere.
A more unexpectedobservationwashowlittleIQmatteredindistinguishingthemost from the leastaccomplished. The average
![Page 403: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/403.jpg)
childhood IQ of the mosteminentgeniuses,whomCoxdubbed the First Ten, was146. The average IQ of theleast eminent, dubbed theLast Ten, was 143. Thespread was trivial. In otherwords, the relationshipbetween intelligence andeminence in Cox’s samplewasexceedinglyslight.
Cox’sFirstTen(MostEminentGeniuses)
![Page 404: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/404.jpg)
SirFrancisBaconNapoleonBonaparteEdmundBurkeJohannWolfgangvonGoethe
MartinLutherJohnMiltonIsaacNewtonWilliamPittVoltaireGeorgeWashington
Cox’sLastTen(LeastEminentGeniuses)
ChristianK.J.vonBunsen
![Page 405: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/405.jpg)
ThomasChalmersThomasChattertonRichardCobdenSamuelTaylorColeridgeGeorgesJ.DantonJosephHaydnHugues-Félicité-RobertdeLamennais
GiuseppeMazziniJoachimMurat
Ifintellectualtalentwasn’tthe determinant ofwhether aperson ascended to the FirstTen or was relegated to the
![Page 406: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/406.jpg)
Last Ten, then what was?While poring over thousandsofpagesofbiographicaldata,Cox and her assistant alsoevaluated sixty-sevendifferentpersonality traits fora subset of one hundredgeniuses. Cox deliberatelychosea rainbowof traits—infact, she covered the fullrange of what modernpsychologists consider to beimportant—to allow for thefullestpossibleexplorationof
![Page 407: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/407.jpg)
the differences that set apartthe eminent from the rest ofhumanity and, further, theFirstTenfromtheLastTen.
For most of the sixty-seven indicators, Cox foundonly trivial differencesbetween the eminent and thegeneral population. Forinstance, eminence had littleto do with extroversion,cheerfulness, or sense ofhumor. And not all the highachievers had earned high
![Page 408: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/408.jpg)
marksinschool.Rather,whatdefinitively set apart theeminent from the rest ofhumanity were a cluster offour indicators. Notably,these also distinguished theFirstTenfromtheLastTen—the super-eminent from themerelyeminent.Coxgroupedthese together and calledthem“persistenceofmotive.”
Two indicators couldeasilyberephrasedaspassionitemsfortheGritScale.
![Page 409: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/409.jpg)
Degree to which heworks with distantobjects in view (asopposed to living fromhand to mouth). Activepreparation for laterlife. Working toward adefinitegoal.
Tendency not toabandon tasks frommerechangeability.Notseekingsomethingfresh
![Page 410: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/410.jpg)
becauseofnovelty.Not“lookingforachange.”
And the other two couldeasily be rewritten asperseverance items for theGritScale.
Degree of strength ofwill or perseverance.Quiet determination tostick to a course oncedecidedupon.
![Page 411: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/411.jpg)
Tendency not toabandon tasks in theface of obstacles.Perseverance, tenacity,doggedness.
In her summarycomments, Cox concludedthat“highbutnot thehighestintelligence, combined withthe greatest degree ofpersistence, will achievegreater eminence than thehighestdegreeof intelligence
![Page 412: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/412.jpg)
with somewhat lesspersistence.”
However you scored on theGritScale,Ihopeitpromptedself-reflection. It’s progressjustclarifyingyourgoals,andtheextenttowhichtheyare—or aren’t—aligned toward asingle passion of supremeimportance.It’salsoprogresstobetterunderstandhowwellyou’re currently able to
![Page 413: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/413.jpg)
persevereinthefaceof life’srejectionslips.
It’sastart.Let’scontinue,in the next chapter, to seehow grit can and doeschange.And,then,intherestofthebook,let’slearnhowtoacceleratethatgrowth.
I. If, for example, you scored 4.1,you’re grittier than about 70percentoftheadultsinoursample.
![Page 414: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/414.jpg)
Chapter5
GRITGROWS
“Howmuch of our grit is inourgenes?”
I’maskedsomeversionofthis question pretty much
![Page 415: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/415.jpg)
anytime Igivea talkongrit.Thenature-nurturequestionisaverybasicone.Wehaveanintuitive sense that somethings about us—like ourheight—are pretty muchdetermined in the geneticlottery, while other things—like whether we speakEnglish or French—are aresult of our upbringing andexperience. “You can’t trainheight” is a popularexpression in basketball
![Page 416: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/416.jpg)
coaching, and many peoplewho learn about grit want toknow if it’smore like heightormorelikelanguage.
Tothequestionofwhetherwe get grit from our DNA,there is a short answer and alongone.Theshortansweris“inpart.”Thelongansweris,well, more complicated. Inmyview,thelongeranswerisworth our attention. Sciencehas made huge strides infiguring out how genes,
![Page 417: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/417.jpg)
experience, and theirinterplay make us who weare.FromwhatIcantell, theinherent complexity of thesescientific facts has led,unfortunately, to theircontinually beingmisunderstood.
To begin, I can tell youwithcompleteconvictionthatevery human trait isinfluencedbybothgenesandexperience.
![Page 418: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/418.jpg)
Consider height.Height isindeed heritable: geneticdifferences are a big reasonwhy some people are reallytall, some really short, and abunch of people are ofvaryingheightsinbetween.
But it’s also true that theaverage height of men andwomen has increaseddramatically in just a fewgenerations. For instance,militaryrecordsshowthattheaverageBritishmanwasfive
![Page 419: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/419.jpg)
feetfiveinchestallabout150years ago, but today thataverage is five feet teninches. Height gains havebeen even more dramatic inother countries; in theNetherlands,theaveragemannow stands almost six footone—againofmore thansixinchesoverthelast150years.I am reminded of thesedramaticgenerationalgainsinheight whenever I gettogether with my Dutch
![Page 420: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/420.jpg)
collaborators. They benddown solicitously, but it stillfeels like standing ina forestofredwoods.
It’s unlikely that the genepool has changed all thatdramatically in just a fewgenerations.Instead,themostpowerfulheightboostershavebeen nutrition, clean air andwater, andmodernmedicine.(Incidentally, generationalgains in weight have beeneven more dramatic, and
![Page 421: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/421.jpg)
again, that seems to be theconsequence of eating moreand moving around lessrather than changes in ourDNA.) Even within ageneration, you can see theinfluence of environment onheight. Children who areprovided healthy food inabundance will grow uptaller, whereasmalnourishment stuntsgrowth.
![Page 422: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/422.jpg)
Likewise, traits likehonesty and generosity and,yes, grit, are geneticallyinfluenced and, in addition,influenced by experience.Ditto for IQ, extroversion,enjoying the great outdoors,having a sweet tooth, thelikelihoodthatyou’llendupachain-smoker, your risk ofgettingskincancer,andreallyany other trait you can thinkof. Nature matters, and sodoesnurture.
![Page 423: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/423.jpg)
Talents, in all their varieties,are also geneticallyinfluenced. Some of us arebornwith genes thatmake iteasiertolearntocarryatune,ordunkabasketball,orsolvea quadratic equation. Butagainst intuition, talents arenot entirely genetic: the rateatwhichwedevelopanyskillis also, crucially, a functionofexperience.
![Page 424: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/424.jpg)
For instance, sociologistDan Chambliss swamcompetitively in high schoolbut stopped when it seemedclearhewasn’tgoingtomakeit as a nationally rankedswimmer.
“I’msmall,”heexplained,“andmyankleswon’tplantarflex.” Come again? “I can’tpointmytoes.Icanonlyflexthem. It’s an anatomicallimitation. Which means,basically, at the elite level, I
![Page 425: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/425.jpg)
could only swimbreaststroke.” After ourexchange, I did a littleresearch on plantar flexion.Stretching exercises canimprove your range ofmotion, but the length ofcertain bones does make adifference in how flexibleyourfeetandanklesare.
Still, the biggestimpediment to improvingwasn’t anatomy; it was howhe was coached: “In
![Page 426: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/426.jpg)
retrospect, I look back nowandcanseeIhadhorriblybadcoachesinacoupleofcrucialplaces. One of my highschool coaches—I had himfor four years—literallytaught me zero. Nothing. Hetaught me how to do abreaststroke turn, and hetaughtmeincorrectly.”
WhathappenedwhenDandid, finally, experience goodcoaching, in part fromhanging around the national
![Page 427: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/427.jpg)
andOlympiccoacheshewasstudying?
“Years later, I got backinto the pool, got in shapeagain, and swam a two-hundred-yard individualmedleyasfastasIdidinhighschool.”
Again, same story. Notjust nature, and not justnurture.Both.
![Page 428: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/428.jpg)
Howdoscientistsknow,withunwavering conviction, thatbothnatureandnurtureplayarole in determining thingslike talent andgrit?Over thepast fewdecades, researchershave been studying identicaland fraternal twins, raised inthe same family or raised indifferent families. IdenticaltwinshaveallthesameDNA,while fraternal twins, onaverage, only share abouthalf. That fact, and a whole
![Page 429: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/429.jpg)
lot of fancy statistics (well,not that fancy—moremundane,really,onceagoodteacherexplainsthemtoyou),allows researchers to infer,from how similar the twinsgrowuptobe,theheritabilityofatrait.
Very recently, researchersin London let me knowthey’d administered the GritScale to more than twothousand pairs of teenagetwins living in the United
![Page 430: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/430.jpg)
Kingdom. This studyestimated the heritability ofthe perseverance subscale tobe37percentandthepassionsubscale to be 20 percent.Theseestimatesareonparforheritabilityestimatesforotherpersonality traits, and in thesimplest terms, this meansthat some of the variation ingrit in the population can beattributed to genetic factors,and the restcanbeattributedtoexperience.
![Page 431: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/431.jpg)
I hasten to add that thereisn’t just one gene thatexplains the heritability ofgrit. On the contrary, dozensof research studies haveshown that almost all humantraits are polygenic,meaningthat traits are influenced bymore than one gene. Manymore, in fact. Height, forexample, is influenced by, atlast count, at least 697differentgenes.Andsomeofthe genes that influence
![Page 432: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/432.jpg)
height influence other traitsas well. In total, the humangenome contains as many astwenty-five thousanddifferentgenes,andtheytendto interact with one anotherand with environmentalinfluences in complicated,stillpoorlyunderstood,ways.
In sum, what have welearned?First:grit,talent,andall other psychological traitsrelevant tosuccess in lifeareinfluenced by genes and also
![Page 433: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/433.jpg)
by experience. Second:there’snosinglegeneforgrit,or indeed any otherpsychologicaltrait.
I’d like to make a third,important point: heritabilityestimatesexplainwhypeoplediffer from the average, butthey say nothing about theaverageitself.
While the heritability ofheight says something about
![Page 434: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/434.jpg)
variability—why in a givenpopulation some people aretaller and some shorter—itsays nothing about howaverage height has changed.This is important because itprovides evidence that theenvironment we grow up inreally does matter, and itmattersalot.
Here’s another strikingexample, and one morerelevant to the science ofsuccess: the Flynn effect.
![Page 435: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/435.jpg)
Named after Jim Flynn, theNew Zealand social scientistwho discovered it, the Flynneffectreferstostartlinggainsin IQ scores over the pastcentury. How big are thegains? On the most widelyused IQ tests today—theWechsler Intelligence Scalefor Children and theWechsler Adult IntelligenceScale—gains have averagedmorethanfifteenpointsinthelast fifty years in the more
![Page 436: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/436.jpg)
thanthirtycountriesthathavebeen studied. Put anotherway, if you scored people acentury ago against modernnorms, they would have anaverage IQ score of 70—borderline for mentallyretarded.Ifyouscoredpeopletoday against the norms of acentury ago, we would haveanaverageIQscoreof130—the typical cut score formentallygiftedprograms.
![Page 437: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/437.jpg)
WhenI first learnedaboutthe Flynn effect, I didn’tbelieve it. How could it bethat we’re all getting thatmuchsmartersoquickly?
I called Jim to share myincredulity—andmydesiretolearn more—and, globe-trotter that he is, he actuallyflew all the way toPhiladelphiatomeetwithmeand give a talk on his work.At our first encounter, Iremember thinking that Jim
![Page 438: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/438.jpg)
lookedlikeacaricatureofanacademic: tall, a little bony,wire-rimmed glasses, and arather unruly head of curlysteel-grayhair.
Flynn began his talk withthebasic factson IQchange.Digging through the rawscores of IQ tests taken overthe years, he found that theimprovements on some testswere much bigger thanothers. He went to thechalkboard and sketched out
![Page 439: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/439.jpg)
a steep line indicating thatscores had climbed mostsharplyfor IQ testsassessingabstract reasoning. Forinstance, many youngchildrentodaycananswerthequestion “Dogs and rabbits:How are they alike?” Theymight tellyou thatbothdogsand rabbits are alive, or thatthey’re both animals. In thescoring manual, theseanswers only earn a halfcredit. Some children might
![Page 440: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/440.jpg)
gosofarastosaythatthey’reboth mammals, and for thatinsight, they’d earn a fullcredit. In contrast, youngchildren a century agomightlook at you quizzically andsay, “Dogs chase rabbits.”Zeropoints.
Asaspecies,we’regettingbetter and better at abstractreasoning.
By way of explainingmassive gains in certain IQsubtests but not in others,
![Page 441: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/441.jpg)
Flynn told a story aboutbasketball and television.Basketball, at all levels ofcompetition, has gottenmorecompetitive over the lastcentury. Flynn played a littleball himself as a student andremembers the gamechanging even within a fewyears.Whathappened?
According to Flynn, whathappened was television.Basketball was a great gametowatch on the small screen
![Page 442: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/442.jpg)
and the exposure fueled thegame’s popularity. Oncetelevision became ahousehold fixture, more kidsstarted playing the game,trying left-handed layups,crossover dribbles, gracefulhook shots, and other skillsthat seemed routine amongstar players. And by gettingbetter, each kid inadvertentlyenriched the learningenvironment for the kids heor she was playing against.
![Page 443: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/443.jpg)
Becauseonethingthatmakesyou better at basketball isplayingwithkidswhoarejustalittlemoreskilled.
Flynn called this virtuouscycle of skill improvementthe social multiplier effect,andheusedthesamelogictoexplain generational changesin abstract reasoning. Moreand more, over the pastcentury, our jobs and dailylives ask us to thinkanalytically, logically.Wego
![Page 444: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/444.jpg)
to school for longer, and inschool, we’re asked, moreand more, to reason ratherthan rely on rotememorization.
Eithersmallenvironmentaldifferences, or genetic ones,can trigger a virtuous cycle.Either way, the effects aremultiplied socially, throughculture, because each of usenriches the environment ofallofus.
![Page 445: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/445.jpg)
HereisagraphshowinghowGritScalescoresvarybyage.These are data from a largesample of American adults,and you can see from thehorizontal axis that thegrittiest adults in my samplewere in their late sixties orolder; the leastgrittywere intheirtwenties.
![Page 446: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/446.jpg)
One explanation for thisdata is that there’s a sort of“reverse Flynn effect” forgrit. For instance, it’spossible that adults in their
![Page 447: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/447.jpg)
seventh decade of life aregrittierbecause theygrewupin a very different culturalera, perhaps one whosevaluesandnormsemphasizedsustained passion andperseverance more than hasbeen the case recently. Inother words, it could be thatthe Greatest Generation isgrittier than the millennialsbecause cultural forces aredifferent today thanyesterday.
![Page 448: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/448.jpg)
This explanation for whygrit andagegohand inhandwas suggested to me by anolder colleaguewho, lookingovermyshoulderatthesamegraph, shook his head andsaid, “I knew it! I’ve beenteaching the sameundergraduates the samecourseat the sameuniversityfordecades.AndI’lltellyou,they just don’t work as hardthese days as they used to!”My dad,who gave his entire
![Page 449: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/449.jpg)
professional lifeasachemistto DuPont and quite literallyretired with the gold watch,might say the same of theWharton entrepreneur whoapproached me after mylecture. Even while pullingall-nighters for his presentventure, the young man halfexpected to be on tosomething entirely newwithinafewyears.
![Page 450: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/450.jpg)
Alternatively, it’s possibletheseagetrendshavenothingto do with generationalchangesingrit.Instead,whatthe data may be showing ishowpeoplematureovertime.My own experience, and thestories of grit paragons likeJeff Gettleman and BobMankoffsuggestthat,indeed,grit grows as we figure outour life philosophy, learn todust ourselves off afterrejectionanddisappointment,
![Page 451: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/451.jpg)
andlearntotellthedifferencebetween low-level goals thatshould be abandoned quicklyand higher-level goals thatdemand more tenacity. Thematuration story is that wedevelopthecapacityforlong-term passion andperseveranceaswegetolder.
To distinguish betweenthese rival explanations, weneedadifferentkindofstudy.To generate the data I justshowed you, I asked people
![Page 452: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/452.jpg)
of different ages about theircurrent level of grit. What Igotwas a snapshot of grit inyounger and older adults.Ideally, I’d follow thesepeople for the rest of theirlives, the way psychologistGeorgeVaillant followed theHarvard men. Since the GritScalehasn’tbeenaroundverylong,Ican’tplayyouatime-lapse movie of grit over thelife course. What I want is
![Page 453: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/453.jpg)
thatmovie.What I have is asnapshot.
Fortunately, many otheraspects of personality havebeen examinedlongitudinally. In dozens ofstudies that have followedpeople over years anddecades, the trends are clear.Most of us become moreconscientious, confident,caring, and calm with lifeexperience. A lot of thatchange happens between the
![Page 454: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/454.jpg)
agesoftwentyandforty,but,in fact, there’s no epoch inthe human life span wherepersonality stops evolving.Collectively, these datademonstratewhat personalitypsychologists now call “thematurityprinciple.”
We grow up. Or at least,mostofusdo.
To some extent, thesechanges are preprogrammedand biological. Puberty andmenopause are things that
![Page 455: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/455.jpg)
change our personalities, forexample. But on the whole,personality change is more afunctionoflifeexperience.
Exactly how do lifeexperiences changepersonality?
One reason we change isthat we learn something wesimply didn’t know before.For instance, wemight learnthrough trial and error thatrepeatedly swapping out onecareerambitionforanotheris
![Page 456: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/456.jpg)
unfulfilling. That’s certainlywhat happened to me in mytwenties. After running anonprofit, then pursuingneuroscience research, thenmanagement consulting, thenteaching, I learned thatbeinga “promising beginner” isfun, but being an actualexpert is infinitely moregratifying. I also learned thatyears of hard work are oftenmistaken for innate talent,and that passion is as
![Page 457: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/457.jpg)
necessary as perseverance toworld-classexcellence.
Likewise, we learn, asnovelist John Irving did, that“to do anything really well,you have to overextendyourself,” to appreciate that,“indoingsomethingoverandover again, something thatwas never natural becomesalmost second nature,” andfinally,thatthecapacitytodowork that diligently “doesn’tcomeovernight.”
![Page 458: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/458.jpg)
Other than insights aboutthe human condition, whatelseistherethatchangeswithage?
Whatchanges, I think,areour circumstances. As wegrow older,we’re thrust intonew situations. We get ourfirstjob.Wemaygetmarried.Ourparentsgetolder,andwefind ourselves theircaretakers. Often, these newsituations call on us to actdifferently than we used to.
![Page 459: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/459.jpg)
And, because there’s nospecies on the planet moreadaptable than ours, wechange. We rise to theoccasion.
Inotherwords,wechangewhenweneedto.Necessityisthemotherofadaptation.
Here’s a trivial example.Somehow, my youngestdaughter, Lucy, reached theage of threewithout learningtousethepotty.Myhusbandand I had done our best to
![Page 460: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/460.jpg)
bribe, cajole, and trick herinto leaving diapers behind.We’dreadallthebooksaboutall theright thingstodo,andwe’d tried to do all thosethings—oratleastwetriedasenergetically as is possiblefor working parents withother things on their to-dolists.Tonoavail.Lucy’swillprovedstrongerthanours.
Soon after her thirdbirthday, Lucy changedpreschool classrooms: from
![Page 461: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/461.jpg)
the toddler classroom, wherealmost all the children werestill in diapers, to the “bigkid” classroom,which didn’teven have a changing table.The first day I dropped heroffinthenewroom,hereyeswidened to saucers, scanningthis new environment—alittle bit afraid, I think, andmore likely than notwishingshe could stay in her oldroom, where she’d growncomfortable.
![Page 462: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/462.jpg)
I’ll never forget pickingLucy up that afternoon. Shesmiled at me proudly andannounced she’d used thepotty. And then, in so manywords, she told me she wasdone with diapers. And shewas. Potty training happenedin a single moment in time.How? Because when a childlinesupforthepottywithallthe other children and seesthatshe’sexpectedtotakeherturn, she does exactly that.
![Page 463: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/463.jpg)
She learns to do what sheneedstodo.
Bernie Noe, theheadmaster of the LakesideSchool in Seattle, recentlyshared the following storyabout his own daughter. Itillustrates the maturityprincipletoaT.Noe’sfamilylives on campus, and as ateenager, his daughter waslate to school almost everyday. One summer, hisdaughter got a job folding
![Page 464: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/464.jpg)
clothesat the localAmericanEagle. On her first day, thestore manager said, “Oh, bytheway, thefirst timeyou’relate, you’re fired.” She wasstunned.No secondchances?All her life, there’d beenpatience, understanding, andsecondchances.
Sothenwhathappened?“It was amazing,” Noe
remembered. “Quite literally,it was the most immediatebehavior change I’ve ever
![Page 465: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/465.jpg)
seen her make.” Suddenly,his daughter was setting twoalarms tomake sure shewason time, or early, to a jobwhere being late was simplynot tolerated. As aheadmaster tasked withshepherding young peoplealong toward maturity, Noeconsiders his power to do sosomewhat limited. “If you’rea business, you don’t carewhether a kid thinks they’respecial.What you care about
![Page 466: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/466.jpg)
is ‘Can you deliver? If youcan’t deliver, hey, we don’thaveanyuseforyou.’ ”
Lectures don’t have halftheeffectofconsequences.
What the maturityprinciple comes down to, Ithink, is this. Over time, welearn life lessons we don’tforget, and we adapt inresponse to the growingdemands of ourcircumstances. Eventually,new ways of thinking and
![Page 467: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/467.jpg)
acting become habitual.There comes a daywhenwecan hardly remember ourimmature former selves.We’ve adapted, thoseadaptations have becomedurable, and, finally, ouridentity—the sort of personwe see ourselves to be—hasevolved.We’vematured.
Taken together, the dataI’vecollectedongritandageare consistent with twodifferent stories. One story
![Page 468: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/468.jpg)
saysthatourgritchangesasafunctionoftheculturalerainwhichwegrowup.Theotherstorysays thatwegetgrittieras we get older. Both couldbe true, and I have asuspicion that both are, atleasttoanextent.Eitherway,thissnapshot reveals thatgritis not entirely fixed. Likeevery aspect of yourpsychological character, gritis more plastic than youmightthink.
![Page 469: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/469.jpg)
If grit can grow, how doesthathappen?
I get emails and lettersalmosteverydayfrompeoplewhowishtheyhadmoregrit.They lament that they neverstuck with anything in ordertoget reallygoodat it.Theyfeel they’ve squandered theirtalents. They desperatelywant a long-term goal, andtheywant topursue thatgoal
![Page 470: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/470.jpg)
with passion andperseverance.
But they don’t knowwheretobegin.
Agoodplace tostart is tounderstand where you aretoday. If you’re not as grittyas you want to be, askyourselfwhy.
The most obvious answerpeople come up with goessomething like this: “I guessI’mjustlazy.”
![Page 471: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/471.jpg)
Here’sanother:“I’mjustaflake.”
Or: “I’m congenitallyincapable of sticking withthings.”
All of these answers, Ithink,arewrong.
In fact, when people dropoutofthings,theydosoforareason. Actually, they do sofordifferent reasons. Any ofthe following four thoughtsmight go through your head
![Page 472: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/472.jpg)
right before you quit whatyou’redoing:
“I’mbored.”“The effort isn’t worthit.”“Thisisn’timportanttome.”“I can’t do this, so Imightaswellgiveup.”
There’s nothing wrong—morally or otherwise—withthoughtslikethese.AsItried
![Page 473: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/473.jpg)
to show in this chapter,paragons of grit quit goals,too. But the higher the levelof the goal in question, themorestubborntheyareaboutseeing it through. Mostimportant, paragons of gritdon’t swap compasses:whenitcomestotheone,singularlyimportant aim that guidesalmost everything else theydo,theverygrittytendnot toutterthestatementsabove.
![Page 474: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/474.jpg)
A lot of what I’ve learnedabout how grit grows comesfrom interviewing men andwomen who epitomize thequalities of passion andperseverance. I’ve includedsnippets of thoseconversations throughout thisbook so that you, too, canpeerinsidethemindandheartof a grit paragon and seewhether there’s a belief,attitude, or habit worthemulating.
![Page 475: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/475.jpg)
These stories of grit areone kind of data, and theycomplement the moresystematic, quantitativestudies I’ve done in placeslike West Point and theNational Spelling Bee.Together,theresearchrevealsthe psychological assets thatmature paragons of grit havein common. There are four.They counter each of thebuzz-killers listedabove, and
![Page 476: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/476.jpg)
theytendtodevelop,overtheyears,inaparticularorder.
First comes interest.Passion begins withintrinsically enjoying whatyou do. Every gritty personI’ve studied can point toaspects of their work theyenjoy less than others, andmost have to put up with atleast one or two chores theydon’t enjoy at all.Nevertheless, they’recaptivatedbytheendeavoras
![Page 477: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/477.jpg)
a whole. With enduringfascination and childlikecuriosity, they practicallyshoutout,“IlovewhatIdo!”
Nextcomesthecapacitytopractice. One form ofperseverance is the dailydiscipline of trying to dothings better than we didyesterday. So, after you’vediscovered and developedinterest in a particular area,you must devote yourself tothe sort of focused, full-
![Page 478: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/478.jpg)
hearted,challenge-exceeding-skill practice that leads tomastery.Youmustzeroinonyour weaknesses, and youmust do so over and overagain, for hours a day, weekaftermonth afteryear.Tobegritty is to resistcomplacency. “Whatever ittakes,Iwanttoimprove!”isarefrainofallparagonsofgrit,no matter their particularinterest, and no matter howexcellenttheyalreadyare.
![Page 479: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/479.jpg)
Third is purpose. Whatripens passion is theconviction that your workmatters. For most people,interest without purpose isnearly impossible to sustainfor a lifetime. It is thereforeimperative that you identifyyourworkasbothpersonallyinteresting and, at the sametime, integrally connected tothe well-being of others. Fora few, a sense of purposedawns early, but for many,
![Page 480: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/480.jpg)
themotivationtoserveothersheightens after thedevelopment of interest andyears of disciplined practice.Regardless, fully matureexemplars of grit invariablytell me, “My work isimportant—bothtomeandtoothers.”
And,finally,hope.Hopeisa rising-to-the-occasion kindofperseverance.Inthisbook,I discuss it after interest,practice, and purpose—but
![Page 481: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/481.jpg)
hopedoesnot define the laststage of grit. It defineseverystage. From the verybeginning to the very end, itis inestimably important tolearn to keep going evenwhen things are difficult,even when we have doubts.Atvariouspoints,inbigwaysand small, we get knockeddown. If we stay down, gritloses. If we get up, gritprevails.
![Page 482: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/482.jpg)
Without the meddling of apsychologist like me, youmayhave figured grit out allon your own. You mayalready have a deep andabiding interest, a readyappetite for constantchallenge, an evolved senseof purpose, and buoyantconfidence in your ability tokeep going that no adversitycould sink. If so, you’reprobably close to 5 out of 5
![Page 483: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/483.jpg)
on the Grit Scale. I applaudyou!
If, on the other hand,you’re not as gritty as youwish you were, then there’ssomething for you in thechapters that follow. Likecalculus and piano, you canlearn the psychology of griton your own, but a littleguidancecanbeatremendoushelp.
The four psychologicalassets of interest, practice,
![Page 484: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/484.jpg)
purpose, and hope are notYou have it or you don’tcommodities. You can learnto discover, develop, anddeepen your interests. Youcan acquire the habit ofdiscipline. You can cultivatea sense of purpose andmeaning. And you can teachyourselftohope.
You can grow your gritfrom the inside out. If you’dliketoknowhow,readon.
![Page 485: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/485.jpg)
PartII
GROWINGGRITFROMTHEINSIDEOUT
![Page 486: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/486.jpg)
Chapter6
INTEREST
Follow your passion is apopular theme ofcommencement speeches.I’ve sat through my fair
![Page 487: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/487.jpg)
share, both as a student andprofessor. I’d wager that atleast half of all speakers,maybe more, underscore theimportance of doingsomethingyoulove.
For instance, Will Shortz,long-time editor of the NewYorkTimescrosswordpuzzle,told students at IndianaUniversity: “My advice foryou is, figure out what youenjoydoingmost in life, andthentrytodoitfull-time.Life
![Page 488: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/488.jpg)
is short. Follow yourpassion.”
Jeff Bezos told Princetongraduatesthestoryofleavinga high-salary, high-statusManhattanfinancejobtostartAmazon: “After muchconsideration, I took the lesssafe path to follow mypassion.” He has also said,“Whateveritisthatyouwanttodo,you’llfindinlifethatifyou’re not passionate aboutwhat it isyou’reworkingon,
![Page 489: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/489.jpg)
you won’t be able to stickwithit.”
And it’s not just on hotJune days in our cap andgownthatwegetthisadvice.I hear the same thing—overand over again, nearlyverbatim—from the gritparagonsIinterview.
SodoesHesterLacey.Hester is a British
journalist who has beeninterviewing achievers of thecaliberofShortzandBezos—
![Page 490: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/490.jpg)
one per week—since 2011.Her column appears weeklyin the Financial Times.Whether they’re fashiondesigners (Nicole Farhi),authors (Salman Rushdie),musicians (Lang Lang),comedians (Michael Palin),chocolatiers(ChantalCoady),or bartenders (Colin Field),Hester asks the samequestions, including: “Whatdrives you on?” and “If you
![Page 491: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/491.jpg)
lost everything tomorrow,whatwouldyoudo?”
I asked Hester what she’slearned from talking tomorethan two hundred “megasuccessful” people, as shedescribed them during ourconversation.
“One thing that comes uptimeandtimeagainis:‘Ilovewhat I do.’ People couch itdifferently. Quite often, theysay just that: ‘I love what Ido.’But they also say things
![Page 492: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/492.jpg)
like ‘I’m so lucky, I get upevery morning lookingforward towork, I can’twaitto get into the studio, I can’twait to get on with the nextproject.’ These people aredoingthingsnotbecausetheyhave to or because it’sfinanciallylucrative....”
Followyourpassionwasnotthemessage I heard growingup.
![Page 493: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/493.jpg)
Instead,Iwastoldthatthepracticalrealitiesofsurviving“in the real world” were farmore important than anyyoung person living a“sheltered life” such as myown could imagine. I waswarned that overly idealisticdreamsof“findingsomethingI loved” could in fact be abreadcrumb trail intopovertyand disappointment. I wasreminded that certain jobs,likebeingadoctor,wereboth
![Page 494: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/494.jpg)
high-income and high-status,and that these things wouldmattermoretomeinthelongrunthanImightappreciateinthemoment.
As you might haveguessed, the individualprofferingthisadvicewasmydad.
“So,why’dyoubecomeachemist?”Ionceasked.
“Because my father toldme to,” he answeredwithoutahintofresentment.“WhenI
![Page 495: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/495.jpg)
was a boy, history was myfavorite subject.” He thenexplained that he’d enjoyedmath and science, too, butthere was really no choicewhen it came to what he’dstudy in college. The familybusinesswastextiles,andmygrandfather dispatched eachof his sons to study tradesrelevant to one stage oranother of textile production.“Our business needed achemist,notahistorian.”
![Page 496: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/496.jpg)
As it turned out, theCommunist Revolution inChina brought a prematureend to the family textilebusiness. Not long after hesettled here in the UnitedStates,my dadwent toworkforDuPont.Thirty-fiveyearslater, he retired as thehighest-ranking scientist inthecompany.
Given how absorbed mydad was in his work—oftenlost in reverie about some
![Page 497: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/497.jpg)
scientific or managementproblem—and howsuccessfulhewasoverthearcof his career, it seemsworthconsidering the possibilitythat it’s best to choosepracticalityoverpassion.
Justhowridiculousisittoadviseyoungpeopletogooutand do what they love?Within the last decade or so,scientistswho study interestshave arrived at a definitiveanswer.
![Page 498: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/498.jpg)
First, research shows thatpeople are enormously moresatisfiedwiththeirjobswhenthey do something that fitstheir personal interests. Thisis the conclusion of a meta-analysis that aggregated datafrom almost a hundreddifferent studies thatcollectivelyincludedworkingadults in just about everyconceivable profession. Forinstance, people who enjoythinking about abstract ideas
![Page 499: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/499.jpg)
are not happy managing theminutiae of logisticallycomplicated projects; they’drather be solving mathproblems. And people whoreally enjoy interacting withpeople are not happy whentheirjobistoworkaloneatacomputer all day; they’remuch better off in jobs likesales or teaching. What’smore, people whose jobsmatch theirpersonal interests
![Page 500: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/500.jpg)
are, in general, happier withtheirlivesasawhole.
Second, people performbetter at work when whattheydointereststhem.Thisisthe conclusion of anothermeta-analysisofsixtystudiesconductedover thepastsixtyyears. Employees whoseintrinsic personal interests fitwith their occupations dotheir jobs better, are morehelpful to their coworkers,and stay at their jobs longer.
![Page 501: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/501.jpg)
College students whosepersonal interests align withtheirmajorearnhighergradesandarelesslikelytodropout.
It’s certainly true that youcan’t get a job just doinganythingyouenjoy.It’stoughto make a living playingMinecraft, no matter howgoodyougetat it.And thereare a lot of people in theworld whose circumstancespreclude the luxury ofchoosing among a broad
![Page 502: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/502.jpg)
arrayofoccupationaloptions.Like it or not, there are veryrealconstraintsinthechoiceswe can make about how weearnaliving.
Nevertheless, as WilliamJamesforetoldacenturyago,these new scientific findingsaffirmcommencementspeechwisdom: the “casting vote”forhowwellwecanexpecttodoinanyendeavoris“desireand passion, the strength of[our]interest....”
![Page 503: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/503.jpg)
In a 2014 Gallup poll, morethan two-thirdsofadultssaidthey were not engaged atwork, a good portion ofwhom were “activelydisengaged.”
Thepictureisevenbleakerabroad. In a survey of 141nations, Gallup found thateverycountrybutCanadahaseven higher numbers of “notengaged” and “activelydisengaged”workersthanthe
![Page 504: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/504.jpg)
United States. Worldwide,only13percentofadultscallthemselves “engaged” atwork.
So it seems that very fewpeople end up loving whattheydoforaliving.
It’s difficult to reconcilethe straightforward directivesoffered in inspirationalspeecheswithepidemiclevelsof indifference toward work.When it comes to lining upouroccupationswithwhatwe
![Page 505: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/505.jpg)
enjoy,howcomesomanyofus miss the mark? And doesmy dad’s success offer acounterexample to thepassion argument? Whatshould we make of the factthat, by the time I camealong, my father’s workreally was his passion?Shouldwestoptellingpeopleto follow your passion and,instead, tell them to followourorders?
Idon’tthinkso.
![Page 506: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/506.jpg)
In fact, I see Will Shortzand Jeff Bezos as terrificinspirations for what workcan be. While it’s naive tothink that any of us couldloveeveryminuteofwhatwedo,Ibelievethethousandsofdata points in those meta-analyses, which confirm thecommonsense intuition thatinterest matters. Nobody isinterested in everything, andeveryone is interested insomething.Somatchingyour
![Page 507: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/507.jpg)
job to what captures yourattentionandimaginationisagood idea. It may notguarantee happiness andsuccess, but it sure helps theodds.
That said, I don’t thinkmost young people needencouragementtofollowtheirpassion. Most would doexactlythat—inaheartbeat—if only they had a passion inthe first place. If I’m everinvited to give a
![Page 508: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/508.jpg)
commencement speech, I’llbegin with the advice tofosterapassion.AndthenI’llspend the rest of my timetryingtochangeyoungmindsabout how that actuallyhappens.
When I first startedinterviewing grit paragons, Iassumed they’d all havestories about the singularmoment when, suddenly,
![Page 509: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/509.jpg)
they’d discovered their God-given passion. In my mind’seye,thiswasafilmableevent,with dramatic lighting and asoundtrack of rousingorchestral musiccommensurate with itsmonumental, life-changingimport.
In the opening scene ofJulie&Julia,ayoungerJuliaChildthananyofuswatchedon television is dining in afancy French restaurant with
![Page 510: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/510.jpg)
herhusband,Paul.Juliatakesonebiteofhersolemeunière—beautifully seared andperfectly deboned by thewaiter moments before andnow napped in a sauce ofNormandybutter, lemon,andparsley. She swoons. She’snever experienced anythinglike this before. She alwaysliked to eat, but she neverknew food could be thisgood.
![Page 511: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/511.jpg)
“The whole experiencewasanopeningupofthesouland spirit forme,” Julia saidmany years later. “I washooked, and for life, as itturnedout.”
Such cinematic momentswere what I expected frommygritparagons.AndIthinkthis is also what younggraduates—roasting in theircaps and gowns, the hardedge of the folding chairbiting into their thighs—
![Page 512: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/512.jpg)
imagine it must be like todiscover your life’s passion.One moment, you have noidea what to do with yourtime on earth. And the next,it’s all clear—you knowexactlywho youweremeanttobe.
But, in fact, most gritparagons I’ve interviewedtold me they spent yearsexploring several differentinterests, and the one thateventuallycametooccupyall
![Page 513: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/513.jpg)
of their waking (and somesleeping) thoughts wasn’trecognizably their life’sdestinyonfirstacquaintance.
Olympic gold medalistswimmer Rowdy Gaines, forexample, told me: “When Iwas a kid, I loved sports.When I got to high school, Iwent out for football,baseball,basketball,golf,andtennis, in that order, before Iwent for swimming. I keptplugging away. I figured I’d
![Page 514: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/514.jpg)
just keep going from onesporttothenextuntilIfoundsomething that I could reallyfall in lovewith.”Swimmingstuck, but it wasn’t exactlyloveatfirstsight.“ThedayItriedoutfortheswimteam,Iwent to the school library tocheck out track and fieldbecause I kind of had afeelingIwasgoingtogetcut.I figured I’d tryout for trackandfieldnext.”
![Page 515: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/515.jpg)
As a teenager, JamesBeard Award–winning chefMarc Vetri was as interestedin music as he was incooking. After college, hemoved to Los Angeles. “Iwent to a music school outthereforayear,andIworkednights in restaurants tomakemoney.Later,when Iwas inaband,Iworkedmorningsinrestaurants so I could do themusic thing at night. Then itwas like, ‘Well, I’m making
![Page 516: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/516.jpg)
moneyintherestaurants,andI’m really starting to like it,andI’mnotmakinganythinginmusic.’And then IhadanopportunitytogotoItaly,andthatwas it.” It’s hard formeto picture my favorite chefplaying the guitar instead ofmaking pasta, but when Iasked what he thought aboutthe road not taken, he said,“Well, music and cooking—they’re both creativeindustries. I’m glad I went
![Page 517: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/517.jpg)
this way, but I think I couldhave been a musicianinstead.”
As for Julia Child, thatethereal morsel of solemeunière was indeed arevelation. But her epiphanywas that classical Frenchcuisine was divine, not thatshe would become a chef,cookbook author, and,eventually, the woman whowouldteachAmericatomakecoq au vin in their very own
![Page 518: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/518.jpg)
kitchens. Indeed, Julia’sautobiography reveals thatthis memorable meal wasfollowed by a succession ofinterest-stimulatingexperiences. An incompletelist would include countlessdeliciousmeals in thebistrosof Paris; conversations andfriendships with friendlyfishmongers, butchers, andproducevendors in thecity’sopen-air markets; encounterswithtwoencyclopedicFrench
![Page 519: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/519.jpg)
cookbooks—the first loanedtoherbyherFrenchtutorandthe second a gift from herever-supportive husband,Paul; hours of cookingclasses at Le Cordon Bleuunder the tutelage of themarvelously enthusiastic yetdemanding Chef Bugnard;and the acquaintance of twoParisianwomenwho had theidea of writing a cookbookforAmericans.
![Page 520: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/520.jpg)
What would havehappened if Julia—whooncedreamed of becoming anovelist and, as a child,possessed,assheputit,“zerointerest in the stove”—hadreturned home to Californiaafter that fateful bite ofperfectly cooked fish? Wecan’t know for sure, butclearly in Julia’s romancewith French food, that firstbite of solewas just the firstkiss. “Really, the more I
![Page 521: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/521.jpg)
cook, the more I like tocook,” she later told hersister-in-law.“Tothinkithastaken me forty years to findmy true passion (cat andhusbandexcepted).”
So, while we might envythosewho lovewhat theydofor a living, we shouldn’tassumethattheystartedfromadifferentplacethantherestofus.Chancesare, they tookquite some time figuring outexactly what they wanted to
![Page 522: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/522.jpg)
do with their lives.Commencement speakersmaysayabouttheirvocation,“I can’t imagine doinganything else,” but, in fact,therewasatimeearlierinlifewhentheycould.
A few months ago, I read apost on Reddit titled“Fleeting Interest inEverything, No CareerDirection”:
![Page 523: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/523.jpg)
I’minmyearly thirtiesand have no idea whatto do with myself,career-wise.AllmylifeI’ve been one of thosepeople who has beentold how smart Iam/howmuchpotentialIhave.I’minterestedinso much stuff that I’mparalyzed to tryanything. It seems likeevery job requires aspecialized certificate
![Page 524: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/524.jpg)
or designation thatrequires long-term timeand financialinvestment—beforeyoucan even try the job,whichisabitofadrag.
I have a lot of sympathyfor the thirty-something whowrote this post. As a collegeprofessor,Ialsohavealotofsympathy for the twenty-somethings who come tomeforcareeradvice.
![Page 525: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/525.jpg)
My colleague BarrySchwartzhasbeendispensingcounsel to anxious youngadultsformuchlongerthanIhave. He’s been teachingpsychology at SwarthmoreCollegeforforty-fiveyears.
Barry thinks that whatprevents a lot of youngpeople from developing aserious career interest isunrealistic expectations. “It’sreallythesameproblemalotofyoungpeoplehavefinding
![Page 526: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/526.jpg)
a romantic partner,” he said.“Theywant somebodywho’sreallyattractiveandsmartandkind and empathetic andthoughtful and funny. Trytelling a twenty-one-year-oldthat you can’t find a personwho is absolutely the best ineveryway.Theydon’t listen.They’re holding out forperfection.”
“What about yourwonderful wife, Myrna?” Iasked.
![Page 527: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/527.jpg)
“Oh, she is wonderful.More wonderful than I am,certainly. But is she perfect?IsshetheonlypersonIcouldhavemadeahappylifewith?Am I the only man in theworld with whom she couldhave made a wonderfulmarriage?Idon’tthinkso.”
A related problem, Barrysays, is the mythology thatfalling in love with a careershould be sudden and swift:“There are a lot of things
![Page 528: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/528.jpg)
where the subtleties andexhilarations come withsticking with it for a while,getting elbow-deep intosomething. A lot of thingsseem uninteresting andsuperficial until you startdoingthemand,afterawhile,you realize that there are somanyfacetsyoudidn’tknowatthestart,andyounevercanfully solve the problem, orfully understand it, or what
![Page 529: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/529.jpg)
have you.Well, that requiresthatyoustickwithit.”
After a pause, Barry said,“Actually, finding a mate isthe perfect analogy. Meetinga potential match—not theone-and-only perfect match,butapromisingone—isonlytheverybeginning.”
There’s a lot we don’t knowabout the psychology ofinterest. Iwishweknew, for
![Page 530: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/530.jpg)
example, why some of us(includingme)findcookingafascinating subject, whilemany others couldn’t careless. Why is Marc Vetriattracted to creativeendeavors, and why doesRowdy Gaines like sports?Aside from the rather vagueexplanation that interests are,likeeverythingelseaboutus,partly heritable and partly afunction of life experience, Ican’t tell you. But scientific
![Page 531: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/531.jpg)
research on the evolution ofinterests has yielded someimportant insights.My senseis that, unfortunately, thesebasic facts aren’t commonlyunderstood.
What most of us think ofwhenwethinkofpassionisasudden, all-at-once discovery—that first bite of solemeunièrebringingwith it thecertainty of the years you’llspend in the kitchen . . .slippingintothewateratyour
![Page 532: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/532.jpg)
first swim meet and gettingout with the foreknowledgethat you’ll one day be anOlympian . . . getting to theendofTheCatcherintheRyeand realizing you’re destinedto be a writer. But a firstencounter with what mighteventually lead to a lifelongpassion is exactly that—justthe opening scene in amuchlonger, less dramaticnarrative.
![Page 533: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/533.jpg)
Tothethirty-somethingonReddit with a “fleetinginterest in everything” and“no career direction,” here’swhat science has to say:passion for your work is alittle bit of discovery,followed by a lot ofdevelopment, and then alifetimeofdeepening.
Letmeexplain.First of all, childhood is
generally far too early toknow what we want to be
![Page 534: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/534.jpg)
when we grow up.Longitudinal studiesfollowing thousands ofpeople across time haveshown thatmost people onlybegin to gravitate towardcertain vocational interests,andawayfromothers,aroundmiddle school. This iscertainlythepatternI’veseeninmyinterviewresearch,andit’s also what journalistHesterLaceyhasfoundinherinterviews with the “mega
![Page 535: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/535.jpg)
successful.” Keep in mind,however, that a seventhgrader—even a futureparagon of grit—is unlikelyto have a fully articulatedpassionatthatage.Aseventhgrader is just beginning tofigure out her general likesanddislikes.
Second, interests are notdiscovered throughintrospection. Instead,interests are triggered byinteractions with the outside
![Page 536: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/536.jpg)
world.Theprocessofinterestdiscovery can be messy,serendipitous,and inefficient.This is because you can’treally predict with certaintywhat will capture yourattention and what won’t.You can’t simply willyourselftolikethings,either.As Jeff Bezos has observed,“One of the huge mistakespeople make is that they tryto force an interest onthemselves.” Without
![Page 537: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/537.jpg)
experimenting, you can’tfigureoutwhichinterestswillstick,andwhichwon’t.
Paradoxically, the initialdiscoveryofan interestoftengoes unnoticed by thediscoverer. In other words,when you just start to getinterested in something, youmay not even realize that’swhat’s happening. Theemotion of boredom isalways self-conscious—youknowitwhenyoufeelit—but
![Page 538: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/538.jpg)
when your attention isattracted to a new activity orexperience, you may havevery little reflectiveappreciation of what’shappeningtoyou.Thismeansthat, at the start of a newendeavor, asking yourselfnervously every few dayswhether you’ve found yourpassionispremature.
Third, what follows theinitialdiscoveryofaninterestis a much lengthier and
![Page 539: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/539.jpg)
increasingly proactive periodof interest development.Crucially, the initialtriggering of a new interestmust be followed bysubsequent encounters thatretrigger your attention—againandagainandagain.
For instance, NASAastronaut Mike Hopkins toldmethatitwaswatchingspaceshuttle launcheson televisionin high school that initiallyinspired his lifelong interest
![Page 540: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/540.jpg)
in space travel.But itwasn’tjust one launch that hookedhim. Itwas several shown insuccession over a period ofyears. Soon enough, hestarted digging for moreinformation on NASA, and“onepieceofinformationledtoanotherandanother.”
For master potter WarrenMacKenzie,ceramicsclassincollege—whichheonlytook,initially, because all thepainting classes were full—
![Page 541: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/541.jpg)
was followed by thediscoveryofAPotter’sBookby the great Bernard Leach,and then a year-longinternship with Leachhimself.
Finally, interests thrivewhen there is a crew ofencouraging supporters,including parents, teachers,coaches, and peers.Why areother people so important?For one thing, they providethe ongoing stimulation and
![Page 542: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/542.jpg)
information that is essentialto actually liking somethingmore and more. Also—moreobviously—positivefeedbackmakes us feel happy,competent,andsecure.
Take Marc Vetri as anexample. There are fewthings I enjoy reading morethan his cookbooks andessaysaboutfood,buthewasa solid-C student throughoutschool. “Ineverworkedhardatacademics,”he toldme.“I
![Page 543: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/543.jpg)
wasalways just like, ‘This iskindof boring.’ ” In contrast,MarcspentdelightfulSundayafternoons at his Siciliangrandmother’shouseinSouthPhilly. “She’d makemeatballsandlasagnaandallthat stuff, and I always likedto head down early to helpher out. By the time I waselevenorso,Istartedwantingto make that stuff at home,too.”
![Page 544: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/544.jpg)
Asateenager,Marchadapart-time job washing dishesin a local restaurant. “And Iloved that. I worked hard.”Why? Making money wasone motivation, but anotherwas the camaraderie of thekitchen. “Around that time Iwassortofasocialoutcast.Iwaskindofawkward.Ihadastutter. Everyone at schoolthought I was weird. I waslike, ‘Oh, here I can washdishes, and I can watch the
![Page 545: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/545.jpg)
guys on the line [cooking]whileI’mwashing,andIcaneat. Everyone is nice, andtheylikeme.’ ”
If you read Marc’scookbooks, you’ll be struckby how many friends andmentors he’s made in theworld of food. Page throughandlookforpicturesofMarcalone, and you’ll be hard-pressed to find many. Andread theacknowledgmentsofIlViaggioDiVetri.Itrunsto
![Page 546: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/546.jpg)
twopageswith the names ofpeoplewhomadehisjourneypossible, including this note:“Mom and Dad, you’vealways let me find my ownway and helped guide methroughit.You’llneverknowhowmuchIappreciateit.I’llalwaysneedyou.”
Isit“adrag”thatpassionsdon’t come to us all at once,as epiphanies, without theneed to actively developthem?Maybe.But thereality
![Page 547: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/547.jpg)
is that our early interests arefragile, vaguely defined, andin need of energetic, years-long cultivation andrefinement.
Sometimes, when I talk toanxious parents, I get theimpression they’vemisunderstood what I meanbygrit.Itellthemthathalfofgrit is perseverance—inresponse, I get appreciative
![Page 548: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/548.jpg)
head nods—but I also tellthem that nobody worksdoggedly on something theydon’t find intrinsicallyinteresting.Here,headsoftenstop nodding and, instead,cocktotheside.
“Just because you lovesomething doesn’t meanyou’ll be great,” says self-proclaimed TigerMomAmyChua.“Notifyoudon’twork.Most people stink at thethings they love.” I couldn’t
![Page 549: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/549.jpg)
agree more. Even in thedevelopment of yourinterests, there is work—practicing, studying, learning—tobe done. Still,mypointisthatmostpeoplestinkevenmoreatwhattheydon’tlove.
So, parents, parents-to-be,andnon-parentsofallages,Ihave a message for you:Beforehardworkcomesplay.Before those who’ve yet tofix on a passion are ready tospend hours a day diligently
![Page 550: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/550.jpg)
honingskills, theymustgoofaround, triggering andretriggering interest. Ofcourse,developinganinterestrequirestimeandenergy,andyes, some discipline andsacrifice. But at this earlieststage, novices aren’tobsessed with getting better.They’re not thinking yearsand years into the future.They don’t know what theirtop-level, life-orienting goal
![Page 551: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/551.jpg)
will be. More than anythingelse,they’rehavingfun.
In other words, even themostaccomplishedofexpertsstart out as unseriousbeginners.
Thisisalsotheconclusionof psychologist BenjaminBloom,who interviewed 120people who achieved world-class skills in sports, arts, orscience—plus their parents,coaches, and teachers.Among Bloom’s important
![Page 552: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/552.jpg)
findings is that thedevelopment of skillprogresses through threedifferent stages, each lastingseveral years. Interests arediscovered and developed inwhatBloomcalled“theearlyyears.”
Encouragement during theearlyyears iscrucialbecausebeginners are still figuringout whether they want tocommit or cut bait.Accordingly, Bloom and his
![Page 553: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/553.jpg)
research team found that thebest mentors at this stagewere especially warm andsupportive: “Perhaps themajor quality of theseteachers was that they madethe initial learning verypleasant and rewarding.Much of the introduction tothe field was as playfulactivity, and the learning atthe beginning of this stagewasmuchlikeagame.”
![Page 554: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/554.jpg)
A degree of autonomyduring the earlyyears is alsoimportant. Longitudinalstudies tracking learnersconfirm that overbearingparents and teachers erodeintrinsic motivation. Kidswhoseparents let themmaketheirownchoicesaboutwhatthey like are more likely todevelop interests lateridentified as a passion. So,whilemydad inShanghai in1950didn’tthinktwiceabout
![Page 555: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/555.jpg)
his father assigning him acareer path, most youngpeople today would find itdifficult to fully “own”interestsdecidedwithouttheirinput.
Sports psychologist JeanCôté finds that shortcuttingthis stage of relaxed, playfulinterest, discovery, anddevelopment has direconsequences.Inhisresearch,professional athletes likeRowdy Gaines who, as
![Page 556: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/556.jpg)
children,sampledavarietyofdifferent sports beforecommitting to one, generallyfare much better in the longrun. This early breadth ofexperience helps the youngathletefigureoutwhichsportfits better than others.Sampling also provides anopportunity to “cross-train”muscles and skills that willeventually complement morefocused training. Whileathletes who skip this stage
![Page 557: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/557.jpg)
often enjoy an earlyadvantage in competitionagainstlessspecializedpeers,Côté finds that they’re morelikely to become injuredphysicallyandtoburnout.
We’lldiscusswhatBloomcalls“themiddleyears”inthenext chapter, on practice.Finally, we’ll plumb “thelateryears”inchapter8whenwediscusspurpose.
For now, what I hope toconvey is that experts and
![Page 558: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/558.jpg)
beginners have differentmotivational needs. At thestartofanendeavor,weneedencouragement and freedomto figure out what we enjoy.We need small wins. Weneed applause. Yes, we canhandle a tincture of criticismandcorrectivefeedback.Yes,we need to practice. But nottoo much and not too soon.Rush a beginner and you’llbludgeon their budding
![Page 559: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/559.jpg)
interest. It’s very, very hardtogetthatbackonceyoudo.
Let’s return to ourcommencement speakers.They’re case studies inpassion,so there’ssomethingto be learned from how theyspenttheirearlyyears.New York Times puzzle
editor Will Shortz told methathismotherwas“awriterand a lover of words,” and
![Page 560: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/560.jpg)
that her mother, in turn, hadbeen a crossword fan. Aninclination toward language,Shortzspeculated,couldverywellbeinhisgenes.
But the unique path hewalkedwas not just amatterof genetic destiny. Not verylong after he learned to readandwrite,Shortzcameacrossa puzzle book. “I was justentrancedbyit,”herecalls.“Ijust wanted to make myown.”
![Page 561: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/561.jpg)
Predictably, that firstpuzzle book—the initialtrigger forhiscuriosity—wasfollowedbyaslewofothers.“Wordpuzzles,mathpuzzles,you name it. . . .” Soonenough, Shortz knew all ofthe major puzzle makers byname,acquiringthecompleteDoverBookscollectionofhisheroSamLoyd,aswellastheworks of a half-dozen otherpuzzle makers whose names
![Page 562: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/562.jpg)
are as familiar to Shortz astheyareforeigntome.
Who bought all thosebooks?
Hismother.Whatelsedidshedo?“I remember when I was
very young my mom had abridgeclubover,andtokeepmequietfortheafternoonshetookapieceofpaper,ruleditinto squares, and showedmehow to enter long wordsacrossandupanddown.And
![Page 563: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/563.jpg)
I was happy all afternoonmaking my little puzzles.Whenthebridgeclubleft,mymother came in andnumberedthegridformeandshowed me how to writeclues. So that was my firstcrossword.”
And then Shortz’s motherdid what few mothers—including me—would havethe initiativeorknow-howtodo:“Mymomencouragedmeto sell my puzzles once I
![Page 564: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/564.jpg)
startedmakingthem,becauseas a writer, she submittedarticles for publication tomagazines and newspapers.Once she saw this interestthat I had, she showed mehowtosubmitmywork.
“I sold my first puzzlewhen I was fourteen, and Ibecame a regular contributorto Dell puzzle magazineswhenIwassixteen.”
Shortz’s mother wasclearly on the lookout for
![Page 565: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/565.jpg)
what might pique her son’sinterest: “My mom did a lotof great things,” he told me.“For instance, I lovedlistening to radio and popmusicandrockmusicwhenIwasakid.Whenshesawthisinterest,shegotaguitarfroma neighbor and set it on thebunkbedabovemybed.Ihadtheopportunity,ifIwantedit,topickuptheguitarandstartplaying.”
![Page 566: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/566.jpg)
But the desire to makemusicwas nothing comparedtothedesiretomakepuzzles.“After nine months, when Ihadnever touched theguitar,she took it back. I guess Ilikedlisteningtomusic,butIhadnointerestinplayingit.”
When Shortz enrolled atIndianaUniversity, itwashismom who found theindividualized program thatenabled Shortz to invent hisown major: to this day,
![Page 567: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/567.jpg)
Shortz remains the onlyperson in theworld toholdacollege degree inenigmatology—the study ofpuzzles.
WhataboutJeffBezos?Jeff’s unusually interest-
filled childhood has a lot todowithhisunusuallycuriousmother,Jackie.
Jeff came into the worldtwoweeksafterJackieturned
![Page 568: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/568.jpg)
seventeen years old. “So,”she toldme, “Ididn’thavealot of preconceived notionsaboutwhatIwassupposedtodo.”
She remembers beingdeeply intrigued by Jeff andhis younger brother andsister: “I was just so curiousabout these little creaturesandwho theywere andwhattheyweregoingtodo.Ipaidattention to what interestedeach one—they were all
![Page 569: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/569.jpg)
different—and followed theirlead. I felt it was myresponsibility to let them dodeep dives into what theyenjoyed.”
For instance, at three, Jeffaskedmultiple times to sleepin a “big bed.” Jackieexplained that eventually hewould sleep in a “big bed,”but not yet. She walked intohis room the next day andfound him, screwdriver inhand, disassembling his crib.
![Page 570: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/570.jpg)
Jackie didn’t scold him.Instead, she sat on the floorand helped. Jeff slept in a“bigbed”thatnight.
Bymiddle school, hewasinventing all sorts ofmechanical contraptions,including an alarm on hisbedroom door that made aloudbuzzingsoundwheneveroneofhissiblings trespassedacross the threshold. “Wemade so many trips toRadioShack,” Jackie said,
![Page 571: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/571.jpg)
laughing. “Sometimes we’dgo back four times in a daybecause we needed anothercomponent.
“Once, he took string andtied all the handles of thekitchen cupboards together,and then, when you openedone, all of them would popopen.”
Itriedtopicturemyselfinthese situations. I tried topicture not freaking out. Itried to imagine doing what
![Page 572: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/572.jpg)
Jackie did, which was tonoticethatheroldestsonwasblooming into a world-classproblem solver, and thenmerrilynurturethatinterest.
“Mymonikerat thehousewas ‘Captain of Chaos,’ ”Jackie told me, “and that’sbecause just about anythingthat youwanted to dowouldbe acceptable in somefashion.”
Jackie remembers thatwhenJeffdecidedtobuildan
![Page 573: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/573.jpg)
infinity cube, essentially amotorized set ofmirrors thatreflect one another’s imagesback and forth ad infinitum,she was sitting on thesidewalk with a friend. “Jeffcomesup tous and is tellingus all the science behind it,andI listenandnodmyheadandaskaquestioneveryoncein a while. After he walkedaway, my friend asked if Iunderstoodeverything.AndIsaid,‘It’snotimportantthatI
![Page 574: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/574.jpg)
understand everything. It’simportantthatIlisten.’ ”
By high school, Jeff hadturned the familygarage intoalaboratoryforinventingandexperimentation. One day,Jackie got a call from Jeff’shigh school saying he wasskipping classes after lunch.Whenhegothome,sheaskedhimwherehe’dbeengoinginthe afternoons. Jeff told herhe’d found a local professorwho was letting him
![Page 575: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/575.jpg)
experiment with airplanewings and friction and drag,and—“Okay,” Jackie said. “Igot it. Now, let’s see if wecan negotiate a legal way todothat.”
Incollege,Jeffmajoredincomputer science andelectrical engineering, andafter graduating, applied hisprogramming skills to themanagement of investmentfunds. Several years later,Jeff built an Internet
![Page 576: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/576.jpg)
bookstore named after thelongest river in the world:Amazon.com. (He alsoregistered the URLwww.relentless.com; type itinto your browser and seewhereittakesyou....)
“I’m always learning,” WillShortz told me. “I’m alwaysstretchingmybrain in a newway,tryingtofindanewcluefor aword, searchout anew
![Page 577: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/577.jpg)
theme. I read once—awritersaidthat ifyou’reboredwithwriting, that means you’rebored with life. I think thesame is true of puzzles. Ifyou’re bored with puzzles,you’re bored with life,becausethey’resodiverse.”
Pretty much every gritparagon I’ve talked to,including my own dad, saysthe same thing. And inexamining one large-scalestudyafteranother,Ifindthat
![Page 578: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/578.jpg)
the grittier an individual is,the fewer career changesthey’relikelytomake.
In contrast, we all knowpeople who habitually throwthemselves headlong into anew project, developing afierce interest, only to moveon after three or four or fiveyears to something entirelydifferent. There seems noharminpursuingavarietyofdifferent hobbies, butendlessly dating new
![Page 579: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/579.jpg)
occupations, and neversettlingdownwithjustone,isamoreseriousmatter.
“I call them short-termers,” Jane Golden toldme.
Jane has been promotingpublicartinmyhomecityofPhiladelphia for more thanthirtyyearsas thedirectorofthe revered Mural ArtsProgram.At last count, she’shelped convert the walls ofmore than 3,600 buildings
![Page 580: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/580.jpg)
intomurals;hersisthesinglelargest public art program inthecountry.Mostpeoplewhoknowherwoulddescribehercommitment tomural arts as“relentless,” and Jane wouldagree.
“Short-termerscomeworkhereforalittlewhileandthentheymove on, and then theygo somewhere else, and thensomewhereelseagain,andsoon. I’m always sort oflooking at them like they’re
![Page 581: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/581.jpg)
from another planet becauseI’m like, ‘How’s that? Howdo you not lock in tosomething?’ ”
Of course, it’s Jane’sunwavering focus that needsexplaining, not the limitedattention spans of the short-termers who come and go.Fundamentally, the emotionof boredom, after doingsomething for a while, is avery natural reaction. Allhuman beings, even from
![Page 582: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/582.jpg)
infancy, tend to look awayfrom things they’ve alreadyseen and, instead, turn theirgaze to things that are newand surprising. In fact, thewordinterestcomesfromtheLatin interesse, whichmeans“to differ.” To be interestingis, literally, to be different.We are, by our natures,neophiles.
Even though getting tiredof things after a while iscommon, it’s not inevitable.
![Page 583: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/583.jpg)
If you revisit the Grit Scale,you’ll see that half the itemsask about how consistentyour interests are over longstretches of time. This linksback to the fact that gritparagons don’t just discoversomething they enjoy anddevelop that interest—theyalsolearntodeepenit.
As a young woman, Janethought she’d become apainter. Now she battlesbureaucratic red tape and
![Page 584: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/584.jpg)
raises money and deals withneighborhood politics. Iwondered whether she’dsacrificed her life to a causeshefeltwasmoremeaningfulbut less interesting. Iwondered if she’d given upnovelty.
“When I stoppedpainting,it was very difficult,” Janetold me. “But then Idiscovered that growing theMuralArtsProgramcouldbeacreativeendeavor.Andthat
![Page 585: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/585.jpg)
wasgreat,becauseI’maverycuriousperson.
“From the outside, youmight see my life asmundane: ‘Jane, you’re justrunning the Mural ArtsProgram and you’ve beendoing that forever.’ I wouldsay, ‘No, listen, today Iwentto a maximum securityprison.IwasinNorthPhilly.I went to church. I was in aboardroom. I met with adeputy commissioner. I met
![Page 586: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/586.jpg)
with a city council person. Iworked at an artists’residencyprogram.Isawkidsgraduating.’ ”
ThenJaneusedapainter’sanalogy: “I’m like an artistwho looks at the sky everymorningandseesavarietyofreally brilliant colors whereother people would just seeblueorgray.I’mseeinginthecourse of a single day thistremendous complexity and
![Page 587: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/587.jpg)
nuance. I see something thatiseverevolvingandrich.”
For help understanding theever-deepening interests ofexperts, I turned to thepsychologistPaulSilvia.
Paul is a leadingauthorityontheemotionofinterest.Hebegan our conversation bypointingoutthatbabiesknowjust aboutzilchwhen they’reborn. Unlike other animals,
![Page 588: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/588.jpg)
whichhavestronginstinctstoact in certain ways, babiesneed to learn almosteverything from experience.Ifbabiesdidn’thaveastrongdrive for novelty, theywouldn’t learn as much, andthatwouldmakeitlesslikelythey’d survive. “So, interest—the desire to learn newthings, to explore the world,to seek novelty, to be on thelookout for change andvariety—it’sabasicdrive.”
![Page 589: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/589.jpg)
How, then, dowe explainthe enduring interests of gritparagons?
Like me, Paul has foundthat experts often say thingslike “The more I know, theless I understand.” Sir JohnTempleton,forexample,whopioneered the idea ofdiversified mutual funds,made the motto of hisphilanthropic foundation“How little we know, howeagertolearn.”
![Page 590: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/590.jpg)
Thekey,Paulexplained,isthat novelty for the beginnercomes in one form, andnovelty for the expert inanother. For the beginner,novelty is anything thathasn’t been encounteredbefore. For the expert,noveltyisnuance.
“Take modern art,” Paulsaid. “A lot of pieces couldseemverysimilartoanovicethatseemverydifferenttoanexpert. Novices don’t have
![Page 591: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/591.jpg)
the necessary backgroundknowledge. They just seecolors and shapes. They’renot surewhat it’s all about.”But the art expert hascomparatively enormousunderstanding.Heor shehasdeveloped a sensitivity todetailsthattherestofuscan’tevensee.
Here’s another example.Ever watch the Olympics?Ever listen to thecommentators say things, in
![Page 592: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/592.jpg)
real time, like “Oh! Thattriple lutz was just a littleshort!” “That push-off wasperfectly timed”? You sitthere and wonder how thesecommentators can perceivesuch microscopic differencesin the performance of oneathleteversusanotherwithoutwatching the video playbackin slow motion. I need thatvideo playback. I aminsensitive to those nuances.But an expert has the
![Page 593: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/593.jpg)
accumulated knowledge andskilltoseewhatI,abeginner,cannot.
If you’d like to follow yourpassion but haven’t yetfosteredone, youmust beginatthebeginning:discovery.
Askyourselfa fewsimplequestions:What do I like tothink about?Where does mymind wander? What do Ireally care about? What
![Page 594: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/594.jpg)
mattersmosttome?HowdoIenjoyspendingmytime?And,in contrast, what do I findabsolutelyunbearable?Ifyoufind it hard to answer thesequestions, try recalling yourteenyears,thestageoflifeatwhich vocational interestscommonlysprout.
Assoonasyouhaveevena general direction in mind,youmusttriggeryournascentinterests.Dothisbygoingoutinto the world and doing
![Page 595: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/595.jpg)
something. To younggraduates wringing theirhandsoverwhat todo, Isay,Experiment! Try! You’llcertainly learn more than ifyoudon’t!
At this early stage ofexploration, here are a fewrelevantrulesofthumbtakenfrom Will Shortz’s essay“HowtoSolve theNewYorkTimesCrosswordPuzzle”:
![Page 596: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/596.jpg)
Beginwith theanswersyou’re surest of andbuild from there.However ill-definedyour interests, therearesome things you knowyou’d hate doing for aliving, and some thingsthat seem morepromising than others.That’sastart.
Don’t be afraid toguess. Like it or not,
![Page 597: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/597.jpg)
there’sacertainamountof trial and errorinherent in the processof interest discovery.Unlike the answers tocrossword puzzles,there isn’t just onething you can do thatmight develop into apassion. There aremany. You don’t haveto find the “right” one,or even the “best” one—just a direction that
![Page 598: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/598.jpg)
feels good. It can alsobe difficult to know ifsomething will be agood fituntilyou try itforawhile.
Don’tbeafraidtoerasean answer that isn’tworking out. At somepoint, you may chooseto write your top-levelgoal in indelible ink,but until you know forsure,workinpencil.
![Page 599: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/599.jpg)
If, on the other hand, youalreadyhaveagoodsenseofwhat you enjoy spendingyour time doing, it’s time todevelop your interest. Afterdiscovery comesdevelopment.
Remember that interestsmust be triggered again andagainandagain.Findwaystomake that happen. And havepatience.Thedevelopmentofinterests takes time. Keepasking questions, and let the
![Page 600: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/600.jpg)
answers to those questionslead you to more questions.Continue to dig. Seek outother people who share yourinterests. Sidle up to anencouraging mentor.Whateveryourage,overtimeyour role as a learner willbecome a more active andinformed one. Over a periodofyears,yourknowledgeandexpertise will grow, andalongwithityourconfidenceandcuriositytoknowmore.
![Page 601: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/601.jpg)
Finally, if you’ve beendoing somethingyou like forafewyearsandstillwouldn’tquite call it a passion, see ifyou can deepen yourinterests. Since novelty iswhatyourbraincraves,you’llbe tempted to move on tosomething new, and thatcouldbewhatmakesthemostsense. However, if you wanttostayengagedformorethana fewyears inany endeavor,you’ll need to find a way to
![Page 602: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/602.jpg)
enjoythenuancesthatonlyatrue aficionado canappreciate. “The old in thenew is what claims theattention,” said WilliamJames. “The old with aslightlynewturn.”
In sum, the directive tofollowyourpassionisnotbadadvice.Butwhatmaybeevenmore useful is to understandhow passions are fostered inthefirstplace.
![Page 603: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/603.jpg)
Chapter7
PRACTICE
Inoneofmyearliestresearchstudies, I found that grittierkids at the National SpellingBeepracticedmorethantheir
![Page 604: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/604.jpg)
lessgrittycompetitors.Theseextra hours of practice, inturn, explained their superiorperformance in finalcompetition.
Thisfindingmadealotofsense.Asamath teacher, I’dobserved a huge range ineffort among my students.Some kids spent, quiteliterally,zerominutesaweekon their homework; othersstudied for hours a day.Considering all the studies
![Page 605: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/605.jpg)
showing that gritty peopletypically stick with theircommitments longer thanothers, it seemed like themajor advantage of grit was,simply,moretimeontask.
At the same time, I couldthinkofalotofpeoplewho’dracked up decades ofexperience in their jobs butnevertheless seemed tostagnateatamiddlinglevelofcompetence. I’m sure youcan, too. Think about it. Do
![Page 606: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/606.jpg)
youknowanyonewho’sbeendoing something for a long,longtime—maybetheirentireprofessional lives—and yetthe best you can say of theirskill is that they’re prettymuch okay and not badenough to fire? As acolleague of mine likes tojoke:somepeopleget twentyyears of experience, whileothers get one year ofexperience . . . twenty timesinarow.
![Page 607: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/607.jpg)
Kaizen is Japanese forresisting the plateau ofarrested development. Itsliteral translation is:“continuousimprovement.”Awhileback,theideagotsometractioninAmericanbusinessculturewhenitwastoutedasthe core principle behindJapan’sspectacularlyefficientmanufacturing economy.After interviewing dozensanddozensofgritparagons,Ican tell you that they all
![Page 608: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/608.jpg)
exude kaizen. There are noexceptions.
Likewise,inherinterviewswith “mega successful”people, journalist HesterLacey has noticed that all ofthem demonstrate a strikingdesire to excel beyond theiralready remarkable level ofexpertise: “An actor mightsay, ‘Imayneverplaya roleperfectly, but Iwant to do itaswellasIpossiblycan.Andineveryrole, Iwant tobring
![Page 609: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/609.jpg)
something new. I want todevelop.’Awritermightsay,‘IwanteverybookIdotobebetterthanthelast.’
“It’s a persistent desire todo better,” Hester explained.“It’s the opposite of beingcomplacent. But it’s apositive state of mind, not anegativeone.It’snotlookingbackward withdissatisfaction. It’s lookingforward and wanting togrow.”
![Page 610: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/610.jpg)
My interview research mademewonderwhethergritisnotjust about quantity of timedevoted to interests, but alsoqualityoftime.Notjustmoretime on task, but also bettertimeontask.
I started readingeverythingIcouldabouthowskillsdevelop.
Soon enough, this led meto the doorstep of cognitivepsychologist Anders
![Page 611: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/611.jpg)
Ericsson. Ericsson has spenthis career studying howexperts acquire world-classskills. He’s studied Olympicathletes, chess grandmasters,renowned concert pianists,prima ballerinas, PGAgolfers, Scrabble champions,and expert radiologists. Thelistgoeson.
Putitthisway:Ericssonisthe world expert on worldexperts.
![Page 612: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/612.jpg)
Below,I’vedrawnagraphthat summarizes whatEricsson’s learned. If youtrack the development ofinternationally renownedperformers, you invariablyfind that their skill improvesgraduallyoveryears.Astheyget better, their rate ofimprovement slows. Thisturnsout tobe true for allofus.Themoreyouknowaboutyourfield,theslighterwillbeyour improvement from one
![Page 613: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/613.jpg)
daytothenext.
That there’s a learningcurve for skill developmentisn’t surprising. But thetimescale on which that
![Page 614: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/614.jpg)
development happens is. InoneofEricsson’sstudies, thevery best violinists at aGerman music academyaccumulated about tenthousand hours of practiceover ten years beforeachieving elite levels ofexpertise. By comparison,less accomplished studentsaccumulated about half asmuch practice over the sameperiod.
![Page 615: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/615.jpg)
Perhaps not socoincidentally, the dancerMartha Graham declared, “Ittakesabouttenyearstomakeamature dancer.”More thana century ago, psychologistsstudying telegraph operatorsobserved that reachingcomplete fluency in Morsecodewas rarebecauseof the“many years of hardapprenticeship” required.How many years? “Ourevidence,” the researchers
![Page 616: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/616.jpg)
concluded,“is that itrequiresten years to make athoroughly seasoned pressdispatcher.”
If you’ve read Ericsson’soriginal research, you knowthat ten thousand hours ofpracticespreadovertenyearsisjustaroughaverage.Someof the musicians he studiedreached the high-water markof expertise before that, andsomeafter.Butthere’sagoodreason why “the ten-
![Page 617: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/617.jpg)
thousand-hour rule” and “theten-year-rule” have goneviral. They give you avisceral sense of the scale ofthe required investment. Nota few hours, not dozens, notscores, not hundreds.Thousands and thousands ofhours of practice over yearsandyearsandyears.
The really crucial insight ofEricsson’s research, though,
![Page 618: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/618.jpg)
is not that experts log morehoursofpractice.Rather, it’sthat experts practicedifferently.Unlikemostofus,expertsareloggingthousandsupon thousands of hours ofwhatEricssoncallsdeliberatepractice.
IsuspectedEricssoncouldprovideanswersastowhy,ifpractice is so important,experience doesn’t alwayslead to excellence. So Idecided to ask him about it,
![Page 619: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/619.jpg)
using myself as a primeexample.
“Look,ProfessorEricsson,I’ve been jogging about anhour a day, several days aweek, since I was eighteen.And I’m not a second fasterthan I everwas. I’ve run forthousands of hours, and itdoesn’t look like I’manywhereclosetomakingtheOlympics.”
“That’s interesting,” hereplied.“MayIaskyouafew
![Page 620: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/620.jpg)
questions?”“Sure.”“Do you have a specific
goalforyourtraining?”“Tobehealthy?Tofitinto
myjeans?”“Ah,yes.Butwhenyougo
forarun,doyouhaveatargetin terms of the pace you’dlike to keep? Or a distancegoal?Inotherwords,istherea specific aspect of yourrunning you’re trying toimprove?”
![Page 621: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/621.jpg)
“Um,no.Iguessnot.”Then he asked what I
thought about while I wasrunning.
“Oh,youknow,I listentoNPR. Sometimes I thinkaboutthethingsIneedtogetdone that day. I might planwhattomakefordinner.”
Then he verified that Iwasn’t keeping track of myruns in any systematic way.No diary of my pace, or mydistance,or theroutesI took,
![Page 622: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/622.jpg)
myendingheart rate,orhowmany intervals I’d sprintedinsteadofjogged.WhywouldI need to do that?Therewasno variety to my routine.Everyrunwaslikethelast.
“I assume you don’t haveacoach?”
Ilaughed.“Ah,”hepurred.“IthinkI
understand. You aren’timprovingbecauseyou’renotdoingdeliberatepractice.”
![Page 623: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/623.jpg)
Thisishowexpertspractice:First, they set a stretch
goal, zeroing in on just onenarrowaspectoftheiroverallperformance. Rather thanfocusonwhattheyalreadydowell, experts strive toimprovespecificweaknesses.They intentionally seek outchallenges they can’t yetmeet. Olympic gold medalswimmer Rowdy Gaines, forexample, said, “At everypractice, I would try to beat
![Page 624: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/624.jpg)
myself.Ifmycoachgavemeten 100s one day and askedmetohold1:15,thenthenextday when he gave me ten100s, I’d try to hold 1:14.”IVirtuosoviolistRobertoDíazdescribes “working to findyour Achilles’ heel—thespecific aspect of the musicthatneedsproblemsolving.”
Then, with undividedattention and great effort,experts strive to reach theirstretch goal. Interestingly,
![Page 625: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/625.jpg)
many choose to do so whilenobody’s watching.Basketball great KevinDurant has said, “I probablyspend70 percent ofmy timeby myself, working on mygame, just trying to fine-tuneevery single piece of mygame.”Likewise, the amountof time musicians devote topracticing alone is a muchbetter predictor of howquickly they develop than
![Page 626: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/626.jpg)
time spent practicing withothermusicians.
As soon as possible,experts hungrily seekfeedback on how they did.Necessarily, much of thatfeedback is negative. Thismeans that experts are moreinterested in what they didwrong—so they can fix it—thanwhattheydidright.Theactive processing of thisfeedback isasessentialas itsimmediacy.
![Page 627: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/627.jpg)
Here’s how UlrikChristensen learned thislesson. Christensen is aphysician-turned-entrepreneur whose adaptivelearning software is designedaround the principles ofdeliberatepractice.Oneofhisearly projects was a virtualreality game that teachesdoctors the proper handlingof urgent, complex cardiacconditions such as strokesandheartattacks.Duringone
![Page 628: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/628.jpg)
training session, he foundhimself alone with aphysicianwhoseemedunabletofinish.
“I couldn’t figure it out,”Christensen told me. “Thisguy wasn’t stupid, but afterhoursofdetailedfeedbackonwhat he’d done wrong, hestill wasn’t getting the rightanswers. Everyone else hadgone home, and there wewere, stuck.” Exasperated,Christensen stopped him just
![Page 629: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/629.jpg)
before he got the next roundof feedback. “Time-out,”Christensen said. “What youjust did, treating this patient,is thereanythingyoudidjustnow where you were indoubt? Anything where youweren’t sure it met the newguidelines?”
The doctor thought amoment and then listeddecisions he’d been certainabout; then he named a fewchoices about which he was
![Page 630: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/630.jpg)
less sure. In other words, hereflected for a moment onwhat he knew and what hedidn’t.
Christensen nodded,listening,andwhenthedoctorwas finished, he let him seethe computer screenwith thesame feedback that had beendisplayed a dozen timesbefore. On the next trial, thedoctorexecutedtheprocedurecorrectly.
![Page 631: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/631.jpg)
And after feedback, thenwhat?
Thenexpertsdoitalloveragain, and again, and again.Until they have finallymasteredwhattheysetouttodo.Untilwhatwasastrugglebefore is now fluent andflawless. Until consciousincompetence becomesunconsciouscompetence.
In the story of the doctorwhofinallytookamomenttothink about what he was
![Page 632: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/632.jpg)
doing, Christensen kept thepracticegoinguntilthedoctorwas doing the procedurewithout any errors at all.After four consecutive,perfectly correct repetitions,Christensen said, “Good job.We’re donewith this for theday.”
And . . . thenwhat?Whatfollows mastery of a stretchgoal?
Thenexperts start alloveragainwithanewstretchgoal.
![Page 633: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/633.jpg)
One by one, these subtlerefinements add up todazzlingmastery.
Deliberate practice was firststudied in chess players andthen in musicians andathletes.Ifyou’renotachessplayer, musician, or athlete,you might be wonderingwhetherthegeneralprinciplesofdeliberatepracticeapplytoyou.
![Page 634: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/634.jpg)
Without hesitation, I cantell you the answer: YES.Even the most complex andcreative of human abilitiescan be broken down into itscomponent skills, each ofwhich can be practiced,practiced,practiced.
For example, deliberatepractice is how BenjaminFranklindescribed improvinghis writing. In hisautobiography, Franklindescribes collecting the very
![Page 635: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/635.jpg)
best essays in his favoritemagazine, the Spectator. Heread and reread them, takingnotes, and then he hid theoriginals in a drawer. Next,Franklin rewrote the essays.“Then I compared mySpectator with the original,discoveredsomeofmyfaults,andcorrectedthem.”Likethemodern-day experts Ericssonstudies,Franklinzeroedinonspecific weaknesses anddrilled them relentlessly. For
![Page 636: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/636.jpg)
instance, to improve hisability to make logicalarguments, Franklin wouldjumble his notes on essaysand then attempt toput theminasensibleorder:“Thiswasto teach me method in thearrangementofthethoughts.”Likewise, to enhance hiscommand of language,Franklin practiced, over andover again, the translation ofprose into poetry and poetryintoprose.
![Page 637: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/637.jpg)
Franklin’swittyaphorismsmake it hard to believe hewasn’ta“natural”writerfromtheverystart.Butperhapsweshould let Franklin himselfhave the last word on thematter: There are no gainswithoutpains.
But what if you’re not awriter,either?
Ifyou’reinbusiness,listento what management guruPeter Drucker said after alifetime of advising CEOs.
![Page 638: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/638.jpg)
Effective management“demandsdoingcertain—andfairly simple—things. Itconsistsofasmallnumberofpractices....”
If you’re a surgeon,considerwhatAtulGawandehas said: “People oftenassumethatyouhavetohavegreat hands to become asurgeon, but it’s not true.”What’s most important,Gawande said, is “practicing
![Page 639: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/639.jpg)
this one difficult thing dayandnightforyearsonend.”
If you want to break aworld record, as magicianDavid Blaine did when heheldhisbreathunderwaterforseventeenminutes,watch hisTED talk. At the very end,the man who can controlevery aspect of hisphysiology breaks down,sobbing:“Asamagician,Itryto show things topeople thatseemimpossible.AndI think
![Page 640: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/640.jpg)
magic, whether I’m holdingmybreathorshufflingadeckofcards,isprettysimple.It’spractice, it’s training, andit’s”—he sobs—“experimenting”—he sobsagain—“while pushingthrough the pain to be thebest that Icanbe.And that’swhatmagicistome....”
After getting to know eachother a little better, Ericsson
![Page 641: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/641.jpg)
and I designed a study todiscover how, exactly, grittykids triumph at the NationalSpellingBee.
Ialreadyknewthatgrittierspellers accumulated morepracticeandperformedbetterthan their less grittycompetitors. What I didn’tknowwaswhether deliberatepractice was driving theseskill improvements, andwhether it was grit that
![Page 642: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/642.jpg)
enabledspellerstodomoreofit.
With the help ofEricsson’sstudents,webeganby interviewing spelling beefinaliststolearnwhatsortsofthingstheydidtoprepareforcompetition. In parallel, wepored through publishedbookson the topic, includingHow to Spell Like a Champby the bee’s own nationaldirector,PaigeKimble.
![Page 643: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/643.jpg)
We learned that there arebasically three types ofactivities recommended byexperienced spellers, theirparents, and coaches: First,reading for pleasure andplaying word games likeScrabble. Second, gettingquizzedbyanotherpersonora computer program. Third,unassisted and solitaryspelling practice, includingmemorizing newwords fromthe dictionary, reviewing
![Page 644: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/644.jpg)
wordsinaspellingnotebook,and committing to memoryLatin,Greek, andotherwordorigins. Only this thirdcategory of activity met thecriteriafordeliberatepractice.
Severalmonths before thefinal competition, spellerswere mailed questionnaires.In addition to theGrit Scale,weasked themtocompletealog in which they estimatedthehoursperweektheyspentonvarious spellingactivities.
![Page 645: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/645.jpg)
We also asked them to ratehow it felt to do theseactivities—in terms ofenjoyment and effort—in themoment they were doingthem.
ThatMay,whenthefinalsaired on ESPN, AndersEricssonandIwerewatching.
Who took home thetrophy? A thirteen-year-oldgirl named Kerry Close. Itwasherfifthconsecutiveyearof competition, and from the
![Page 646: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/646.jpg)
log she completed in ourstudy, I estimate she’daccumulated at least threethousand hours of spellingpractice. Kerry’s triumphantlastwordsatthemicrophone,articulated with confidenceand a smile, were:“Ursprache.U-R-S-P-R-A-C-H-E.Ursprache.”
“I’mstudyingashardas Ican for my last year—to goforit,”Kerrytoldajournalistwho’d been tracking her
![Page 647: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/647.jpg)
preparations. “I’m trying tolearn words off the regularlist, to learn more obscurewords that have a chance ofcomingup.”Theyearbefore,the same journalist made theobservation that Kerry “doesmore word study by herself.She works with numerousspelling study guides, makeslistsofinterestingwordsfromher reading, and labors herwaythroughthedictionary.”
![Page 648: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/648.jpg)
When we analyzed ourdata,wefirstconfirmedwhatI’d found the year before:grittier spellers practicedmorethanlessgrittyspellers.But the most importantfinding was that the type ofpractice matteredtremendously. Deliberatepractice predicted advancingto further rounds in finalcompetition far better thananyotherkindofpreparation.
![Page 649: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/649.jpg)
When I share thesefindings with parents andstudents, I hasten to add thatthere are many, manylearning benefits to beingquizzed. Shining a light onwhatyouthinkyouknowbutactuallyhaven’tyetmasteredis one. Indeed, winner KerryClose later told me that sheusedquizzingtodiagnoseherweaknesses—to identifycertain words or types ofwords she consistently
![Page 650: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/650.jpg)
misspelled so that she couldfocushereffortsonmasteringthem. In a sense, quizzingmay have been a necessaryprelude to doing moretargeted, more efficient,deliberatepractice.
What about reading forfun?Nada.Prettymuchallofthe kids in the NationalSpellingBeeareinterestedinlanguage, but there wasn’teven a hint of a relationshipbetween reading for fun,
![Page 651: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/651.jpg)
which they all enjoyed, andspellingprowess.
Ifyou judgepracticebyhowmuch it improves your skill,then deliberate practice hasno rival. This lesson seemedto become increasingly cleartospellersastheyspentmoretime competing. With eachsuccessive year ofexperience, they spent moretime practicing deliberately.
![Page 652: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/652.jpg)
The same trend was evenmore pronounced in themonth before the actualfinals, when the averagespeller was devoting tenhours per week to deliberatepractice.
If, however, you judgepracticebywhat it feels like,youmightcometoadifferentconclusion. On average,spellers rated deliberatepracticeassignificantlymoreeffortful, and significantly
![Page 653: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/653.jpg)
less enjoyable, than anythingelse they did to prepare forcompetition. In contrast,spellers experienced readingbooks for pleasure andplaying word games likeScrabble as effortless and asenjoyable as “eating yourfavoritefood.”
A vivid—if somewhatmelodramatic—firsthanddescriptionofwhatdeliberatepractice can feel like comesfromdancerMarthaGraham:
![Page 654: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/654.jpg)
“Dancingappearsglamorous,easy, delightful.But the pathto the paradise of thatachievementisnoteasierthananyother.Thereisfatiguesogreatthatthebodycrieseveninitssleep.Therearetimesofcomplete frustration. Therearedailysmalldeaths.”
Not everyone woulddescribe working outsidetheir comfort zone in suchextreme terms, but Ericssongenerallyfindsthatdeliberate
![Page 655: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/655.jpg)
practice is experienced assupremely effortful. Asevidence that working at thefar edge of our skills withcomplete concentration isexhausting,hepointsoutthateven world-class performersat the peak of their careerscan only handle a maximumof one hour of deliberatepractice before needing abreak, and in total, can onlydo about three to five hoursofdeliberatepracticeperday.
![Page 656: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/656.jpg)
It’salsorelevantthatmanyathletes and musicians takenapsaftertheirmostintensivetraining sessions.Why? Restand recovery may seem anobviousnecessityforathletes.Butnonathletessaymuchthesameabouttheirmostintenseexertions,suggestingthatitisthementalwork, asmuch asthe physical stresses, thatmakes deliberate practice sostrenuous. For instance,here’s how director Judd
![Page 657: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/657.jpg)
Apatow describes making afilm: “Every day is anexperiment. Every scenemightnotworkandsoyou’reconcentrating—Is itworking?ShouldIgetanextralineforediting?WhatwouldIchangeif I had to, if I hated this inthree months, why would Ihate it? And you’reconcentrating and you’reexhausted. . . . It’s prettyintense.”
![Page 658: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/658.jpg)
And, finally, world-classperformers who retire tendnot to keep up nearly thesame deliberate practiceschedule. If practice wasintrinsically pleasurable—enjoyable for its own sake—you’d expect them to keepdoingit.
TheyearafterEricssonandIbegan working together,Mihaly CsikszentmihalyiII
![Page 659: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/659.jpg)
spent his summer at myuniversity as a scholar inresidence. Csikszentmihalyiis as eminent a psychologistas Ericsson, and both havedevoted their careers tostudying experts. But theiraccounts of world-classexpertise couldn’t be moredifferent.
For Csikszentmihalyi, thesignature experience ofexperts is flow, a state ofcomplete concentration “that
![Page 660: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/660.jpg)
leads to a feeling ofspontaneity.” Flow isperforming at high levels ofchallenge and yet feeling“effortless,” like “you don’thavetothinkabout it,you’rejustdoingit.”
For example, an orchestraconductor toldCsikszentmihalyi:
You are in an ecstaticstatetosuchapointthatyou feel as though you
![Page 661: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/661.jpg)
almost don’t exist. . . .My hand seems devoidof myself, and I havenothing to do withwhat’shappening.Ijustsit there watching in astate of awe andwonderment. And [themusic]justflowsoutbyitself.
And a competitive figureskatergavethisdescriptionoftheflowstate:
![Page 662: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/662.jpg)
Itwasjustoneof thoseprogramsthatclicked.Imean everything wentright, everything feltgood...it’sjustsucharush,likeyoucouldfeelit could go on and onand on, like you don’twant it to stop becauseit’s going so well. It’salmost as though youdon’t have to think,everything goes
![Page 663: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/663.jpg)
automatically withoutthinking....
Csikszentmihalyi hasgathered similar first-personreports from hundreds ofexperts. In every fieldstudied,optimalexperienceisdescribedinsimilarterms.
Ericsson is skeptical thatdeliberatepracticecouldeverfeel as enjoyable as flow. Inhis view, “skilled people cansometimes experience highly
![Page 664: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/664.jpg)
enjoyable states (‘flow’ asdescribed by MihalyCsikszentmihalyi, 1990)during their performance.These states are, however,incompatible with deliberatepractice. . . .”Why?Becausedeliberatepracticeiscarefullyplanned, and flow isspontaneous. Becausedeliberate practice requiresworking where challengesexceedskill,andflowismostcommonly experiencedwhen
![Page 665: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/665.jpg)
challenge and skill are inbalance. And, mostimportant, because deliberatepractice is exceptionallyeffortful, and flow is, bydefinition,effortless.
Csikszentmihalyi haspublisheda contraryopinion:“Researchers who study thedevelopment of talents haveconcluded that to learn anycomplex skill well takesabout 10,000 hours ofpractice....Andthepractice
![Page 666: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/666.jpg)
can be very boring andunpleasant.Whilethisstateofaffairsisalltoooftentrue,theconsequences are by nomeans self-evident.”Csikszentmihalyi goes on toshare a personal story thathelpsexplainhisperspective.In Hungary, where he grewup,onthetallwoodengateatthe entrance to the localelementary school, hung asign that read: The roots ofknowledge are bitter, but its
![Page 667: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/667.jpg)
fruits are sweet. This alwaysstruck him as deeply untrue:“Even when the learning ishard,” he writes, “it is notbitterwhenyoufeel that it isworth having, that you canmasterit,thatpracticingwhatyoulearnedwillexpresswhoyouareandhelpyouachievewhatyoudesire.”
Sowho’sright?
![Page 668: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/668.jpg)
As fatewouldhave it, thesame summerCsikszentmihalyi wasvisiting,Ericssonwasalso intown. I arranged for them todebate the topic of “passionandworld-classperformance”before an audience of abouteightyeducators.
Whentheysatdownatthetable in the front of thelecturehall,Irealizedthatthetwo men are near-perfectdoppelgängers. Both are tall
![Page 669: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/669.jpg)
and solidly built. Both areEuropeanbybirth,withslightaccents that somehow makethem seem even moreeminent and scholarly. Bothsport close-cropped beards,and though onlyCsikszentmihalyi’s has goneall white, either man wouldbeagoodchoiceifyouwerelooking for someone to playSantaClaus.
On thedayof thepanel, Iwas a little anxious. I don’t
![Page 670: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/670.jpg)
like conflict—evenwhen it’snotmine.
It turns out I had nothingto worry about. Theproponents of deliberatepractice versus flow behavedas perfect gentlemen. Noinsults were exchanged.There wasn’t even a hint ofdisrespect.
Instead, Ericsson andCsikszentmihalyisatshoulderto shoulder, each taking themicrophonewhenitwastheir
![Page 671: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/671.jpg)
turn, each methodicallysummarizing decades ofresearch supporting starklycontrasting perspectives.When one was speaking, theother appeared to listenintently. And then themicrophone would changehands. So it went for ninetyminutes.Doexpertssuffer,Iwanted
to know. Or are theyecstatic?
![Page 672: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/672.jpg)
Somehow, the dialogue Ihoped would resolve thisconundrumplayedoutastwoseparate presentations—oneondeliberatepracticeandtheother on flow—splicedtogether.
When it was all over, Ifound myself a littledisappointed. It wasn’t thedrama that I missed, it wasthe resolution. I still didn’thave an answer to myquestion: Is expert
![Page 673: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/673.jpg)
performance a matter ofarduous and not-so-fun-in-the-moment exertion, or canitbeeffortlessandjoyous?
For years after thatanticlimactic summit, I readand thought about the issue.Finally, because I neverdeveloped theconviction thatmight prompt me to rejectonesideandtaketheother,Idecided to collect somedata.
![Page 674: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/674.jpg)
I asked thousands of adultswho’d taken the Grit Scaleonline to take a secondquestionnaire assessing flow.Theparticipants in this studyincluded men and women ofall ages representing allmannerofprofessions:actors,bakers, bank tellers, barbers,dentists, doctors, policeofficers, secretaries, teachers,waiters, and welders . . . tonamejustafew.
![Page 675: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/675.jpg)
Across these diverseoccupations, grittier adultsreported experiencing moreflow,notless.Inotherwords,flowandgritgohandinhand.
Putting together what Ilearned from this survey, thefindingsonNationalSpellingBee finalists, and adecadelong inspection of therelevant research literature,I’ve come to the followingconclusion:Gritty people domore deliberate practice and
![Page 676: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/676.jpg)
experience more flow.There’snocontradictionhere,for two reasons. First,deliberate practice is abehavior, and flow is anexperience. Anders Ericssonis talking aboutwhat expertsdo; Mihaly Csikszentmihalyiis talking about how expertsfeel. Second, you don’t haveto be doing deliberatepractice and experiencingflow at the same time. And,in fact, I think that for most
![Page 677: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/677.jpg)
experts, they rarely gotogether.
Moreresearchisneededtosettlethequestion,andinthenext few years, I’m hopingthat Ericsson,Csikszentmihalyi, and I cancollaboratetodoexactlythat.
Currently,myviewis thatthe primary motivation fordoing effortful deliberatepractice is to improve yourskill. You’re concentratingone hundred percent, and
![Page 678: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/678.jpg)
you’ve deliberately set thelevel of challenge to exceedyour current level of skill.You’re in “problem solving”mode, analyzing everythingyoudotobringitclosertotheideal—thegoalyousetat thebeginning of the practicesession. You’re gettingfeedback, and a lot of thatfeedbackisaboutwhatyou’redoing wrong, and you’reusing that feedback to makeadjustmentsandtryagain.
![Page 679: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/679.jpg)
The motivation thatpredominates during flow, incontrast, is entirely different.Theflowstate is intrinsicallypleasurable. You don’t carewhether you’re improvingsome narrow aspect of yourskill set. And though you’reconcentrating one hundredpercent, you’re not at all in“problem solving” mode.You’re not analyzing whatyou’re doing; you’re justdoing. You’re getting
![Page 680: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/680.jpg)
feedback, but because thelevel of challenge just meetsyour current level of skill,that feedback is telling youthat you’re doing a lot right.You feel like you’re incomplete control, becauseyouare.You’refloating.Youlose trackof time.Nomatterhow fast you’re running orhow intensely you’rethinking, when you’re inflow, everything feelseffortless.
![Page 681: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/681.jpg)
In other words, deliberatepractice is for preparation,andflowisforperformance.
Let’s return to swimmerRowdyGaines.
Gaines told me he oncetabulated how much practiceit took to develop thestamina, technique,confidence, and judgment towin an Olympic goldmedal.In the eight-year periodleadinguptothe1984games,he swam, in increments of
![Page 682: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/682.jpg)
fifty-yardlaps,atleasttwentythousandmiles.Of course, ifyou add in the years beforeand after, the odometer goesevenhigher.
“I swam around theworld,”hetoldmewithasoftlaugh, “for a race that lastedforty-nineseconds.”
“Did you enjoy thosemiles?”Iasked.“Imean,didyoulovepracticing?”
“I’m not going to lie,” hereplied. “I never really
![Page 683: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/683.jpg)
enjoyedgoingtopractice,andI certainly didn’t enjoy itwhile I was there. In fact,there were brief moments,walkingtothepoolatfourorfour-thirty in themorning,orsometimes when I couldn’ttakethepain,whenI’dthink,‘God,isthisworthit?’ ”
“Sowhydidn’tyouquit?”“It’svery simple,”Rowdy
said. “It’s because I lovedswimming. . . . I had apassionforcompeting,forthe
![Page 684: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/684.jpg)
result of training, for thefeelingofbeing in shape, forwinning, for traveling, formeeting friends. I hatedpractice, but I had an overallpassionforswimming.”
Olympic gold medalistrower Mads Rasmussenoffered a similar account ofhis motivation: “It’s abouthardwork.Whenit’snotfun,you dowhat you need to doanyway. Because when youachieveresults,it’sincredibly
![Page 685: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/685.jpg)
fun. You get to enjoy the‘Aha’ at the end, and that iswhatdragsyoualongalotoftheway.”
The idea of years ofchallenge-exceeding-skillpractice leading to momentsof challenge-meeting-skillflow explains why eliteperformance can look soeffortless: in a sense, it is.Here’sanexample.Eighteen-year-old swimmer KatieLedecky recently broke her
![Page 686: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/686.jpg)
own world record in the1,500-meter freestyle.Improbably, history wasmade during a preliminaryround at a competition inKazan,Russia.“Tobehonest,it felt pretty easy,” she saidafterward.“Iwassorelaxed.”But it’s not flow to whichLedecky credits her speed:“Breaking that record istestament to thework I haveput in and the shape I am inrightnow.”
![Page 687: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/687.jpg)
Indeed, Ledecky has beenswimming since shewas six.She’s developed a reputationfor working fiercely hard atevery single practice,sometimestrainingwithmaleswimmers for addedchallenge. Three years ago,Ledecky described blankingoutalittlebitintheracethatwonherthegoldmedalintheeight-hundred-meterfreestyle.“Onethingintermsof swimming that people
![Page 688: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/688.jpg)
don’t really know,” she latersaid,“isthattheworkyouputin[during]practiceshowsoffinthemeet.”
Here’smyownstoryofhoursofeffortfuldeliberatepracticeleading to moments ofeffortless flow. A few yearsago, a producer named JulietBlake called to ask if I’d beinterested in giving a six-
![Page 689: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/689.jpg)
minute TED talk. “Sure,” Isaid.“Soundsfun!”
“Wonderful! After youhave your talk ready, we’llhave a video conferencewhere wewatch you give it,and we’ll give you somefeedback. You know,somethinglikearehearsal.”Hmmm, “feedback” you
say? Something other thanapplause? More slowly, Isaid, “Sure . . . that soundsfine.”
![Page 690: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/690.jpg)
I prepared a talk and onthe appointed day connectedwith Juliet and her boss, theleader of TED, ChrisAnderson. Staring into thewebcam, I deliveredmy talkin the allotted time. Then Iwaitedformyeffusivepraise.
If therewas any, Imissedit.
Instead, what I got wasChris telling me he’d gottenlost in all my scientificjargon. Too many syllables.
![Page 691: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/691.jpg)
Too many slides. And notenough clear, understandableexamples. Further, how I’dcome to this whole line ofresearch—my road fromteacher to psychologist—wasunclear and unsatisfying.Juliet agreed. She added thatI’d managed to tell a storywith absolutely zerosuspense. The way I’ddesigned my talk was liketelling the punch line of ajokeattheverybeginning.
![Page 692: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/692.jpg)
Ouch! That bad, huh?Juliet and Chris are busypeople,andIknewIwouldn’tgetasecondchanceatgettingcoached. So I forced myselfto listen. Afterward, Ipondered who knew betterhow to give a great talk ongrit:themorme?
It didn’t take long torealize that they were theexperiencedstorytellers,andIwas the scientistwhoneeded
![Page 693: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/693.jpg)
feedback to make her talkbetter.
So I rewrote the talk,practiced in front of myfamily,andgotmorenegativefeedback. “Why do you say‘Um’all thetime?”myolderdaughter, Amanda, asked.“Yeah, why do you do that,Mom?” my youngerdaughter, Lucy, chimed in.“Andyoubiteyour lipwhenyou’re nervous. Don’t dothat.It’sdistracting.”
![Page 694: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/694.jpg)
More practice. Morerefinements.
Then the fateful dayarrived.Igaveatalkthatboreonly a weak resemblance tothe one I’d originallyproposed.Itwasbetter.A lotbetter. Watch that talk andyou’llseemeinflow.SearchYouTube for the manyrehearsals that preceded it—or,for thatmatter,footageofanyone doing effortful,mistake-ridden, repetitive
![Page 695: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/695.jpg)
deliberate practice—and myguess is you’ll come upempty.
Nobody wants to showyou the hours and hours ofbecoming. They’d rathershow the highlight of whatthey’vebecome.
After it was all over, Irushed to meet my husbandand mother-in-law, who’dbeenintheaudiencethatdayto cheer me on. As soon asthey were within earshot, I
![Page 696: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/696.jpg)
calledoutpreemptively:“Justthe effusive praise, please!”Andtheydelivered.
Lately,I’vebeenaskinggrittyperformers and their coachesin diverse fields to elaborateon how it feels to dodeliberate practice. Manyagree with dancer MarthaGrahamthatattemptingtodowhat you cannot yet do is
![Page 697: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/697.jpg)
frustrating, uncomfortable,andevenpainful.
However, some havesuggested that, in fact, theexperience of deliberatepractice can be extremelypositive—notjustinthelong-termbut in themoment.Funisn’t quite theword they useto describe deliberatepractice, but neither isbitter.And, too, top performerspoint out that the alternativeto deliberate practice—
![Page 698: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/698.jpg)
mindlessly “going throughthe motions” withoutimprovement—canbeitsownformofsuffering.
I puzzled over theseobservations for awhile, andthenIdecidedtolookbackatthe diary data that Ericssonand I had collected from theNational Spelling Beefinalists. While I knew thatspellers rated deliberatepracticeasespeciallyeffortfuland unenjoyable, I also
![Page 699: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/699.jpg)
recalledthattherewasquiteaspreadaroundtheseaverages.In other words, not allspellers had the same exactexperience.
Ilookedtoseehowgrittiercompetitors experienceddeliberatepractice.Comparedto their less passionate, lesspersevering competitors,grittier spellers not onlylogged more hours ofdeliberatepractice,theyrateditasbothmoreenjoyableand
![Page 700: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/700.jpg)
more effortful. That’s right.Grittierkidsreportedworkingharder than other kids whendoing deliberate practice but,at the same time, said theyenjoyed it more than otherkids,too.
It’s hard to know for surewhat tomakeof this finding.Onepossibilityis thatgrittierkids spend more time doingdeliberate practice, and that,overtheyears,theydevelopataste for hard work as they
![Page 701: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/701.jpg)
experience the rewards oftheir labor.This is the “learnto love the burn” story.Alternatively, itcouldbethatgrittier kids enjoy the hardwork more, and that getsthemtodomoreofit.Thisisthe “some people enjoy achallenge”story.
I can’t tell you which ofthese accounts is accurate,and if Ihad toguess, I’dsaythere’ssometruthtoboth.Aswe’ll learn in chapter 11,
![Page 702: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/702.jpg)
there’s solid scientificevidence that the subjectiveexperience of effort—what itfeels like to work hard—canand does change when, forexample,effortisrewardedinsome way. I’ve watched myowndaughters learn toenjoyworkinghardmore than theyused to, and I can say thesameformyself.
On the other hand, KatieLedecky’s coach, Bruce
![Page 703: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/703.jpg)
Gemmell, says she’s alwaysrelishedatoughchallenge.
“There’sa littlevideoclipthat Katie’s parents have ofoneofherfirstswimmeets,”Bruce toldme. “It’s just onelap. She’s six years old. Sheswimsafewstrokesandthengrabsontothelaneline.Sheswimsafewmorestrokesandgrabs on to the lane lineagain.Finally,shegetstotheend of the pool and gets outofthewater.Dad’sfilmingit,
![Page 704: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/704.jpg)
and he asks, ‘Tell me aboutyour first race.Howwas it?’She goes, ‘Great!’ A fewsecondslater,sheadds,‘Thatwas hard!’ And she’sbeaming—asmilefromeartoear. That says it all rightthere. She has that attitudewitheverythingwedo.”
In the same conversation,Bruce told me that Katiewillingly does moredeliberate practice thananyonehe’severmet.“We’ll
![Page 705: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/705.jpg)
try a drill that she’s horribleat—something where she’llstartoffinthepoorestthirdofthe group doing it. Then I’llcatch her sneaking practicetime to get better at it, sowithin some period of time,she’s one of the best in thegroup.Someotherswimmers,well, theytryandtheyfailatit, and I have to cajole andbegthemtotryitagain.”
If deliberate practice canbe “awesome,” can it ever
![Page 706: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/706.jpg)
feellikeeffortlessflow?When I asked spelling
champ Kerry Close if she’dever experienced the state offlow during deliberatepractice, she said, “No, theonly time I could say that Iwas in flow was when Iwasn’t being challenged.”Atthe same time, she describeddeliberate practice asgratifying in its own way:“Someofmymostrewardingstudying,” she toldme, “was
![Page 707: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/707.jpg)
onmyown,forcingmyselftobreak down a big task intomultiple parts and getting itdone.”
As of now, there isn’tenough research to saywhether deliberate practicecan be experienced aseffortless flow. My guess isthatdeliberatepracticecanbedeeply gratifying, but in adifferent way than flow. Inother words, there aredifferent kinds of positive
![Page 708: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/708.jpg)
experience: the thrill ofgetting better is one, and theecstasyofperformingatyourbestisanother.
Other than getting yourself aterrific coach, mentor, orteacher, how can youget themost out of deliberatepracticeand—becauseyou’veearned it—experience moreflow?
First,knowthescience.
![Page 709: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/709.jpg)
Each of the basicrequirements of deliberatepracticeisunremarkable:
•Aclearlydefinedstretchgoal
•Fullconcentrationandeffort
•Immediateandinformativefeedback
•Repetitionwithreflectionandrefinement
But how many hours ofpractice do most people
![Page 710: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/710.jpg)
accomplish that checks allfour of these boxes? Myguessisthatmanypeoplearecruising through life doingprecisely zero hours of dailydeliberatepractice.
Even supermotivatedpeople who’re working toexhaustionmaynot bedoingdeliberate practice. Forinstance, when a Japaneserowing teaminvitedOlympicgold medalist MadsRasmussen to come visit, he
![Page 711: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/711.jpg)
was shocked at how manyhours of practice theirathleteswerelogging.It’snothours of brute-forceexhaustion you’re after, hetold them. It’s high-quality,thoughtful training goalspursued, just as Ericsson’sresearchhasshown,forjustafewhoursaday,tops.
Noa Kageyama, aperformance psychologist onthe faculty of the JuilliardSchool of Music, says he’s
![Page 712: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/712.jpg)
been playing the violin sincehe was two but didn’t reallystart practicing deliberatelyuntilhewastwenty-two.Whynot? There was no lack ofmotivation—at one point,young Noa was takinglessons with four differentteachers and, literally,commuting to three differentcities to work with them all.Really, the problemwas justthat Noa didn’t know better.Oncehediscoveredtherewas
![Page 713: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/713.jpg)
an actual science of practice—an approach that wouldimprove his skills moreefficiently—both the qualityof his practice and hissatisfactionwith his progressskyrocketed. He’s nowdevoted himself to sharingthat knowledge with othermusicians.
A few years ago, mygraduate student LaurenEskreis-Winkler and Idecided to teach kids about
![Page 714: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/714.jpg)
deliberate practice. We puttogether self-guided lessons,complete with cartoons andstories, illustrating keydifferences betweendeliberate practice and lesseffective ways of studying.We explained that no mattertheir initial talent, greatperformers in every domainimprove through deliberatepractice. We let studentsknow that hidden behindevery effortless performance
![Page 715: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/715.jpg)
on YouTube are hours andhours of unrecorded,invisible-to-outsiders,challenging, effortful,mistake-ridden practice. Wetold them that trying to dothings they can’t yet do,failing, and learning whattheyneed tododifferently isexactly the way expertspractice. We helped themunderstand that feelings offrustration aren’t necessarilya sign they’re on the wrong
![Page 716: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/716.jpg)
track. On the contrary, wetold them that wishing theydid thingsbetter isextremelycommonduring learning.Wethen tested this interventionagainst different kinds ofplacebocontrolactivities.
What we found is thatstudents can change the waythey thinkaboutpracticeandachievement. For instance,asked what advice they’dgive to another student onhow to succeed in school,
![Page 717: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/717.jpg)
students who learned aboutdeliberatepracticeweremorelikely to recommend “focuson your weaknesses” and“concentrate one hundredpercent.” Given the choicebetween doing deliberatepractice in math versusentertaining themselves withsocial media and gamingwebsites, they elected to domore deliberate practice.And, finally, in the case ofthosewho’dbeenperforming
![Page 718: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/718.jpg)
at a below-average level inclass, learning aboutdeliberate practice increasedtheirreportcardgrades.
Whichleadstomysecondsuggestion for getting themost out of deliberatepractice:Makeitahabit.
By this Imean, figureoutwhenandwhereyou’remostcomfortable doing deliberatepractice. Once you’ve madeyour selection, do deliberatepractice then and there every
![Page 719: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/719.jpg)
day. Why? Because routinesareagodsendwhen it comesto doing something hard. Amountainof research studies,including a few of my own,show that when you have ahabitofpracticingatthesametime and in the same placeeveryday,youhardlyhavetothink about getting started.Youjustdo.
ThebookDailyRitualsbyMason Currey describes adayinthelifeofonehundred
![Page 720: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/720.jpg)
sixty-one artists, scientists,and other creators. If youlookforaparticularrule,likeAlwaysdrinkcoffee,orNeverdrinkcoffee,orOnlywork inyourbedroom,orNeverworkin your bedroom, you won’tfindit.Butifinsteadyouask,“Whatdothesecreatorshavein common?” you’ll find theanswerrightinthetitle:dailyrituals.Intheirownparticularway, all the experts in thisbookconsistentlyputinhours
![Page 721: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/721.jpg)
and hours of solitarydeliberate practice. Theyfollow routines. They’recreaturesofhabit.
For instance, cartoonistCharles Schulz, who drewalmost eighteen thousandPeanuts comic strips in hiscareer, rose at dawn,showered, shaved, and hadbreakfast with his children.He then drove his kids toschoolandwenttohisstudio,where he worked through
![Page 722: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/722.jpg)
lunch(ahamsandwichandaglass of milk) until hischildren returned fromschool. Writer MayaAngelou’s routinewas to getup and have coffee with herhusband, and then, by sevenin the morning, deliverherselftoa“tinymean”hotelroom with no distractionsuntiltwointheafternoon.
Eventually, if you keeppracticing in the same timeand place, what once took
![Page 723: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/723.jpg)
conscious thought to initiatebecomesautomatic.“Thereisno more miserable humanbeing,” observed WilliamJames,thantheoneforwhom“thebeginningofeverybitofwork”mustbedecidedaneweachday.
I myself learned thatlesson quickly. I now knowwhat Joyce Carol Oatesmeant when she likenedcompletingthefirstdraftofabook to “pushing a peanut
![Page 724: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/724.jpg)
across a very dirty kitchenfloor with your nose.” Sowhat’d I do? Here’s thesimple daily plan that helpedmegetgoing:Whenit’seightinthemorningandI’minmyhome office, I will rereadyesterday’s draft. This habitdidn’t make the writingeasier, per se, but it suremadeiteasiertogetstarted.
My third suggestion forgetting the most out ofdeliberate practice is to
![Page 725: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/725.jpg)
change the way youexperienceit.
Around the time I wasrevisiting my NationalSpelling Bee data anddiscovering how much moreenjoyable the experience ofdeliberate practice is forgrittier competitors, I calledupaswimmingcoachnamedTerry Laughlin. Terry hascoached every level ofswimmer, from completenewbie to Olympic
![Page 726: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/726.jpg)
champion, and brokenrecordshimselfinopen-waterMasters swimming. I wasparticularly interested in hisperspectivebecausehe’slongadvocated what he calls a“total immersion” approachto swimming—essentially arelaxed, mindful approach toglidingthroughthewater.
“Deliberate practice canfeel wonderful,” Terry toldme.“Ifyoutry,youcanlearnto embrace challenge rather
![Page 727: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/727.jpg)
than fear it. You can do allthethingsyou’resupposedtodo during deliberate practice—a clear goal, feedback, allof it—and still feel greatwhileyou’redoingit.
“It’s all about in-the-moment self-awarenesswithout judgment,” hecontinued. “It’s aboutrelieving yourself of thejudgmentthatgetsinthewayofenjoyingthechallenge.”
![Page 728: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/728.jpg)
After hanging up withTerry, I began to think aboutthe fact that infants andtoddlers spend most of theirtime trying to do things theycan’t, again and again—andyet they don’t seemespecially embarrassed oranxious.Nopain,nogainisarule that doesn’t seem toapplytothepreschoolset.
Elena Bodrova andDeborah Leong,psychologists who’ve
![Page 729: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/729.jpg)
devoted their careers tostudying how children learn,agree that learning frommistakes is something babiesandtoddlersdon’tmindatall.Watch a baby struggle to situp,oratoddlerlearntowalk:you’ll see one error afteranother,failureafterfailure,alot of challenge exceedingskill,alotofconcentration,alot of feedback, a lot oflearning. Emotionally? Well,they’re tooyoung to ask,but
![Page 730: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/730.jpg)
very young children don’tseem tortured while they’retrying todo things theycan’tyetdo.
And then . . . somethingchanges. According to ElenaandDeborah,aroundthetimechildren enter kindergarten,theybegintonoticethattheirmistakes inspire certainreactionsingrown-ups.Whatdo we do? We frown. Ourcheeks flush a bit. We rushovertoourlittleonestopoint
![Page 731: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/731.jpg)
out that they’ve donesomething wrong. Andwhat’s the lesson we’reteaching? Embarrassment.Fear. Shame. Coach BruceGemmell says that’s exactlywhathappens tomanyofhisswimmers:“Betweencoachesand parents and friends andthe media, they’ve learnedthat failing is bad, so theyprotect themselvesandwon’tstick their neck out and givetheirbesteffort.”
![Page 732: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/732.jpg)
“Shame doesn’t help youfix anything,” Deborah toldme.
Sowhat’stobedone?Elena and Deborah ask
teachers to model emotion-free mistake making. Theyactually instruct teachers tocommit an error on purposeandthenletstudentsseethemsay,witha smile, “Oh,gosh,I thought there were fiveblocks in this pile! Let mecountagain!One...two...
![Page 733: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/733.jpg)
three...four...five...six!Therearesixblocks!Great!Ilearned I need to touch eachblockasIcount!”
Whether you can makedeliberate practice as ecstaticas flow, I don’t know, but Idothinkyoucantrysayingtoyourself,andtoothers,“Thatwashard!Itwasgreat!”
I. This means swimming onehundredmeters inoneminute and
![Page 734: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/734.jpg)
fifteen seconds, and then trying todo the same in one minute andfourteenseconds,andsoon.
II. Pronounced cheeks-sent-me-high. And for years, Mihaly hasgoneby“Mike.”
![Page 735: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/735.jpg)
Chapter8
PURPOSE
Interest is one source ofpassion. Purpose—theintention to contribute to thewell-being of others—is
![Page 736: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/736.jpg)
another.Thematurepassionsof gritty people depend onboth.
For some, purpose comesfirst. This is the only way Ican understand a paragon ofgrit like Alex Scott. Eversince Alex could remember,she’d been sick. Herneuroblastoma had beendiagnosed when she was ayear old. Shortly after herfourthbirthday,Alextoldhermother, “When I get out of
![Page 737: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/737.jpg)
thehospital,Iwant tohavealemonade stand.” And shedid. She operated her firstlemonade stand before sheturned five, raising twothousand dollars for herdoctors to “help other kids,like they helped me.” WhenAlex passed away four yearslater, she’d inspired somanypeople to create their ownlemonade stands that she’draised more than a milliondollars. Alex’s family has
![Page 738: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/738.jpg)
continued her legacy, and todate,Alex’sLemonadeStandFoundation has raised morethan one hundred milliondollarsforcancerresearch.
Alex was extraordinary.Butmostpeoplefirstbecomeattracted to things theyenjoyandonlylaterappreciatehowthesepersonalinterestsmightalso benefit others. In otherwords, the more commonsequenceistostartoutwitharelatively self-oriented
![Page 739: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/739.jpg)
interest, then learn self-disciplined practice, and,finally, integrate that workwith an other-centeredpurpose.
The psychologistBenjaminBloomwas amongthe first to notice this three-phaseprogression.
Thirty years ago, whenBloom set out to interviewworld-class athletes, artists,mathematicians, andscientists,heknewhe’dlearn
![Page 740: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/740.jpg)
something about how peoplereach the top of their fields.What he didn’t foresee wasthat he’d discover a generalmodeloflearningthatappliedto all the fields he studied.Despite superficialdifferences in theirupbringing and training, allthe extraordinary people inBloom’s study hadprogressed through threedistinct periods ofdevelopment. We discussed
![Page 741: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/741.jpg)
whatBloomcalledthe“earlyyears”inchapter6oninterestand “the middle years” inchapter 7 on practice.We’venow come to the third, final,andlongestphaseinBloom’smodel—the “later years”—when,asheputit,“thelargerpurpose and meaning” ofwork finally becomesapparent.
![Page 742: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/742.jpg)
When I talk togrit paragons,and they tell me that whatthey’repursuinghaspurpose,they mean something muchdeeper than mere intention.They’re not just goal-oriented; the nature of theirgoalsisspecial.
When I probe, asking,“Canyoutellmemore?Whatdo you mean?” theresometimesfollowsanearnest,stumblingstruggletoputhowthey feel into words. But
![Page 743: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/743.jpg)
always—always—those nextsentences mention otherpeople. Sometimes it’s veryparticular (“my children,”“my clients,” “my students”)and sometimes quite abstract(“this country,” “the sport,”“science,” “society”).However they say it, themessageisthesame:thelongdaysandeveningsoftoil,thesetbacksanddisappointmentsand struggle, the sacrifice—all this is worth it because,
![Page 744: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/744.jpg)
ultimately, their efforts paydividendstootherpeople.
At its core, the idea ofpurpose is the idea thatwhatwedomatterstopeopleotherthanourselves.
A precocious altruist likeAlex Scott is an easy-to-fathom example of other-centeredpurpose.
So is art activist JaneGolden, the grit paragon wemet in chapter 6. Interest inart led Jane to become a
![Page 745: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/745.jpg)
muralist inLosAngelesaftergraduating from college. Inher late twenties, Jane wasdiagnosedwithlupusandtoldshe didn’t have long to live.“The news came as such ashock,”she toldme.“Itgaveme a new perspective onlife.” When Jane recoveredfromthedisease’smostacutesymptoms, she realized shewould outlive the doctors’initial predictions, but withchronicpain.
![Page 746: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/746.jpg)
Moving back to herhometown of Philadelphia,she took over a small anti-graffiti program in themayor’s office and, over thenext three decades, grew itintooneof the largest publicartprogramsintheworld.
Now in her late fifties,Jane continues to work fromearly morning to late in theevening, six or seven days aweek. One colleague likensworkingwithhertorunninga
![Page 747: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/747.jpg)
campaign office the nightbefore an election—exceptElection Day never comes.For Jane, those hourstranslate into more muralsandprograms,andthatmeansmoreopportunitiesforpeoplein the community to createandexperienceart.
When I asked Jane abouther lupus, she admitted,matter-of-factly,thatpainisaconstant companion. Sheoncetoldajournalist:“There
![Page 748: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/748.jpg)
are moments when I cry. Ithink I just can’t do itanymore, push that boulderup the hill. But feeling sorryfor myself is pointless, so Ifind ways to get energized.”Why? Because her work isinteresting? That’s only thebeginning of Jane’smotivation. “Everything I dois in a spirit of service,” shetoldme. “I feel driven by it.It’s a moral imperative.”
![Page 749: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/749.jpg)
Putting it more succinctly,shesaid:“Artsaveslives.”
Other grit paragons havetop-level goals that arepurposeful in less obviousways.
Renowned wine criticAntonioGalloni,forinstance,toldme:“Anappreciationforwine is something I’mpassionateaboutsharingwithother people. When I walkintoarestaurant,Iwanttosee
![Page 750: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/750.jpg)
a beautiful bottle of wine oneverytable.”
Antonio says his missionis“tohelppeopleunderstandtheirownpalates.”Whenthathappens, he says, it’s like alightbulb goes off, and hewants “to make a millionlightbulbsgooff.”
So, while interest forAntonio came first—hisparents owned a food andwine shop while he wasgrowing up, and he “was
![Page 751: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/751.jpg)
always fascinated by wine,even at a young age”—hispassion is very muchenhanced by the idea ofhelping other people: “I’mnot a brain surgeon, I’m notcuringcancer.Butinthisonesmallway, I think I’mgoingto make the world better. Iwake up everymorningwithasenseofpurpose.”
In my “grit lexicon,”therefore,purposemeans“the
![Page 752: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/752.jpg)
intention to contribute to thewell-beingofothers.”
After hearing, repeatedly,from grit paragons howdeeply connected they felttheir work was to otherpeople, I decided to analyzethatconnectionmoreclosely.Sure, purpose might matter,buthowmuchdoes itmatter,relative to other priorities? Itseemed possible that single-
![Page 753: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/753.jpg)
minded focus on a top-levelgoalis,infact,typicallymoreselfishthanselfless.
Aristotle was among thefirst to recognize that thereare at least two ways topursue happiness. He calledone “eudaimonic”—inharmony with one’s good(eu) inner spirit (daemon)—and the other “hedonic”—aimed at positive, in-the-moment, inherently self-centered experiences.
![Page 754: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/754.jpg)
Aristotle clearly took a sideon the issue, deeming thehedonic life primitive andvulgar, and upholding theeudaimonic life as noble andpure.
But, in fact, both of thesetwo approaches to happinesshave very deep evolutionaryroots.
On one hand, humanbeingsseekpleasurebecause,by and large, the things thatbring us pleasure are those
![Page 755: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/755.jpg)
that increase our chances ofsurvival. If our ancestorshadn’t craved food and sex,for example, they wouldn’thave lived very long or hadmany offspring. To someextent,allofusare,asFreudputit,drivenbythe“pleasureprinciple.”
On theotherhand,humanbeings have evolved to seekmeaning and purpose. In themost profound way, we’resocial creatures. Why?
![Page 756: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/756.jpg)
Because the drive to connectwith and serve others alsopromotes survival. How?Because people whocooperate are more likely tosurvive than loners. Societydepends on stableinterpersonal relationships,and society in somanywayskeepsusfed,sheltersusfromthe elements, and protects usfrom enemies. The desire toconnect is as basic a human
![Page 757: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/757.jpg)
need as our appetite forpleasure.
To some extent, we’re allhardwired to pursue bothhedonic and eudaimonichappiness. But the relativeweight we give these twokinds of pursuits can vary.Some of us care aboutpurpose much more than wecare about pleasure, andviceversa.
To probe the motivationsthat underlie grit, I recruited
![Page 758: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/758.jpg)
sixteen thousand Americanadults and asked them tocomplete the Grit Scale. Aspart of a long supplementaryquestionnaire, studyparticipants read statementsabout purpose—for instance,“What I do matters tosociety”—and indicated theextent to which each appliedto them. They did the samefor six statements about theimportance of pleasure—forinstance, “For me, the good
![Page 759: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/759.jpg)
life is the pleasurable life.”From these responses, wegenerated scores rangingfrom 1 to 5 for theirorientations to purpose andpleasure,respectively.
Below, I’ve plotted thedata from this large-scalestudy.As you can see, grittypeople aren’tmonks, nor arethey hedonists. In terms ofpleasure-seeking, they’re justlike anyone else; pleasure ismoderately important no
![Page 760: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/760.jpg)
matterhowgrittyyouare. Insharp contrast, you can seethat grittier people aredramatically more motivatedthan others to seek ameaningful, other-centeredlife.Higherscoresonpurposecorrelate with higher scoresontheGritScale.
![Page 761: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/761.jpg)
This is not to say that allgrit paragons are saints, butrather,thatmostgrittypeoplesee their ultimate aims asdeeplyconnectedtotheworldbeyondthemselves.
![Page 762: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/762.jpg)
My claim here is that, formost people, purpose is atremendously powerfulsource of motivation. Theremay be exceptions, but therarity of these exceptionsprovestherule.
WhatamImissing?Well, it’sunlikelythatmy
sample included manyterroristsorserialkillers.Andit’s true that I haven’t
![Page 763: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/763.jpg)
interviewed political despotsorMafia bosses. I guess youcould argue that I’moverlooking a wholepopulation of grit paragonswhosegoalsarepurelyselfishor,worse,directedatharmingothers.
On this point, I concede.Partly.Intheory,youcanbeamisanthropic, misguidedparagonofgrit.JosephStalinandAdolfHitler,forinstance,were most certainly gritty.
![Page 764: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/764.jpg)
Theyalsoprove that the ideaof purpose can be perverted.How many millions ofinnocent people haveperished at the hands ofdemagogues whose statedintentionwastocontributetothewell-beingofothers?
In other words, agenuinely positive, altruisticpurpose is not an absoluterequirement of grit. And Ihave to admit that, yes, it ispossibletobeagrittyvillain.
![Page 765: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/765.jpg)
But, on the whole, I takethesurveydataI’vegathered,andwhatparagonsofgrittellme in person, at face value.So,whileinterestiscrucialtosustaining passion over thelong-term, so, too, is thedesire to connect with andhelpothers.
My guess is that, if youtake a moment to reflect onthe times in your life whenyou’ve really been at yourbest—when you’ve risen to
![Page 766: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/766.jpg)
the challenges before you,finding strength to do whatmight have seemedimpossible—you’ll realizethat the goals you achievedwereconnectedinsomeway,shape, or form to the benefitofotherpeople.
Insum,theremaybegrittyvillains in theworld, butmyresearch suggests there aremanymoregrittyheroes.
![Page 767: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/767.jpg)
Fortunate indeed are thosewhohave a top-levelgoal soconsequential to the worldthatitimbueseverythingtheydo, no matter how small ortedious, with significance.Consider the parable of thebricklayers:
Three bricklayers areasked:“Whatareyoudoing?”
Thefirstsays,“Iamlayingbricks.”
The second says, “I ambuildingachurch.”
![Page 768: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/768.jpg)
And the third says, “I ambuildingthehouseofGod.”
The first bricklayer has ajob.Thesecondhasacareer.Thethirdhasacalling.
Many of us would like tobe like the third bricklayer,but instead identify with thefirstorsecond.
Yale managementprofessorAmyWrzesniewskihasfoundthatpeoplehavenotroubleatalltellingherwhichof the three bricklayers they
![Page 769: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/769.jpg)
identify with. In about equalnumbers, workers identifythemselvesashaving:
ajob(“Iviewmyjobasjust a necessity oflife, much likebreathing orsleeping”),
a career (“I view myjob primarily as astepping-stone tootherjobs”),or
![Page 770: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/770.jpg)
a calling (“Mywork isone of the mostimportant things inmylife”).
UsingAmy’smeasures, I,too, have found that only aminority ofworkers considertheir occupations a calling.Not surprisingly, those whodo are significantly grittierthanthosewhofeelthat“job”or “career” more aptlydescribestheirwork.
![Page 771: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/771.jpg)
Those fortunate peoplewho do see their work as acalling—as opposed to a joboracareer—reliablysay“mywork makes the world abetter place.” And it’s thesepeople who seem mostsatisfied with their jobs andtheir lives overall. In onestudy, adults who felt theirworkwasacallingmissedatleast a third fewer days ofworkthanthosewithajoboracareer.
![Page 772: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/772.jpg)
Likewise, a recent surveyof 982 zookeepers—whobelong to a profession inwhich 80 percent of workershave college degrees and yeton average earn a salary of$25,000—found that thosewhoidentifiedtheirworkasacalling (“Working withanimals feels likemy callinginlife”)alsoexpressedadeepsense of purpose (“Theworkthat I do makes the world abetter place”). Zookeepers
![Page 773: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/773.jpg)
withacallingwerealsomorewilling to sacrifice unpaidtime, after hours, to care forsick animals. And it waszookeepers with a callingwho expressed a sense ofmoral duty (“I have a moralobligationtogivemyanimalsthebestpossiblecare”).
I’ll point out the obvious:there’snothing“wrong”withhaving no professional
![Page 774: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/774.jpg)
ambition other than to makeanhonest living.Butmostofusyearnformuchmore.Thiswas the conclusion ofjournalist Studs Terkel, whoin the 1970s interviewedmorethanahundredworkingadults in all sorts ofprofessions.
Not surprisingly, Terkelfound that only a smallminorityofworkersidentifiedtheirworkasacalling.Butitwasn’t for lack of wanting.
![Page 775: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/775.jpg)
All of us, Terkel concluded,are looking for “dailymeaning as well as dailybread . . . for a sort of liferatherthanaMondaythroughFridaysortofdying.”
The despair of spendingthe majority of our wakinghours doing something thatlacks purpose is vividlyembodiedinthestoryofNoraWatson, a twenty-eight-year-old staff writer for aninstitution publishing health-
![Page 776: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/776.jpg)
careinformation:“Mostofusarelookingforacalling,notajob,” she told Terkel.“There’s nothing I wouldenjoy more than a job thatwassomeaningfultomethatI brought it home.”And yet,she admitted to doing abouttwohoursof realworkadayand spending the rest of thetimepretendingtowork.“I’mthe only person in thewholedamn building with a deskfacing thewindow insteadof
![Page 777: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/777.jpg)
the door. I just turn myselfaroundfromallthatIcan.
“I don’t think I have acalling—at this moment—except to be me,” Nora saidtoward the end of herinterview. “But nobody paysyou for being you, so I’m atthe Institution—for themoment....”
In the course of hisresearch, Terkel did meet a“happyfewwhofindasavorin their daily job.” From an
![Page 778: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/778.jpg)
outsider’s point of view,those with a calling didn’talways labor in professionsmore conducive to purposethan Nora. One was astonemason, another abookbinder. A fifty-eight-year-old garbage collectornamed Roy Schmidt toldTerkel that his job wasexhausting, dirty, anddangerous. He knew mostother occupations, includinghispreviousofficejob,would
![Page 779: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/779.jpg)
beconsideredmoreattractiveto most people. And yet, hesaid: “I don’t look down onmy job in any way. . . . It’smeaningfultosociety.”
Contrast Nora’s closingwords with the ending ofRoy’sinterview:“Iwastoldastory one time by a doctor.Years ago, in France . . . ifyoudidn’tstandinfavorwiththeking, they’dgiveyou thelowest job, of cleaning thestreets of Paris—which must
![Page 780: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/780.jpg)
have been a mess in thosedays. One lord goofed upsomewherealong the line, sothey put him in charge of it.Andhedidsuchawonderfuljob that he was commendedfor it. The worst job in theFrench kingdom and he waspatted on the back for whathe did. That was the firststory I ever heard aboutgarbagewhereitreallymeantsomething.”
![Page 781: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/781.jpg)
In the parable of thebricklayers, everyone has thesame occupation, but theirsubjective experience—howthey themselves viewed theirwork—couldn’t be moredifferent.
Likewise, Amy’s researchsuggests that callings havelittle to do with formal jobdescriptions. In fact, shebelieves that just about anyoccupation can be a job,career, or calling. For
![Page 782: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/782.jpg)
instance, when she studiedsecretaries, she initiallyexpectedveryfewtoidentifytheirworkasacalling.Whenher data came back, shefound that secretariesidentified themselves ashaving a job, career, orcalling in equal numbers—just about the sameproportion she’d identified inothersamples.
Amy’s conclusion is thatit’s not that some kinds of
![Page 783: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/783.jpg)
occupations are necessarilyjobs and others are careersand still others are callings.Instead, what matters iswhether thepersondoing thework believes that layingdown the next brick is justsomething that has to bedone, or instead somethingthat will lead to furtherpersonal success, or, finally,work that connects theindividual to something fargreaterthantheself.
![Page 784: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/784.jpg)
Iagree.Howyouseeyourwork is more important thanyourjobtitle.
And this means that youcan go from job to career tocalling—allwithoutchangingyouroccupation.
“Whatdoyoutellpeople,”I recentlyaskedAmy,“whentheyaskyouforadvice?”
“A lot of people assumethat what they need to do isfindtheircalling,”shesaid.“Ithink a lot of anxiety comes
![Page 785: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/785.jpg)
fromtheassumptionthatyourcallingislikeamagicalentitythat exists in the world,waitingtobediscovered.”
That’s also how peoplemistakenly think aboutinterests, I pointed out. Theydon’t realize they need toplay an active role indeveloping and deepeningtheirinterests.
“A calling is not somefully formed thing that youfind,” she tells advice
![Page 786: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/786.jpg)
seekers. “It’s much moredynamic.Whateveryoudo—whether you’re a janitor orthe CEO—you cancontinually look at what youdoandaskhowitconnectstootherpeople,howitconnectsto the bigger picture, how itcanbe an expressionofyourdeepestvalues.”
In other words, abricklayerwhooneday says,“Iamlayingbricks”mightatsome point become the
![Page 787: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/787.jpg)
bricklayer who recognizes “Iam building the house ofGod.”
Amy’s observation that thesame individual in the sameoccupation can at differenttimes think of it as a job,career, or calling brought tomindJoeLeader.
Joe is a senior vicepresident at NYC Transit.Basically,he’stheNewYork
![Page 788: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/788.jpg)
City subway’s lead engineer.It’s a task of almostunimaginable proportions.Annually, more than 1.7billion trips are taken on thecity’ssubways,making it thebusiest subwaysystem in theUnited States. There are 469stations.Laidend toend, thetracks for the subwaysystemwould reach all the way toChicago.
As a young man, Leaderwasn’t looking for a calling.
![Page 789: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/789.jpg)
He was looking to pay backstudentloans.
“When I was coming outof college,” he toldme, “mybiggest concern was justgettingajob.Anyjob.Transitcametoourcampustorecruitengineers,andIgothired.”
As an intern, Leader wasassigned to work on thetracks.“Ithrewinrails,Iwaspullingties,Iwasdoingcableworkforthethirdrail.”
![Page 790: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/790.jpg)
Not everyone would findthatwork interesting,but Joedid.“Itwasfun.WhenIwasfirst on the job, and all mybuddies were business orcomputerguys,weusedtogoout, and on the way homefrom thebars in the evening,theyusedtorunupanddowna platform and say, ‘Joe,what’s this, what’s this?’ Iused to tell them: that’s athird-rail insulator, that’s aninsulatedjoint.Tome, itwas
![Page 791: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/791.jpg)
fun.”So,interestwastheseedof
hispassion.Joesoonendedupdoinga
lot of planning work, whichhe also enjoyed. As hisinterests and expertisedeepened, and he started todistinguishhimself, hebegantoseetransitengineeringasalong-term career. “On mydays off, Iwent down to thelaundromattodothelaundry.Youknowthosebigtablesfor
![Page 792: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/792.jpg)
folding your clothes? Well,all the women used to laughbecause I’d bring myengineeringdrawingsand laythemoutandworkonthem.Ireally fell in love with thatpartofthejob.”
Withinayear, Joe saidhebegan to look at his workdifferently. Sometimes, he’dlook at a bolt or rivet andrealize that some fellow hadput that in decades ago, andhere it was, still in the same
![Page 793: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/793.jpg)
place, still making the trainsrun,stillhelpingpeopletogetwheretheyneededtobe.
“Ibegantofeel likeIwasmaking a contribution tosociety,” he told me. “Iunderstood Iwas responsiblefor moving people everysingle day. And when Ibecame a project manager, Iwouldwalk away from thesebig installation jobs—youknow, a hundred panels or awhole interlocking [of
![Page 794: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/794.jpg)
signals]—and I knew thatwhatwe’ddonewasgoingtolastforthirtyyears.Thatwaswhen I felt I had a vocation,orIwouldsay,acalling.”
TohearJoeLeadertalkabouthis work might make youwonder if,afterayearofnotfinding your work to be acalling, you should give uphope. Among her MBAstudents, AmyWrzesniewski
![Page 795: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/795.jpg)
findsthatmanygivetheirjobonlyacoupleofyearsbeforeconcluding that it couldn’tpossibly be their life’spassion.
It may comfort you toknow that it took MichaelBaimemuchlonger.
Baime is a professor ofinternal medicine at theUniversity of Pennsylvania.Youmightthinkhiscallingisto heal and to teach. That’sonly partly right. Michael’s
![Page 796: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/796.jpg)
passion iswell-being throughmindfulness. It took himyearstointegratehispersonalinterest in mindfulness withtheother-centeredpurposeofhelpingpeopleleadhealthier,happier lives. Only wheninterest and purpose meldeddidhefeel likehewasdoingwhat he’d been put on thisplanettodo.
I asked Michael how hegotinterestedinmindfulness,and he took me all the way
![Page 797: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/797.jpg)
back to his boyhood. “I waslookingupatthesky,”hetoldme. “And the strangest thinghappened. I felt like I wasactually getting lost in thesky. I felt it as a sort ofopening,likeIwasbecomingmuch larger. Itwas themostwonderful experience I’veeverhad.”
Later, Michael found thathecouldmakethesamethinghappen just by payingattentiontohisownthoughts.
![Page 798: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/798.jpg)
“I becameobsessed,” he toldme. “I didn’t know what tocall it, but I would do it allthetime.”
Several years later,Michael was browsing in abookstore with his motherwhen he came upon a bookthat described his experienceexactly. The book was byAlan Watts, a Britishphilosopherwhowrote aboutmeditation for Western
![Page 799: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/799.jpg)
audiences long before itbecamefashionable.
With his parents’encouragement,Michaeltookclasses in meditationthroughout high school andcollege. As graduationapproached,hehad to decidewhattodonext.Professionalmeditator was not an actualfull-time occupation. Hedecidedtobecomeadoctor.
Severalyears intomedicalschool,Michael confessed to
![Page 800: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/800.jpg)
one of his meditationteachers, “This isn’t reallywhat Iwant to do.This isn’tright for me.” Medicine wasimportant,butitdidn’tmatchup with his deepest personalinterests. “Stay,” said theteacher. “You’ll help morepeople if you become adoctor.”
Michaelstayed.After finishing his
coursework,Michael says, “Ididn’t really know what I
![Page 801: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/801.jpg)
wanted to do. To kind oftread water, I just signed upfor the first year ofinternship.”
Tohissurprise,heenjoyedpracticingmedicine.“Itwasafine way to be helpful topeople.Itwasn’tlikemedicalschool, which isn’t so muchabout helping people ascutting apart cadavers andmemorizingtheKrebscycle.”Rapidly, he progressed frominterntofellowtorunningthe
![Page 802: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/802.jpg)
medical clinic to becomingthe assistant director ofresidency and, finally, chiefofgeneralinternalmedicine.
Still, medicine wasn’tquite what Michael wouldconsideracalling.
“As I practiced, I realizedthat the thing many of mypatients really neededwasn’tanotherprescriptionorX-ray,but actually what I’d beendoingformyselfsinceIwasakid. What many patients
![Page 803: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/803.jpg)
needed was to stop andbreathe and fully connectwiththeirlivedexperience.”
That realization ledMichael to create ameditation class for patientswith serious healthconditions.Thatwasin1992.Sincethen,he’sexpandedtheprogram and, just this year,taken it on as a full-timeoccupation. To date, aboutfifteen thousand patients,
![Page 804: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/804.jpg)
nurses, and physicians havebeentrained.
Recently, I askedMichaelto give a lecture onmindfulness for localschoolteachers.Onthedayofhis talk,he steppedup to thepodiumandlookedintentlyathisaudience.Onebyone,hemade eye contact with eachof the seventy educatorswho’dgivenup theirSundayafternoontohearwhathehad
![Page 805: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/805.jpg)
to say. There was a longpause.
And then, with a smile Ican only describe as radiant,hebegan:“Ihaveacalling.”
Iwastwenty-onewhenIfirstexperienced the power of apurposefultop-levelgoal.
In the springofmy junioryear incollege, Iwent to thecareer services center to findsomethingtodothatsummer.
![Page 806: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/806.jpg)
Turning the pages of anenormous three-ring binderlabeled SUMMER PUBLICSERVICE, I came across aprogram calledSummerbridge. The programwas looking for collegestudents to design and teachsummer enrichment classesfor middle school studentsfrom disadvantagedbackgrounds.Teaching kids for a
summer sounds like a good
![Page 807: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/807.jpg)
idea, I thought. Icould teachbiology and ecology. I’llshow them how to make asolar oven out of tinfoil andcardboard. We’ll roast hotdogs.It’llbefun.
I didn’t think, Thisexperienceisgoingtochangeeverything.
Ididn’tthink,Sure,you’repremednow,butnotforlong.
I didn’t think, Hold ontight—you’re about to
![Page 808: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/808.jpg)
discover the power ofpurpose.
To be honest, I can’t tellyoumuchaboutthatsummer.The details escape me. I doknow I woke long beforedawn each day, includingweekends, to prepare formyclasses. I do know I workedlong into the night. Iremember specific kids, andcertain moments. But itwasn’t until I returned homeand had a moment to reflect
![Page 809: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/809.jpg)
that I realized what hadhappened. I’d glimpsed thepossibility that a child’sconnectionwithateachercanbelife-changing—forboth.
WhenIreturnedtocampusthat fall, I sought out otherstudents who’d taught atSummerbridge programs.One of these students, PhilipKing,happenedtoliveinthesamedorm.Likeme,hefeltapalpable urgency to startanother Summerbridge
![Page 810: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/810.jpg)
program. The idea was toocompelling. We couldn’t nottry.
Wehadnomoney,noideahow to start a nonprofit, noconnections,and, inmycase,nothing but skepticism andworryfromparentsconvincedthis was a catastrophicallystupid way to use a Harvardeducation.
Philip and I had nothingand,yet,wehadexactlywhatweneeded.Wehadpurpose.
![Page 811: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/811.jpg)
Asanyonewhohasstartedan organization from scratchcan tell you, there are amillion tasks, big and small,andnoinstructionmanualforany of them. If Philip and Iwere doing something thatwas merely interesting, wecouldn’t have done it at all.But because creating thisprogramwas in ourminds—and in our hearts—sooverwhelmingly importantforkids, itgaveusacourage
![Page 812: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/812.jpg)
and energy neither of us hadeverknownbefore.
Because we weren’tasking for ourselves, Philipand I found the gumption toknock on the doors of justabout every small businessand restaurant in Cambridge,asking for donations. Wefound the patience to sit incountless waiting rooms ofpowers-that-be. We waitedandwaited, sometimes hourson end, until these authority
![Page 813: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/813.jpg)
figures had time to see us.Then we found thestubbornness to keep askingand asking until we securedwhatweneeded.
And so it went foreverything we had to do—because we weren’t doing itfor ourselves,weweredoingitforagreatercause.
Two weeks after Philipand I graduated, we openedthe doors to the program.That summer, seven high
![Page 814: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/814.jpg)
school and college studentsdiscoveredwhatitwasliketobe a teacher. Thirty fifth-grade boys and girlsdiscoveredwhatitwasliketospend their summer vacationlearning, studying, workinghard, and—though it mayhave seemed impossiblebefore they actually did it—having fun at the sametime.
Thatwasmorethantwentyyears ago. Now called
![Page 815: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/815.jpg)
BreakthroughGreaterBoston,the program has grown farbeyond what Philip and Icould have imagined,providing tuition-free, year-round academic enrichmentfor hundreds of studentsevery year. To date, morethan a thousand young menandwomenhavetaughtintheprogram,manyofwhomhavegone on to pursue full-timecareersineducation.
![Page 816: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/816.jpg)
Summerbridge led me topursueteaching.Teachingledme to an enduring interest inhelping children do so muchmore with their lives thanthey might ever dreampossible.
Andyet...For me, teaching wasn’t
enough. Still unfulfilled wasthelittlegirlinmewholovedscience, who was fascinatedbyhumannature,who,whenshe was sixteen and had a
![Page 817: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/817.jpg)
chance to take a summerenrichment class, picked—ofall the courses in the catalog—psychology.
Writing this book mademe realize that I’m someonewhohadaninklingaboutmyinterests in adolescence, thensomeclarityaboutpurposeinmy twenties, and finally, inmy thirties, the experienceand expertise to say that mytop-level,life-organizinggoalis, and will be until my last
![Page 818: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/818.jpg)
breath: Use psychologicalsciencetohelpkidsthrive.
One reason my dad was soupset about Summerbridge isthathelovesme.HethoughtIwould sacrifice my welfarefor the well-being of otherpeople who, frankly, hedidn’t love as much as hisowndaughter.
Indeed, the concepts ofgrit and purpose might, in
![Page 819: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/819.jpg)
principle, seem to conflict.How is it possible to staynarrowly focused on yourowntop-levelgoalwhilealsohaving the peripheral visionto worry about anyone else?If grit is about having apyramid of goals that allserve a single personalobjective, how do otherpeoplefitintothepicture?
“Most people think self-oriented and other-orientedmotivationsareoppositeends
![Page 820: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/820.jpg)
of a continuum,” says mycolleague and Whartonprofessor AdamGrant. “Yet,I’ve consistently found thatthey’re completelyindependent. You can haveneither, and you can haveboth.” In other words, youcanwanttobeatopdogand,atthesametime,bedriventohelpothers.
Adam’s researchdemonstrates that leadersandemployees who keep both
![Page 821: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/821.jpg)
personal and prosocialinterests inminddobetter inthe long run than those whoare 100 percent selfishlymotivated.
For instance, Adam onceasked municipal firefighters,“Why are you motivated todo your work?” He thentracked their overtime hoursover the next two months,expecting firefighters whoweremoremotivated to helpothers to demonstrate the
![Page 822: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/822.jpg)
greatest grit. But many ofthosewhoweredriventohelpothersworkedfewerovertimehours.Why?
A second motivation wasmissing: interest in the workitself. Only when theyenjoyed the work did thedesire tohelpothers result inmore effort. In fact,firefighters who expressedprosocialmotives(“BecauseIwant to help others throughmy work”) and intrinsic
![Page 823: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/823.jpg)
interest in their work(“Because I enjoy it”)averaged more than 50percent more overtime perweekthanothers.
When Adam asked thesame question—“Why areyou motivated to do yourwork?”—of 140 fund-raisersat a call center for a publicuniversity, he found nearlyidentical results. Only thefund-raisers who expressedstronger prosocial motives
![Page 824: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/824.jpg)
and who found the workintrinsically engaging mademorecallsand,inturn,raisedmore money for theuniversity.
Developmentalpsychologists David Yeagerand Matt Bundick find thesame pattern of results inadolescents. For example, inonestudy,David interviewedabout a hundred adolescents,asking them to tell him, intheir own words, what they
![Page 825: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/825.jpg)
wantedtobewhentheygrewup,andwhy.
Some talked about theirfuture in purely self-orientedterms(“Iwanttobeafashiondesigner because it’s a funthing to do. . . . What’simportant . . . is that youreallyenjoy[yourcareer]”).
Others only mentionedother-oriented motives (“Iwanttobeadoctor.Iwanttohelppeopleout...”).
![Page 826: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/826.jpg)
And, finally, someadolescents mentioned bothself- and other-orientedmotives: “If I was a marinebiologist, I would push [to]keep everything clean. . . . Iwould pick a certain placeand go help that place out,like the fish andeverything. . . . I’ve alwaysloved having fish tanks andfishbecausetheygettoswimand it’s, like, free. It’s likeflying underwater or
![Page 827: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/827.jpg)
something.”Two years later, young
peoplewho’dmentionedbothself- and other-orientedmotives rated theirschoolwork as morepersonally meaningful thanclassmates who’d namedeithermotivealone.
FormanyofthegritparagonsI’veinterviewed,theroadtoa
![Page 828: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/828.jpg)
purposeful, interestingpassionwasunpredictable.
Aurora and Franco Fonteare Australian entrepreneurswhose facilities servicescompany has 2,500employees and generatesmore than $130 million inannualrevenue.
Twenty-seven years ago,Aurora and Franco werenewly married and deadbroke. They got the idea tostart a restaurant but didn’t
![Page 829: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/829.jpg)
haveenoughmoneytolaunchone. Instead, they begancleaning shopping malls andsmall office buildings—notout of any sense of calling,butbecauseitpaidthebills.
Soon enough, their careerambitions took a turn. Theycouldseeabrighter future inbuildingmaintenance than inhospitality.Theybothworkedferociously hard, putting ineighty-hour weeks,sometimes with their infant
![Page 830: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/830.jpg)
children in carriers strappedacross their chests, scrubbingthe bathroom tiles in theircustomers’ buildings as iftheyweretheirown.
Through all the ups anddowns—andthereweremany—Franco told me: “Wealwayspersevered.Wedidn’tgive in to obstacles. Therewasnowayweregoingtoletourselvesfail.”
I confessed toAurora andFrancothatitwashardforme
![Page 831: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/831.jpg)
to imagine how cleaningbathrooms—or even buildinga multimillion-dollarcorporation that cleansbathrooms—could feel like acalling.
“It’s not about thecleaning,” Aurora explained,her voice tightening withemotion. “It’s about buildingsomething. It’s about ourclients and solving theirproblems. Most of all, it’sabout the incredible people
![Page 832: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/832.jpg)
we employ—they have thebiggest souls, and we feel ahuge responsibility towardthem.”
According to Stanforddevelopmental psychologistBill Damon, such a beyond-the-self orientation can andshould be deliberatelycultivated. Now in the fifthdecade of his distinguishedcareer, Bill studies how
![Page 833: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/833.jpg)
adolescentslearntoleadlivesthat are personally gratifyingand, at the same time,beneficial to the largercommunity. The study ofpurpose, he says, is hiscalling.
InBill’swords,purposeisafinalanswertothequestion“Why? Why are you doingthis?”
What has Bill learnedabouttheoriginsofpurpose?
![Page 834: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/834.jpg)
“Indatasetafterdataset,”hetoldme,“there’sapattern.Everyone has a spark. Andthat’s the very beginning ofpurpose. That spark issomething you’re interestedin.”
Next,youneed toobservesomeone who is purposeful.The purposeful role modelcould be a familymember, ahistorical figure, a politicalfigure.Itdoesn’treallymatterwhoit is,anditdoesn’teven
![Page 835: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/835.jpg)
matter whether that purposeis related to what the childwill end up doing. “Whatmatters,” Bill explained, “isthat someone demonstratesthat it’s possible toaccomplish something onbehalfofothers.”
Infact,hecan’tremembera single case in which thedevelopment of purposeunfolded without the earlierobservation of a purposefulrolemodel.“Ideally,”hesaid,
![Page 836: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/836.jpg)
“the child really gets to seehowdifficultalifeofpurposeis—all the frustrations andthe obstacles—but also howgratifying, ultimately, it canbe.”
What follows is arevelation, asBill put it.Thepersondiscoversaproblemintheworld that needs solving.This discovery can come inmanyways. Sometimes frompersonal loss or adversity.Sometimes from learning
![Page 837: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/837.jpg)
about the loss and adversityconfrontingothers.
But seeing that someoneneeds our help isn’t enough,Billhastened toadd.Purposerequires a second revelation:“I personally can make adifference.” This conviction,this intention to take action,he says, is why it’s soimportant tohaveobservedarole model enact purpose intheir own life. “You have to
![Page 838: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/838.jpg)
believe that your efforts willnotbeinvain.”
KatColeissomeonewhohada role model for purpose-drivengrit.
I met Kat when she wasthe thirty-five-year-oldpresident of the Cinnabonbakery chain. If you listen toher story without reflectingmuchon it,youmightdub it“rags to riches,” but if you
![Page 839: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/839.jpg)
lean in and pay attentionyou’llhearadifferenttheme:“frompovertytopurpose.”
Kat grew up inJacksonville, Florida. Hermother, Jo, worked up thecourage to leave Kat’salcoholic father when Katwas nine. Jo worked threejobs to make enough moneyto support Kat and her twosisters, and yet still foundtime tobeagiver.“She’dbebaking for someone, running
![Page 840: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/840.jpg)
an errand for someone—sheintuitively saw every smallopportunity to do somethingfor others. Everyone she gotto know, whether they werecoworkers or just people inthe community, becamefamilytoher.”
Kat emulated both hermother’s work ethic and herprofounddesiretobehelpful.
Before we get to Kat’smotivation, though, let’sconsider her unlikely ascent
![Page 841: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/841.jpg)
upthecorporateladder.Kat’srésumébeginswithastint,atage fifteen, selling clothes atthe local mall. At eighteen,she was old enough towaitress. She got a job as a“Hooters girl” and one yearlater was asked to help openthefirstHootersrestaurantinAustralia. Ditto for MexicoCity, the Bahamas, and thenArgentina. By twenty-two,shewasrunningadepartmentoften.Bytwenty-six,shewas
![Page 842: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/842.jpg)
vice president. As amemberof the executive team, Kathelped expand the Hootersfranchise to more than fourhundred sites in twenty-eightcountries.Whenthecompanywas bought by a privateequityfirm,Kat,atagethirty-two, had such an impressivetrack record that Cinnabonrecruited her to be itspresident.UnderKat’swatch,Cinnabon sales grew fasterthan theyhad inmore thana
![Page 843: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/843.jpg)
decade,andwithinfouryearsexceededonebilliondollars.
Now let’s consider whatmakesKattick.
One time early in Kat’swaitressing days at Hooters,the cooks quit in the middleof their shift. “So,” she toldme matter-of-factly, “I wentback with the manager andhelped cook the food so allthetablesgotserved.”
Why?
![Page 844: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/844.jpg)
“First of all, I wassurvivingofftips.That’showI paid my bills. If peopledidn’t get their food, theywouldn’tpaytheircheck,andthey certainlywouldn’t leavea tip. Second, I was socurioustoseeifIcoulddoit.And third, I wanted to behelpful.”
Tips and curiosity arepretty self-orientedmotivations, but wanting tobe helpful is, quite literally,
![Page 845: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/845.jpg)
other-oriented. Here was anexample of how a singleaction—jumping behind thestove to make food for allthose waiting customers—benefited the individual andthepeoplearoundher.
The next thing Kat knew,she was training kitchenemployees and helping outwith the back-officeoperations. “Then one day,thebartenderneededtoleaveearly, and the same thing
![Page 846: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/846.jpg)
happened. Another day, themanager quit, and I learnedhow to run a shift. In thecourse of six months, I’dworked every job in thebuilding.NotonlydidIworkthose jobs, I became thetrainer tohelp teachall thoserolestootherpeople.”
Jumping into the breachand being especially helpfulwasn’t a calculated move toget ahead in the corporation.Nevertheless, that beyond-
![Page 847: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/847.jpg)
the-call-of-duty performanceled to an invitation to helpopen international locations,which led to a corporateexecutiveposition,andsoon.
Not so coincidentally, it’sthe sort of thing her mother,Jo, would have done. “Mypassionistohelppeople,”Jotold me. “No matter atbusiness, or away frombusiness, if you needsomebody to come over andbuild something, or help out
![Page 848: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/848.jpg)
insomeway,I’mthatpersonwho wants to be there foryou.Tome,anysuccessI’vehad, it’s because I love toshare. There’s no reserve inme—whatever I have, I’mwilling to give to you oranyoneelse.”
Kat attributes herphilosophy to her mother,whoraisedher“toworkhardand give back.” And thatethicstillguideshertoday.
![Page 849: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/849.jpg)
“Gradually,Ibecamemoreand more aware that I wasvery good at going into newenvironments and helpingpeoplerealizethey’recapableof more than they know. Iwasdiscoveringthat thiswasmy thing. And I started torealize that if I could helppeople—individuals—dothat, thenIcouldhelp teams.IfIcouldhelpteams,Icouldhelp companies. If I couldhelp companies, I could help
![Page 850: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/850.jpg)
brands.IfIcouldhelpbrands,Icouldhelpcommunitiesandcountries.”
Not long ago, Kat postedan essay on her blog, titled“See What’s Possible, andHelp Others Do the Same.”“When I am around people,”Katwrote,“myheartandsoulradiate with the awarenessthat I am in the presence ofgreatness. Maybe greatnessunfound, or greatnessunderdeveloped, but the
![Page 851: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/851.jpg)
potential or existence ofgreatness nevertheless. Youneverknowwhowillgoontodo goodor even great thingsor become the next greatinfluencer in the world—sotreat everyone like they arethatperson.”
Whateveryourage,it’snevertoo early or late to begincultivating a sense ofpurpose. I have three
![Page 852: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/852.jpg)
recommendations, eachborrowed from one of thepurpose researchersmentionedinthischapter.
David Yeagerrecommends reflecting onhow thework you’re alreadydoing can make a positivecontributiontosociety.
In several longitudinalexperiments, David Yeagerand his colleague DavePaunesku asked high schoolstudents, “How could the
![Page 853: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/853.jpg)
worldbeabetterplace?”andthen asked them to drawconnections to what theywere learning in school. Inresponse, one ninth graderwrote, “Iwould like to get ajob as some sort of geneticresearcher. I would use thisjobtohelpimprovetheworldbypossiblyengineeringcropsto produce more food. . . .”Another said, “I think thathaving an education allowsyou to understand the world
![Page 854: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/854.jpg)
aroundyou. . . .Iwillnotbeable to help anyone withoutfirstgoingtoschool.”
This simple exercise,which took less than a classperiod to complete,dramatically energizedstudent engagement.Compared to a placebocontrolexercise,reflectingonpurpose led students todouble the amount of timethey spent studying for anupcomingexam,workharder
![Page 855: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/855.jpg)
on tedious math problemswhen given the option towatch entertaining videosinstead, and, in math andscience classes, bring homebetterreportcardgrades.
Amy Wrzesniewskirecommends thinking abouthow, in smallbutmeaningfulways, you can change yourcurrent work to enhance itsconnection to your corevalues.
![Page 856: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/856.jpg)
Amy calls this idea “jobcrafting,” and it’s anintervention she’s beenstudying with fellowpsychologists Jane Dutton,JustinBerg,andAdamGrant.This is not a Pollyanna,every-job-can-be-nirvanaidea. It is, simply, the notionthat whatever youroccupation, you canmaneuver within your jobdescription—adding,delegating, and customizing
![Page 857: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/857.jpg)
what you do to match yourinterestsandvalues.
Amyandhercollaboratorsrecently tested this idea atGoogle. Employees workingin positions that don’timmediately bring the wordpurpose to mind—in sales,marketing, finance,operations, and accounting,for example—were randomlyassigned to a job-craftingworkshop. They came upwith their own ideas for
![Page 858: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/858.jpg)
tweaking theirdaily routines,each employee making apersonalized “map” for whatwould constitute moremeaningful and enjoyablework. Six weeks later,managers and coworkersrated the employees whoattended this workshop assignificantly happier andmoreeffective.
Finally, Bill Damonrecommends findinginspiration in a purposeful
![Page 859: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/859.jpg)
rolemodel. He’d like you torespondinwritingtosomeofthe questions he uses in hisinterviewresearch, including,“Imagine yourself fifteenyearsfromnow.Whatdoyouthink will be most importantto you then?” and “Can youthink of someone whose lifeinspires you to be a betterperson?Who?Why?”
When I carried out Bill’sexercise, I realized that theperson inmy lifewho,more
![Page 860: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/860.jpg)
than anyone, has shown methe beauty of other-centeredpurpose is my mom. She is,without exaggeration, thekindestpersonI’veevermet.
Growing up, I didn’talways appreciate Mom’sgenerousspirit.Iresentedthestrangers who shared ourtable every Thanksgiving—not just distant relativeswho’d recently emigratedfrom China, but theirroommates, and their
![Page 861: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/861.jpg)
roommates’ friends. Prettymuch anyone who didn’thave a place to go whohappenedtorunintomymomin the month of Novemberwas warmly welcomed intoourhome.
Oneyear,Momgaveawaymybirthdaypresentsamonthafter I’d unwrapped them,and another, she gave awaymy sister’s entire stuffedanimal collection. We threwtantrums and wept and
![Page 862: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/862.jpg)
accusedherofnot lovingus.“But there are children whoneed them more,” she said,genuinely surprised at ourreaction.“Youhavesomuch.Theyhavesolittle.”
When I told my father Iwouldn’t be taking theMCAT exam for medicalschool and, instead, woulddevotemyself tocreating theSummerbridge program, hewasapoplectic.“Whydoyoucareaboutpoorkids?They’re
![Page 863: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/863.jpg)
not family! You don’t evenknow them!” I now realizewhy. All my life, I’d seenwhatoneperson—mymother—could do to help manyothers. I’d witnessed thepowerofpurpose.
![Page 864: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/864.jpg)
Chapter9
HOPE
There’s an old Japanesesaying:Fallseven,riseeight.If Iwereever togeta tattoo,
![Page 865: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/865.jpg)
I’d get these four simplewordsindeliblyinked.
Whatishope?One kind of hope is the
expectation that tomorrowwillbebetter than today. It’sthe kind of hope that has usyearningforsunnierweather,or a smoother path ahead. Itcomes without the burden ofresponsibility.Theonusisonthe universe to make thingsbetter.
![Page 866: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/866.jpg)
Gritdependsonadifferentkind of hope. It rests on theexpectation that our ownefforts can improve ourfuture. I have a feelingtomorrow will be better isdifferent from I resolve tomake tomorrow better. Thehope that gritty people havehas nothing to do with luckand everything to do withgettingupagain.
![Page 867: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/867.jpg)
In the spring semester ofmyfirst year of college, Ienrolledinneurobiology.
Iwouldcometoeachclassearlyandsitinthefrontrow,where I’d copy everyequationanddiagramintomynotebook.Outside of lecture,Ididalltheassignedreadingsand required problem sets.Going into the first quiz, Iwas a little shaky in a fewareas—itwasatoughcourse,and my high school biology
![Page 868: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/868.jpg)
coursework left a lot to bedesired—but on the whole Ifeltprettyconfident.
The quiz started out finebut quickly became moredifficult. I began to panic,thinking over and over: I’mnotgoingtofinish!Ihavenoidea what I’m doing! I’mgoingtofail!This,ofcourse,wasaself-fulfillingprophecy.The more my mind wascrowded by those heart-palpitatingthoughts,thelessI
![Page 869: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/869.jpg)
could concentrate. Time ranout before I’d even read thelastproblem.
A few days later, theprofessor handed back thequiz. I looked downdisconsolately at mymiserable grade and, shortlythereafter, shuffled into theoffice of my assignedteaching assistant. “Youshould really considerdropping this course,” headvised. “You’re just a
![Page 870: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/870.jpg)
freshman. You have threemore years. You can alwaystaketheclasslater.”
“I took AP Bio in highschool,”Icountered.
“Howdidyoudo?”“I got an A, but my
teacherdidn’t teachusmuch,which is probably why Ididn’t take the actual APexam.” This confirmed hisintuition that I should dropthecourse.
![Page 871: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/871.jpg)
Virtually the samescenario repeated itself withthe midterm, for which I’dstudied madly, and afterwhich, I foundmyself in theteaching assistant’s officeonceagain.Thistimehistonewas more urgent. “You donot want a failing grade onyour transcript. It’s not toolate to withdraw from thecourse. If you do, nothingwill get factored into yourGPA.”
![Page 872: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/872.jpg)
I thankedhimforhis timeand closed the door behindme. In the hallway, Isurprised myself by notcrying. Instead, I reviewedthefactsof thesituation: twofailures and only one moreexam—the final—before theendofthesemester.IrealizedIshouldhavestartedout inalower-level course, and now,more than halfway throughthe semester, it was obviousmyenergeticstudyingwasn’t
![Page 873: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/873.jpg)
provingsufficient.IfIstayed,there was a good chance I’dchokeonthefinalandendupwithanFonmytranscript.IfI dropped the course, I’d cutmylosses.
I curled my hands intofists, clenched my jaw, andmarched directly to theregistrar’s office. At thatmoment, I’d resolved to stayenrolled in—and, in fact,majorin—neurobiology.
![Page 874: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/874.jpg)
Looking back on thatpivotalday,IcanseethatI’dbeen knocked down—or,more accurately, tripped onmyowntwofeetandfellflaton my face. Regardless, itwas a moment when I couldhave stayed down. I couldhave said to myself: I’m anidiot! Nothing I do is goodenough! And I could havedroppedtheclass.
Instead, my self-talk wasdefiantly hopeful: I won’t
![Page 875: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/875.jpg)
quit!Icanfigurethisout!For the rest of the
semester, I not only triedharder, I tried things Ihadn’tdone before. I went to everyteaching assistants’ officehours.Iaskedforextrawork.I practiced doing the mostdifficultproblemsunder timepressure—mimicking theconditions under which Ineeded to produce a flawlessperformance. I knew mynerves were going to be a
![Page 876: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/876.jpg)
problem at exam time, so Iresolved to attain a level ofmasterywhere nothing couldsurpriseme. By the time thefinalexamcamearound,Ifeltlike I could have written itmyself.
Iacedthefinal.MyoverallgradeinthecoursewasaB—the lowest grade I’d get infouryears,but,ultimately,theone that made me theproudest.
![Page 877: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/877.jpg)
LittledidIknowwhenIwasfoundering in myneurobiologyclass that Iwasre-creatingtheconditionsofafamous psychologyexperiment.
Let me wind back theclock to1964.Twofirst-yearpsychology doctoral studentsnamed Marty Seligman andSteve Maier are in awindowless laboratory,watchingacageddogreceiveelectric shocks to its back
![Page 878: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/878.jpg)
paws. The shocks comerandomly and withoutwarning. If the dog doesnothing, the shock lasts fiveseconds,butifthedogpushesitsnoseagainstapanelatthefront of the cage, the shockendsearly.Inaseparatecage,another dog is receiving thesame shocks at exactly thesameintervals,butthere’snopanel to push on. In otherwords, both dogs get theexactsamedosageofshockat
![Page 879: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/879.jpg)
the exact same times, butonlythefirstdogisincontrolofhowlongeachshocklasts.After sixty-four shocks, bothdogs go back to their homecages, and new dogs arebrought in for the sameprocedure.
Thenextday,onebyone,all the dogs are placed in adifferentcagecalledashuttlebox. In the middle, there’s alow wall, just high enoughthat the dogs can leap the
![Page 880: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/880.jpg)
barrier if they try. A high-pitched tone plays, heraldingan impending shock, whichcomes through the floor ofthe half of the shuttle boxwhere the dog is standing.Nearly all the dogs who hadcontrol over the shocks thepreviousdaylearntoleapthebarrier. They hear the toneand jump over the wall tosafety. In contrast, two-thirdsof the dogs who had nocontrol over the shocks the
![Page 881: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/881.jpg)
previous day just lie downwhimpering, passivelywaiting for the punishmentstostop.
This seminal experimentproved for the first time thatit isn’t suffering that leads tohopelessness. It’s sufferingyouthinkyoucan’tcontrol.
Many years after decidingtomajor in the subject Iwasfailing, I sat in a graduatestudent cubicle a few doorsdown from Marty’s office,
![Page 882: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/882.jpg)
readingaboutthisexperimenton learned helplessness. Iquickly saw the parallels tomy earlier experience. Thefirst neurobiology quizbrought unexpected pain. Istruggled to improve mysituation, but when themidtermcame, Igot shockedagain. The shuttle box wasthe rest of the semester.Would I conclude from myearlier experience that I washelpless to change my
![Page 883: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/883.jpg)
situation? After all, myimmediate experiencesuggested that two disastrousoutcomes would be followedbyathird.
OrwouldIbelikethefewdogs who, despite recentmemories of uncontrollablepain, held fast to hope?Would I consider my earliersuffering to be the result ofparticular mistakes I couldavoid in the future?Would Iexpandmy focus beyond the
![Page 884: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/884.jpg)
recent past, remembering themany times I’d shrugged offfailure and eventuallyprevailed?
As it turns out, I behavedlike the one-third of dogs inMarty and Steve’s study thatpersevered.Igotupagainandkeptfighting.
In the decade following that1964 experiment, additionalexperiments revealed that
![Page 885: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/885.jpg)
suffering without controlreliably produces symptomsof clinical depression,including changes in appetiteand physical activity, sleepproblems, and poorconcentration.
When Marty and Stevefirst proposed that animalsandpeoplecanlearnthattheyarehelpless, their theorywasconsidered downright absurdby fellow researchers.Nobody at the time took
![Page 886: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/886.jpg)
seriously the possibility thatdogscouldhavethoughtsthatthen influenced theirbehavior. In fact, fewpsychologists entertained thepossibility that people hadthoughts that influenced theirbehavior. Instead, thereceivedwisdomwas thatalllivinganimalssimplyrespondmechanically to punishmentsandrewards.
After a mountain of datahad accumulated, ruling out
![Page 887: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/887.jpg)
every conceivable alternativeexplanation, the scientificcommunitywas, at long last,convinced.
Having thoroughlyplumbed the disastrousconsequences ofuncontrollable stress in thelaboratory,Marty grewmoreand more interested in whatcould be done about it. Hedecidedtoretrainasaclinicalpsychologist. Wisely, hechosetodosounderthewing
![Page 888: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/888.jpg)
ofAaronBeck,apsychiatristand fellow pioneer inunderstandingtherootcausesand practical antidotes fordepression.
What followed was avigorous exploration of theflip side of learnedhelplessness, which Martylater dubbed learnedoptimism. The crucial insightthat seeded Marty’s newwork was available from thevery beginning: While two-
![Page 889: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/889.jpg)
thirds of the dogs that hadexperienced uncontrollableshock later gave up trying tohelpthemselves,aboutathirdremained resilient. Despitetheirearliertrauma,theykepttrying maneuvers that wouldbringrelieffrompain.
Itwas those resilient dogsthat led Marty to study theanalogous I won’t quitresponse to adversity inpeople. Optimists, Martysoon discovered, are just as
![Page 890: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/890.jpg)
likelytoencounterbadeventsas pessimists. Where theydiverge is in theirexplanations: optimistshabitually search fortemporaryandspecificcausesof their suffering, whereaspessimists assume permanentand pervasive causes are toblame.
Here’s an example fromthe test Marty and hisstudents developed todistinguish optimists from
![Page 891: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/891.jpg)
pessimists: Imagine: Youcan’t get all the work donethat others expect of you.Now imagine one majorcause for this event. Whatleapstomind?Afteryoureadthat hypothetical scenario,you write down yourresponse, and then, afteryou’re offered morescenarios, your responses arerated for how temporary(versus permanent) and how
![Page 892: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/892.jpg)
specific (versus pervasive)theyare.
If you’re a pessimist, youmight say, I screw upeverything. Or: I’m a loser.These explanations are allpermanent; there’s not muchyou can do to change them.They’re also pervasive;they’relikelytoinfluencelotsoflifesituations,notjustyourjob performance. Permanentand pervasive explanationsfor adversity turn minor
![Page 893: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/893.jpg)
complications into majorcatastrophes. They make itseemlogicaltogiveup.If,onthe other hand, you’re anoptimist, you might say, Imismanaged my time. Or: Ididn’t work efficientlybecause of distractions.These explanations are alltemporary and specific; their“fixability” motivates you tostart clearing them away asproblems.
![Page 894: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/894.jpg)
Using this test, Martyconfirmed that, compared tooptimists,pessimistsaremorelikely to suffer fromdepression and anxiety.What’s more, optimists farebetterindomainsnotdirectlyrelated to mental health. Forinstance, optimisticundergraduates tend to earnhigher grades and are lesslikely to drop out of school.Optimistic young adults stayhealthier throughout middle
![Page 895: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/895.jpg)
age and, ultimately, livelonger than pessimists.Optimists are more satisfiedwith their marriages. A one-year field study of MetLifeinsurance agents found thatoptimists are twice as likelyto stay in their jobs, and thatthey sell about 25 percentmore insurance than theirpessimistic colleagues.Likewise, studies ofsalespeople intelecommunications, real
![Page 896: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/896.jpg)
estate, office products, carsales, banking, and otherindustries have shown thatoptimists outsell pessimistsby20to40percent.
In one study, eliteswimmers, many of whomwere training for the U.S.Olympic trials, took Marty’soptimism test. Next, coachesaskedeachswimmertoswimin his or her best event andthen deliberately told eachswimmer they’d swum just a
![Page 897: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/897.jpg)
littleslowerthanwasactuallythe case. Given theopportunity to repeat theirevent,optimistsdidatleastaswell as in their first attempt,but pessimists performedsubstantiallyworse.
How do grit paragonsthink about setbacks?Overwhelmingly, I’ve foundthat they explain eventsoptimistically. JournalistHester Lacey finds the samestriking pattern in her
![Page 898: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/898.jpg)
interviews with remarkablycreative people. “What hasbeen your greatestdisappointment?” she askseach of them. Whetherthey’re artists orentrepreneurs or communityactivists, their response isnearly identical. “Well, Idon’t really think in termsofdisappointment. I tend tothink that everything thathappens is something I canlearn from. I tend to think,
![Page 899: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/899.jpg)
‘Well okay, thatdidn’t go sowell, but I guess I will justcarryon.’ ”
Around the time MartySeligman took his two-yearhiatus from laboratoryresearch, his new mentorAaron Beck was questioninghis own training in Freudianpsychoanalysis. Like mostpsychiatristsatthetime,Beckhadbeentaughtthatallforms
![Page 900: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/900.jpg)
ofmental illnesswere rootedin unconscious childhoodconflicts.
Beck disagreed. He hadtheaudacity tosuggest thatapsychiatrist could actuallytalkdirectly topatientsaboutwhatwasbotheringthem,andthat the patients’ thoughts—their self-talk—could be thetarget of therapy. Thefoundational insight ofBeck’s new approach wasthat the same objective event
![Page 901: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/901.jpg)
—losingajob,gettingintoanargument with a coworker,forgetting to call a friend—can lead to very differentsubjective interpretations.Anditisthoseinterpretations—rather than the objectiveevents themselves—that cangive rise to our feelings andourbehavior.
Cognitive behavioraltherapy—which aims to treatdepression and otherpsychological maladies by
![Page 902: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/902.jpg)
helping patients think moreobjectively and behave inhealthier ways—has shownthat, whatever our childhoodsufferings, we can generallylearn toobserveournegativeself-talk and change ourmaladaptive behaviors. Aswith any other skill, we canpractice interpreting whathappenstousandrespondingas an optimist would.Cognitive behavioral therapyis now a widely practiced
![Page 903: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/903.jpg)
psychotherapeutic treatmentfor depression, and hasproven longer-lasting in itseffects than antidepressantmedication.
AfewyearsafterI’dgottenatoehold in grit research,Wendy Kopp, the founderand then CEO of Teach ForAmerica,cametovisitMarty.
Then still his graduatestudent, I was eager to join
![Page 904: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/904.jpg)
theirmeetingfortworeasons.First,TeachForAmericawassending hundreds of recentcollege graduates intodisadvantagedschooldistrictsacross the country. Frompersonal experience, I knewteaching to be a grit-demanding profession,nowheremore so than in theurban and rural classroomswhere TFA teachers areassigned.Second,Wendywasherself a paragon of grit.
![Page 905: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/905.jpg)
Famously,she’dconceivedofTFAduringhersenioryearatPrinceton and, unlike somany idealists whoeventually give up on theirdream, she’d stuck with it,starting from nothing andcreatingoneofthelargestandmost influential educationalnonprofits in the country.“Relentlesspursuit”wasbotha core value of TFA and thephrase often used by friends
![Page 906: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/906.jpg)
and coworkers to describeWendy’sleadershipstyle.
At that meeting, the threeofusdevelopedahypothesis:Teachers who have anoptimisticwayofinterpretingadversityhavemoregrit thantheir more pessimisticcounterparts,andgrit,inturn,predicts better teaching. Forinstance, an optimisticteacher might keep lookingfor ways to help anuncooperative student,
![Page 907: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/907.jpg)
whereas a pessimist mightassume there was nothingmore to be done. To testwhether that was true, wedecided tomeasureoptimismand grit before teachers setfoot in the classroom and, ayearlater,seehoweffectivelyteachers had advanced theacademic progress of theirstudents.
ThatAugust,fourhundredTFA teachers completed theGrit Scale and, in addition,
![Page 908: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/908.jpg)
Marty’s questionnaireassessing their optimism. Tothe extent they thought oftemporaryandspecificcausesforbadevents,andpermanentandpervasivecausesofgoodevents, we coded theirresponses as optimistic. Tothe extent they did thereverse, we coded theirresponsesaspessimistic.
In the same survey, wemeasured one more thing:happiness. Why? For one
![Page 909: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/909.jpg)
thing, there was a small butgrowing body of scientificevidence that happinesswasn’t just the consequenceofperformingwellatwork,itmight also be an importantcause.Also,wewerecuriousabouthowhappy thegrittiestteachers were. Did single-minded passion andperseverancecomeat acost?Or could you be gritty andhappyatthesametime?
![Page 910: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/910.jpg)
One year later, whenTeach For America hadtabulated effectivenessratingsforeachteacherbasedontheacademicgainsoftheirstudents, we analyzed ourdata. Just as we’d expected,optimistic teachers weregrittier and happier, and gritand happiness in turnexplained why optimisticteachers got their students toachieve more during theschoolyear.
![Page 911: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/911.jpg)
After staring at theseresults for a while, I beganreminiscing about my ownexperience of classroomteaching. I remembered themany afternoons I’d gonehome exasperated andexhausted. I rememberedbattling catastrophic self-talkabout my own capabilities—Oh god, I really am anidiot!—and those of myyoung charges—She got itwrong again? She’ll never
![Page 912: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/912.jpg)
learnthis!AndIrememberedthe mornings I’d gotten upand decided, after all, thatthere was one more tacticworthtrying:MaybeifIbringin a Hershey bar and cut itinto pieces, they’ll get theidea of fractions. Maybe if Ihaveeveryonecleanouttheirlockers on Mondays, they’llget in the habit of keepingtheirlockersclean.
Thedatafromthisstudyofyoung teachers, along with
![Page 913: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/913.jpg)
Wendy Kopp’s intuitions,interviewswithgritparagons,and a half century ofpsychological research allpoint to the same,commonsense conclusion:Whenyoukeepsearchingforwaystochangeyoursituationfor the better, you stand achance of finding them.When you stop searching,assumingtheycan’tbefound,youguaranteetheywon’t.
![Page 914: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/914.jpg)
Or asHenryFord is oftenquoted as saying, “Whetheryou think you can, or thinkyoucan’t—you’reright.”
Around the time MartySeligman and Steve Maierwere linking hopelessness toalackofperceivedcontrol,ayoung psychology majornamed Carol Dweck wasmaking her way throughcollege. Carol had always
![Page 915: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/915.jpg)
been intrigued that somepeopleperseverewhileothersin identical circumstancesgive up. Right aftergraduation, she enrolled in adoctoral program inpsychology and pursued thisquestion.
Marty and Steve’s workhad a profound influence onyoung Carol. She believedtheir findings but wasunsatisfied. Sure, attributingyourmiserytocausesbeyond
![Page 916: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/916.jpg)
yourcontrolwasdebilitating,but where did theseattributionscomefromin thefirst place? Why, she asked,didonepersongrowuptobean optimist and another apessimist?
In one of Carol’s firststudies, she worked withmiddle schools to identifyboys and girls who, byconsensus of their teachers,the school principal, and theschool psychologist, were
![Page 917: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/917.jpg)
especially “helpless” whenconfronted by failure. Herhunchwasthatthesechildrenbelieved that a lack ofintellectual ability led tomistakes,ratherthanalackofeffort. In other words, shesuspecteditwasn’tjustalongstring of failures that madethesechildrenpessimistic,butrathertheircorebeliefsaboutsuccessandlearning.
To test her idea, Caroldivided the children into two
![Page 918: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/918.jpg)
groups. Half the childrenwere assigned to a successonly program. For severalweeks, they solved mathproblems and, at the end ofeach session, no matter howmany they’d completed, theyreceived praise for doingwell. The other half of thechildren in Carol’s studywere assigned to anattribution retrainingprogram.These children alsosolved math problems, but
![Page 919: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/919.jpg)
were occasionally told thatthey hadn’t solved enoughproblems during thatparticular session and,crucially, that they “shouldhavetriedharder.”
Afterward,all thechildrenwere given a combination ofeasy and very difficultproblemstodo.
Carol reasoned that, ifprior failures were the rootcause of helplessness, thesuccess only program would
![Page 920: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/920.jpg)
boost motivation. If, on theother hand, the real problemwas how children interpretedtheir failures, then theattribution retrainingprogram would be moreeffective.
What Carol found is thatthe children in the successonlyprogramgaveup justaseasilyafterencounteringverydifficultproblemsastheyhadbefore training. In sharpcontrast, children in the
![Page 921: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/921.jpg)
attribution retrainingprogram tried harder afterencountering difficulty. Itseems as though they’dlearned to interpret failure asacuetotryharderratherthanas confirmation that theylackedtheabilitytosucceed.
Over the next four decades,Carolprobeddeeper.
She soon discovered thatpeople of all ages carry
![Page 922: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/922.jpg)
around in theirmindsprivatetheoriesabouthowtheworldworks. These points of viewareconscious in that ifCarolasks you questions aboutthem, you have a readyanswer.But like the thoughtsyouworkonwhenyougo toa cognitive behavioraltherapist, you may not beaware of them until you’reasked.
Here are four statementsCarol uses to assess a
![Page 923: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/923.jpg)
person’s theory ofintelligence. Read them nowand consider how much youagreeordisagreewitheach:
Your intelligence issomethingverybasicaboutyou that you can’t changeverymuch.
Youcan learnnew things,butyoucan’treallychangehowintelligentyouare.
![Page 924: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/924.jpg)
No matter how muchintelligence you have, youcanalwayschangeitquiteabit.
You can alwayssubstantially change howintelligentyouare.
If you found yourselfnodding affirmatively to thefirst two statements butshaking your head indisagreement with the lasttwo, then Carol would say
![Page 925: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/925.jpg)
you have more of a fixedmindset. If you had theopposite reaction, then Carolwouldsayyou tend towardagrowthmindset.
I like to thinkofagrowthmindsetthisway:Someofusbelieve, deep down, thatpeople really can change.Thesegrowth-orientedpeopleassume that it’s possible, forexample, to get smarter ifyou’re given the rightopportunitiesandsupportand
![Page 926: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/926.jpg)
if you tryhardenoughand ifyou believe you can do it.Conversely, some peoplethinkyoucanlearnskills,likehow to ride a bike or do asalespitch,butyourcapacityto learn skills—your talent—can’tbetrained.Theproblemwith holding the latter fixed-mindset view—and manypeople who considerthemselves talented do—isthat no road is withoutbumps. Eventually, you’re
![Page 927: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/927.jpg)
going to hit one. At thatpoint,havingafixedmind-setbecomes a tremendousliability.ThisiswhenaC–,arejection letter, adisappointingprogressreviewatwork,oranyothersetbackcan derail you.With a fixedmindset, you’re likely tointerpret these setbacks asevidence that, after all, youdon’thave“therightstuff”—you’renotgoodenough.With
![Page 928: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/928.jpg)
agrowthmindset,youbelieveyoucanlearntodobetter.
Mindsetshavebeenshowntomakeadifferenceinallthesame life domains asoptimism.Forinstance,ifyouhave a growth mindset,you’remorelikelytodowellin school, enjoy betteremotional and physicalhealth, and have stronger,more positive socialrelationships with otherpeople.
![Page 929: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/929.jpg)
A few years ago, Caroland I asked more than twothousand high school seniorstocompleteagrowth-mindsetquestionnaire. We’ve foundthat students with a growthmindset are significantlygrittier than students with afixed mindset. What’s more,grittier students earn higherreport card grades and, aftergraduation,aremorelikelytoenroll in and persist throughcollege. I’ve since measured
![Page 930: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/930.jpg)
growth mindset and grit inboth younger children andolder adults, and in everysample, I’ve found thatgrowth mindset and grit gotogether.
When you ask Carol whereour mindsets come from,she’ll point to people’spersonal histories of successand failure and how thepeople around them,
![Page 931: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/931.jpg)
particularly those in aposition of authority, haverespondedtotheseoutcomes.
Consider, for example,what people said to youwhen, as a child, you didsomething really well. Wereyou praised for your talent?Orwereyoupraisedforyoureffort? Either way, chancesare you use the samelanguage today whenevaluating victories anddefeats.
![Page 932: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/932.jpg)
Praising effort andlearning over “natural talent”isanexplicittargetofteachertraining in theKIPP schools.KIPP stands for theKnowledge Is PowerProgram,anditwasstartedin1994 by Mike Feinberg andDaveLevin,twogrittyyoungTeach For America teachers.Today, KIPP schools serveseventy thousandelementary,middle, and high schoolstudents across the country.
![Page 933: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/933.jpg)
The vast majority ofKIPPsters, as they proudlyrefer to themselves, comefrom low-income families.Against the odds, almost allgraduate from high school,andmore than 80 percent goontocollege.
KIPP teachers get a littlethesaurusduring training.Onone side, there areencouragements teachersoften use with the best ofintentions.Ontheother,there
![Page 934: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/934.jpg)
is language that subtly sendsthemessage that life isaboutchallenging yourself andlearning to do what youcouldn’tdobefore.Seebelowfor examples appropriate forpeople of any age. Whetheryou’re a parent, manager,coach, or any other type ofmentor,Isuggestyouobserveyour own language over thenext few days, listening forthebeliefsyourwordsmaybe
![Page 935: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/935.jpg)
reinforcing in yourself andothers.
UnderminesGrowthMindsetandGrit
PromotesGrowthMindsetandGrit
“You’reanatural!Ilovethat.”
“You’realearner!Ilovethat.”
“Well,atleastyoutried!”
“Thatdidn’twork.Let’stalkabout
![Page 936: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/936.jpg)
howyouapproacheditandwhatmightworkbetter.”
“Greatjob!You’resotalented!”
“Greatjob!What’sonethingthatcouldhavebeenevenbetter?”
“Thisishard.Don’tfeelbad
“Thisishard.Don’tfeelbadifyou
![Page 937: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/937.jpg)
ifyoucan’tdoit.”
can’tdoityet.”
“Maybethisjustisn’tyourstrength.Don’tworry—youhaveotherthingstocontribute.”I
“Ihavehighstandards.I’mholdingyoutothembecauseIknowwecanreachthemtogether.”
![Page 938: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/938.jpg)
Language is one way tocultivate hope. Butmodelinga growth mindset—demonstrating by ouractionsthat we truly believe peoplecan learn to learn—may beevenmoreimportant.
Author and activist JamesBaldwinonceputitthisway:“Children have never beenverygoodatlisteningtotheirelders, but they have neverfailed to imitate them.” Thisis one of Dave Levin’s
![Page 939: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/939.jpg)
favorite quotes, and I’vewatched him begin manyKIPP training workshopswithit.
A psychologist inmy lab,Daeun Park, recently foundthistobeexactlythecase.Inayearlongstudyof first-andsecond-gradeclassrooms,shefoundthat teacherswhogavespecial privileges to higher-performing students andemphasized how theycompared to others
![Page 940: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/940.jpg)
inadvertently inculcated afixed mindset among theyoung students. Over theyear,studentsofteacherswhoactedthiswaygrewtoprefergames and problems thatwereeasy, “soyoucanget alotright.”Byyear’send,theyweremorelikelytoagreethat“apersonisacertainamountsmart, and stays prettymuchthesame.”
Similarly, Carol and hercollaborators are finding that
![Page 941: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/941.jpg)
children develop more of afixed mindset when theirparents react to mistakes asthough they’re harmful andproblematic.Thisistrueevenwhen these parents say theyhave a growth mindset. Ourchildrenarewatchingus,andthey’reimitatingwhatwedo.
The same dynamics applyin a corporate setting.Berkeley professor JenniferChatman and hercollaborators recently
![Page 942: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/942.jpg)
surveyed employees ofFortune 1000 companiesabout mindset, motivation,and well-being. They foundthat, in each company, therewas a consensus aboutmindset. In fixed-mindsetcompanies,employeesagreedwithstatementslike“Whenitcomes to being successful,this company seems tobelieve that people have acertain amount of talent, andthey really can’t do much to
![Page 943: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/943.jpg)
changeit.”Theyfeltthatonlya few star performers werehighly valued and that thecompany wasn’t trulyinvested in other employees’development. Theserespondents also admitted tokeeping secrets, cuttingcorners, and cheating to getahead. By contrast, ingrowth-mindset cultures,employees were 47 percentmore likely to say theircolleagues were trustworthy,
![Page 944: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/944.jpg)
49percentmorelikelytosaytheir company fostersinnovation, and 65 percentmore likely to say theircompanysupportsrisktaking.
How do you treat highachievers?Howdoyou reactwhenothersdisappointyou?
Myguessisthatnomatterhow much you embrace theidea of growth mindset, youoften default to a fixedmindset. At least, this is thecase for Carol, Marty, and
![Page 945: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/945.jpg)
me.Allofusknowhowwe’dlike to react when, say,someone we’re supervisingbringsusworkthatfallsshortof expectations. We’d likeour knee-jerk reflex to becalm and encouraging. Weaspire tohaveanOkay, whatis there to learn here?attitudetowardmistakes.
But we’re human. So,moreoftenthanwe’dlike,weget frustrated. We show ourimpatience. In judging the
![Page 946: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/946.jpg)
person’sabilities,weallowaflickerofdoubt todistractusmomentarily from the moreimportant task of what theycoulddonexttoimprove.
The reality is that mostpeople have an inner fixed-mindset pessimist in themright alongside their innergrowth-mindset optimist.Recognizing this is importantbecauseit’seasytomakethemistakeofchangingwhatwesay without changing our
![Page 947: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/947.jpg)
body language, facialexpressions,andbehavior.
Sowhat shouldwedo?Agoodfirststepistowatchformismatches between ourwords and actions.Whenweslip up—and we will—wecan simply acknowledge thatit’shardtomoveawayfromafixed,pessimisticviewoftheworld. One of Carol’scolleagues, Susan Mackie,works with CEOs andencourages them to give
![Page 948: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/948.jpg)
names to their inner fixed-mindsetcharacters.Thentheycan say things like “Oops. Iguess I brought ControllingClaire to the meeting today.Let me try that again.” Or:“Overwhelmed Olivia isstrugglingtodealwithallthecompeting demands, can youhelpmethinkthisthrough?”
Ultimately, adopting agritty perspective involvesrecognizing that people getbetter at things—they grow.
![Page 949: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/949.jpg)
Just as we want to cultivatethe ability to get up off thefloor when life has knockedus down, we want to givethosearoundusthebenefitofthe doubt when somethingthey’ve tried isn’t a ragingsuccess. There’s alwaystomorrow.
IrecentlycalledBillMcNabbfor his perspective. Since2008, Bill has served as the
![Page 950: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/950.jpg)
CEO of Vanguard, theworld’s largest provider ofmutualfunds.
“We’ve actually trackedsenior leaders here atVanguard and asked whysome did better in the longrunthanothers.Iusedtousethe word ‘complacency’ todescribe the oneswho didn’twork out, but the more Ireflect on it, the more Irealize that’snotquite it. It’sreally a belief that ‘I can’t
![Page 951: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/951.jpg)
learn anymore. I am what Iam.ThisishowIdothings.’ ”
Andwhataboutexecutiveswhoultimatelyexcelled?
“The people who havecontinued to be successfulherehavestayedonagrowthtrajectory. They just keepsurprising you with howmuchthey’regrowing.We’vehad people who, if youlooked at their résumécoming in,you’dsay, ‘Wow,howdidthatpersonendupso
![Page 952: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/952.jpg)
successful?’ And we’ve hadother people come in withincredible credentials, andyou’re wondering, ‘Why didtheynotgofurther?’ ”
When Bill discovered theresearch on growth mindsetand grit, it confirmed hisintuitions—not just as acorporate leader but as afather, former high schoolLatin teacher, rowing coach,andathlete.“Ireallydothinkpeopledeveloptheoriesabout
![Page 953: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/953.jpg)
themselves and the world,and it determines what theydo.”
When we got to thequestion of where, exactly,any of us begin formulatingthese theories, Bill said,“Believe it or not, I actuallystarted out with more of afixedmindset.”Hechalksupthat mindset, partly, to hisparents enrolling him, whilehe was still in elementaryschool, ina researchstudyat
![Page 954: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/954.jpg)
a nearby university. Heremembers taking a wholebattery of intelligence testsand, at the end, being told,“You did really well, andyou’regoingtodoreallywellinschool.”
For a while, anauthoritative diagnosis oftalent, in combination withearly success, boosted hisconfidence: “I took greatpride in finishing tests fasterthan anyone else. I didn’t
![Page 955: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/955.jpg)
always get one hundredpercent, but I usually cameclose, and I took greatpleasure in not working thathardtoachievewhatIdid.”
Billattributeshisswitchtoa growth mindset to joiningthecrewteamincollege.“I’dnever rowed before, but Ifound I liked being on thewater.Ilikedbeingoutside.Iliked the exercise. I sort offellinlovewiththesport.”
![Page 956: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/956.jpg)
RowingwasthefirstthingBill wanted to do well thatdidn’tcomeeasily:“Iwasnotanatural,”hetoldme.“Ihadalotoffailuresearlyon.ButI kept going, and theneventually, I started gettingbetter. Suddenly, it began tomake sense: ‘Put your headdownandgohard.Hardworkreally, really matters.’ ” Bythe end of his freshmanseason,Billwasinthejuniorvarsity boat. That didn’t
![Page 957: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/957.jpg)
sound so bad tome, butBillexplained that, statistically,this placement suggestedthere was no chance of evermakingvarsity.Thatsummer,he stayed on campus androwedallsummer.
All that practice paid off.Bill was promoted to the“stroke seat” of the juniorvarsity boat,making him theonewhosetsthepacefortheother seven rowers. Duringtheseason,oneof thevarsity
![Page 958: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/958.jpg)
rowers was injured, and Billhad the opportunity to showwhat he could do. By hisaccount, and also the teamcaptain’s, he did terrificallywell. Still, when the injuredrower recovered, the coachdemotedBillagain.
“That coach had a fixedmindset—he just couldn’tbelieve that I’d improved asmuchasIdid.”
There were more ups anddowns, but Bill’s growth
![Page 959: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/959.jpg)
mindset kept gettingaffirmed. “Because I’d comesodamnclosetoquittingandyet hung in there, andbecause thingseventuallydidwork out, I learned a lessonI’d never forget. The lessonwas that, when you havesetbacks and failures, youcan’t overreact to them.Youneed to step back, analyzethem, and learn from them.But you also need to stayoptimistic.”
![Page 960: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/960.jpg)
How did that lesson helpBilllaterinlife?“Therehavebeen times in my careerwhere I felt discouraged. I’dwatch someone else getpromotedbeforeme.I’dwantthings to go a certain way,and they’d go the opposite.At those points, I’d say tomyself, ‘Just keep workinghardand learning,and itwillallworkout.’ ”
![Page 961: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/961.jpg)
“Whatdoesn’tkillmemakesmestronger,”Nietzscheoncesaid. Kanye West and KellyClarkson echo the samesentiment, and there’s areason we keep repeating it.Many of us can remember atimewhen,likeBillMcNabb,we were confronted withchallengeandyetemergedontheothersidemoreconfidentthanwhenwebegan.
Consider,forexample,theOutward Bound program,
![Page 962: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/962.jpg)
which sends adolescents oradults into the wildernesswith experienced leaders,usually for a few weeks.From its inception a halfcentury ago, the premise ofOutward Bound—so namedfor themomenta ship leavesharborfortheopenseas—hasbeenthatchallengingoutdoorsituations develop “tenacityinpursuit” and“undefeatablespirit.” In fact, acrossdozensof studies, the program has
![Page 963: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/963.jpg)
been shown to increaseindependence, confidence,assertiveness, and the beliefthat what happens in life islargely under your control.What’s more, these benefitstend to increase, rather thandiminish, in the six monthsfollowing participation in theprogram.
All the same, it’sundeniable that what doesn’tkill us sometimes makes usweaker. Consider the dogs
![Page 964: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/964.jpg)
whowereshockedrepeatedlywithnocontrol.Athirdofthedogs were resilient to thisadversity, but there was noevidencethatanyofthedogsin the uncontrollable stresscondition benefited from theexperience in any way. Onthecontrary,mostweremuchmore vulnerable to sufferingintheimmediateaftermath.
So, it appears thatsometimes what doesn’t killyoumakes you stronger, and
![Page 965: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/965.jpg)
sometimes it does theopposite.Theurgentquestionbecomes:When?When doesstruggle lead to hope, andwhen does struggle lead tohopelessness?
A few years ago, SteveMaier and his studentsdesigned an experimentnearly identical to theoneheand Marty Seligman hadconducted fortyyears earlier:One group of rats receivedelectric shocks, but if they
![Page 966: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/966.jpg)
turned a small wheel withtheir front paws, they couldturn off the shock until thenext trial. A second groupreceived theexact samedoseof electric shocks as the firstbut had no control over theirduration.
Onecrucialdifferencewasthat, in the new experiment,theratswereonlyfiveweeksold—that’sadolescenceintherat life cycle. A seconddifferencewasthattheeffects
![Page 967: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/967.jpg)
of this experience wereassessed five weeks later,when the rats were fullymature adults. At that point,both groups of rats weresubjected to uncontrollableelectric shocks and, the nextday, observed in a socialexplorationtest.
Here’swhatStevelearned.Adolescent rats whoexperienced stress theycouldnot control grew up to beadult rats who, after being
![Page 968: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/968.jpg)
subjected to uncontrollableshocks a second time,behavedtimidly.Thiswasnotunusual—they learned to behelplessinthesamewaythatany other rat would. Incontrast, adolescent rats whoexperienced stress theycouldcontrol grew up to be moreadventurous and, mostastounding, appeared to beinoculated against learnedhelplessness in adulthood.That’s right—when these
![Page 969: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/969.jpg)
“resilient rats” grew up, theusual uncontrollable shockprocedures no longer madethemhelpless.
In other words, whatdidn’t kill the young rats,when by their own effortsthey could control what washappening, made themstrongerforlife.
When I learned about SteveMaier’s new experimental
![Page 970: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/970.jpg)
work,Ijusthadtotalktohiminperson.IgotonaplanetoColorado.
Steve walked me aroundhislaboratoryandshowedmethe special cages equippedwith little wheels that, whenturned, cut off the current totheelectricshock.Afterward,the graduate studentwho ranthe experiment on adolescentratsthatIjustdescribedgavea talk on the brain circuitsand neurotransmitters
![Page 971: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/971.jpg)
involved.Finally,whenSteveand I sat down together, Iasked him to explain, fromthis experiment andeverything else he’d done inhis long and distinguishedcareer, the neurobiology ofhope.
Steve thought for amoment.“Here’sthedealinafew sentences. You’ve gotlotsofplacesinthebrainthatrespond to aversiveexperiences. Like the
![Page 972: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/972.jpg)
amygdala.Infact, thereareawhole bunch of limbic areasthatrespondtostress.”
Inodded.“Nowwhathappensisthat
these limbic structures areregulated by higher-orderbrainareas,liketheprefrontalcortex.Andso,ifyouhaveanappraisal, a thought, a belief—whatever you want to callit—thatsays,‘Waitaminute,I can do something aboutthis!’ or ‘This really isn’t so
![Page 973: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/973.jpg)
bad!’orwhatever, then theseinhibitory structures in thecortex are activated. Theysend a message: ‘Cool itdown there! Don’t get soactivated. There’s somethingwecando.’ ”
I got it. But I still didn’tunderstand, fully, why Stevehad gone to the trouble ofexperimenting withadolescentrats.
“The long-term storyneeds some more
![Page 974: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/974.jpg)
explanation,” he continued.“We think there is plasticityin that circuitry. If youexperience adversity—somethingprettypotent—thatyou overcome on your ownduring your youth, youdevelop a different way ofdealing with adversity lateron. It’s important that theadversity be pretty potent.Because these brain areasreallyhavetowiretogetherinsome fashion, and that
![Page 975: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/975.jpg)
doesn’t happen with justminorinconveniences.”
So you can’t just talksomeone into believing theycanmasterchallenges?
“That’s right. Just tellingsomebodytheycanovercomeadversity isn’t enough. Forthe rewiring to happen, youhave to activate the controlcircuitry at the same time asthose low-level areas. Thathappenswhenyouexperience
![Page 976: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/976.jpg)
mastery at the same time asadversity.”
And what about a lifehistory of challenge withoutcontrol?
“Iworryalotaboutkidsinpoverty,” Steve said.“They’re getting a lot ofhelplessness experiences.They’re not getting enoughmastery experiences. They’renot learning: ‘Icando this. Ican succeed in that.’ Myspeculation is that those
![Page 977: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/977.jpg)
earlier experiences can havereally enduring effects. Youneed to learn that there’s acontingency between youractions and what happens toyou: ‘If I do something, thensomethingwillhappen.’ ”
Thescientificresearchisveryclear that experiencingtraumawithoutcontrolcanbedebilitating.But I alsoworryabout people who cruise
![Page 978: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/978.jpg)
through life, friction-free, fora long, long time beforeencountering their first realfailure. They have so littlepracticefallingandgettingupagain. They have so manyreasons to stick with a fixedmindset.
I see a lot of invisiblyvulnerable high-achieversstumble in young adulthoodandstruggletogetupagain.Icall them the “fragileperfects.” Sometimes I meet
![Page 979: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/979.jpg)
fragile perfects in my officeafter a midterm or a final.Very quickly, it becomesclear that these bright andwonderful people know howtosucceedbutnothowtofail.
Last year, I kept in touchwith a freshman at Pennnamed Kayvon Asemani.Kayvon has the sort ofrésumé that might make youworry he’s a fragile perfect:valedictorian of his highschool class, student body
![Page 980: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/980.jpg)
president,starathlete . . . thelistgoeson.
But I assure you thatKayvon is the veryembodiment of growthmindset and optimism. Wemetwhen hewas a senior attheMiltonHersheySchool,atuition-free boarding schooloriginally established bychocolatier Milton Hersheyfor orphan boys and, to thisday, a haven for childrenfrom severely disadvantaged
![Page 981: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/981.jpg)
backgrounds.Kayvonandhissiblings ended up atHersheyjust before Kayvon enteredthe fifth grade—one yearafter his father nearlystrangledhismothertodeath,leaving her in a permanentcoma.
At Hershey, Kayvonthrived. He discovered apassionformusic,playingthetrombone in two schoolbands. And he discoveredleadership,givingspeechesto
![Page 982: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/982.jpg)
state politicians, creating astudent-run school newswebsite, chairing committeesthat raised tens of thousandsof dollars for charity, and inhis senior year, serving asstudentbodypresident.
In January, Kayvonemailed to letme know howhisfirstsemesterhadgone.“Ifinished the first semesterwitha3.5,”hewrote.“ThreeA’s and one C. I’m notcompletelysatisfiedwith it. I
![Page 983: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/983.jpg)
knowwhat I did right to gettheA’sandIknowwhatIdidwrongtogettheC.”
As for his poorest grade?“ThatCinEconomicscaughtup tome because Iwas in ahole from my conflictedthoughtsabout thisplaceandwhether I fit in. . . . I candefinitelydobetterthana3.5,and a 4.0 is not out of thequestion. My first semestermentalitywasthatIhavealotto learn from these kids.My
![Page 984: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/984.jpg)
newmentalityisthatIhavealottoteachthem.”
The spring semesterwasn’t exactly smoothsailing,either.KayvonearnedabunchofA’s but didn’t donearly aswell as he’d hopedin his two quantitativecourses. We talked, briefly,about the option oftransferring out of Wharton,Penn’s highly competitivebusinessschool,andIpointedout that there was no shame
![Page 985: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/985.jpg)
in switching into a differentmajor. Kayvon was havingnoneofit.
Here’sanexcerptfromhisemail to me in June:“Numbers and executingquantitative concepts havealways been difficult forme.But I embrace the challenge,andI’mgoingtoapplyallthegrit I have to improvingmyself and making myselfbetter, even if it meansgraduating with a GPA less
![Page 986: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/986.jpg)
than what I would haveearned if I just majored insomething that didn’t requiremetomanipulatenumbers.”
I have no doubt thatKayvonwillkeepgettingup,time and again, alwayslearningandgrowing.
Collectively, the evidenceI’ve presented tells thefollowing story: A fixedmindsetaboutabilityleadsto
![Page 987: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/987.jpg)
pessimistic explanations ofadversity, and that, in turn,leads to both giving up onchallengesandavoidingthemin the first place. In contrast,a growth mindset leads tooptimisticwaysofexplainingadversity, and that, in turn,leads to perseverance andseeking out new challengesthatwillultimatelymakeyouevenstronger.
![Page 988: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/988.jpg)
My recommendation forteaching yourself hope is totakeeachstepinthesequenceaboveandask,WhatcanIdotoboostthisone?
Myfirstsuggestioninthatregard is to update yourbeliefsabout intelligenceandtalent.
When Carol and hercollaborators try to convincepeople that intelligence, oranyother talent,can improvewith effort, she starts by
![Page 989: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/989.jpg)
explaining the brain. Forinstance,sherecountsastudypublishedinthetopscientificjournal Nature that trackedadolescent braindevelopment. Many of theadolescents in this studyincreased their IQ scoresfrom age fourteen, when thestudystarted,toageeighteen,when it concluded. This fact—that IQ scores are notentirelyfixedoveraperson’slifespan—usuallycomesasa
![Page 990: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/990.jpg)
surprise.What’s more, Carolcontinues, these sameadolescents showed sizablechanges in brain structure:“Those who got better atmath skills strengthened theareas of the brain related tomath, and the samewas trueforEnglishskills.”
Carolalsoexplainsthatthebrain is remarkably adaptive.Like a muscle that getsstronger with use, the brainchanges itself when you
![Page 991: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/991.jpg)
struggle to master a newchallenge. In fact, there’snevera time in lifewhen thebrain is completely “fixed.”Instead, all our lives, ourneuronsretainthepotentialtogrow new connections withoneanotherandtostrengthenthe ones we already have.What’s more, throughoutadulthood, we maintain theabilitytogrowmyelin,asortof insulating sheath thatprotects neurons and speeds
![Page 992: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/992.jpg)
signals traveling betweenthem.
My next suggestion is topracticeoptimisticself-talk.
The link betweencognitive behavioral therapyand learned helplessness ledto the development of“resilience training.” Inessence, this interactivecurriculum is a preventativedose of cognitive behavioraltherapy. In one study,children who completed this
![Page 993: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/993.jpg)
training showed lower levelsof pessimism and developedfewer symptoms ofdepression over the next twoyears. In a similar study,pessimistic college studentsdemonstrated less anxietyoverthesubsequenttwoyearsandlessdepressionoverthreeyears.
If, reading this chapter,you recognize yourself as anextremepessimist,myadviceis to find a cognitive
![Page 994: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/994.jpg)
behavioral therapist. I knowhow unsatisfying thisrecommendation mightsound.Many years ago, as ateenager, I wrote to DearAbby about a problem Iwashaving. “Go see a therapist,”she wrote back. I recalltearing up her letter, angryshe didn’t propose a neater,faster, more straightforwardsolution. Nevertheless,suggesting that readingtwenty pages about the
![Page 995: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/995.jpg)
science of hope is enough toremove an ingrainedpessimistic bias would benaive. There’smuchmore tosay about cognitivebehavioral therapy andresilience training than I cansummarizehere.
The point is that you can,infact,modifyyourself-talk,andyoucanlearntonotletitinterfere with you movingtoward your goals. Withpractice and guidance, you
![Page 996: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/996.jpg)
can change the way youthink, feel, and, mostimportant,actwhenthegoinggetsrough.
Asatransitiontothefinalsection of this book,“Growing Grit from theOutside In,” letmeofferonefinal suggestion for teachingyourself hope: Ask for ahelpinghand.
A few years ago, I met aretired mathematician namedRhonda Hughes. Nobody in
![Page 997: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/997.jpg)
Rhonda’s familyhadgone tocollege, but as a girl, shelikedmath a whole lot morethan stenography. Rhondaeventually earned a PhD inmathematics and, afterseventy-nine of her eightyapplications for a facultyposition were rejected, shetook a job at the singleuniversity that made her anoffer.
One reasonRhondagot intouchwas to tellme that she
![Page 998: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/998.jpg)
hadan issuewithan itemonthe Grit Scale. “I don’t likethat item that says, ‘Setbacksdon’t discourage me.’ Thatmakesnosense.Imean,whodoesn’t get discouraged bysetbacks? I certainly do. Ithinkitshouldsay,‘Setbacksdon’tdiscouragemeforlong.Igetbackonmyfeet.’ ”
Of course, Rhonda wasright,andinsomanywords,Ichangedtheitemaccordingly.
![Page 999: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/999.jpg)
But the most importantthingaboutRhonda’sstoryisthat she almost never gotback up all by herself.Instead, she figured out thatasking for help was a goodwaytoholdontohope.
Here’s just one of thestories she told me: “I hadthis mentor who knew, evenbeforeIdid,thatIwasgoingto be a mathematician. It allstarted when I’d done verypoorlyononeofhistests,and
![Page 1000: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1000.jpg)
Iwenttohisofficeandcried.Allofasudden,hejumpedupoutofhischairand,withoutaword, ran out of the room.When, finally, he came backhe said, ‘Young lady, youshould go to graduate schoolin mathematics. But you’retaking all of the wrongcourses.’ And he had all ofthe courses I should havebeen takingmapped out, andthe personal promises of
![Page 1001: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1001.jpg)
other faculty that they’dhelp.”
About twenty years ago,RhondacofoundedtheEDGEProgram with SylviaBozeman, a fellowmathematician. EDGE standsfor Enhancing Diversity inGraduate Education, and itsmission is to supportwomenand minority studentspursuing doctoral training inmathematics.“Peopleassumeyou have to have some
![Page 1002: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1002.jpg)
special talent to domathematics,” Sylvia hassaid. “They think you’reeither bornwith it, or you’renot. But Rhonda and I keepsaying,‘Youactuallydeveloptheabilitytodomathematics.Don’tgiveup!’ ”
“Therehavebeensomanytimes in my career when Iwanted to pack it in, when Iwanted to give up and dosomething easier,” Rhondatold me. “But there was
![Page 1003: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1003.jpg)
always someonewho, in oneway or another, told me tokeep going. I think everyoneneeds somebody like that.Don’tyou?”
I.There’s an expression in sports:“Race your strengths and trainyourweaknesses.”Iagreewiththewisdom of this adage, but I alsothink it’s important that peoplerecognize that skills improvewithpractice.
![Page 1004: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1004.jpg)
PartIII
GROWINGGRITFROMTHEOUTSIDEIN
![Page 1005: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1005.jpg)
Chapter10
PARENTINGFORGRIT
What can I do to encouragegritinthepeopleIcarefor?
![Page 1006: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1006.jpg)
I’m asked this question atleastonceaday.
Sometimes it’s a coachwho asks; sometimes it’s anentrepreneur or a CEO. Lastweek, it was a fourth-gradeteacher,andtheweekbefore,a math professor at acommunity college. I’ve hadarmy generals and navyadmirals toss me thisquestion, too, butmost oftenit’s a mother or father whoworries that their child isn’t
![Page 1007: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1007.jpg)
close to realizing theirpotential.
Allthepeoplequizzingmearethinkingasparentswould,ofcourse—evenifthey’renotparents. The word parentingderivesfromLatinandmeans“to bring forth.” You’reacting in a parentlike way ifyou’reaskingforguidanceonhow to best bring forthinterest, practice, purpose,and hope in the people youcarefor.
![Page 1008: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1008.jpg)
When I turn the tables andask people for their ownintuitions on how to “parentfor grit,” I get differentanswers.
Somebelievegritisforgedin the crucible of adversity.Others are quick toparaphrase Nietzsche: “Whatdoesn’t kill you makes youstronger.”I Such invocationsconjureanimageofscowlingmothers and fathers
![Page 1009: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1009.jpg)
dispensing endless criticismonthesidelinesofgamesthathad better be victories, orchaining their children to thepiano bench or violin stand,orgroundingthemforthesinofanA–.
This perspective assumesthat offering loving supportand demanding highstandards are two ends of acontinuum, with theauthoritarian parents of the
![Page 1010: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1010.jpg)
gritty far to the right ofcenter.
HadIbeenaroundtoseekopinions a century ago, suchwould have been theperspective of John Watson,then chair of psychology atJohnsHopkinsUniversity.
In his best-selling 1928parenting guide,Psychological Care of Infantand Child, Watson holdsforth on how to raise a child“who loses himself in work
![Page 1011: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1011.jpg)
and play,who quickly learnsto overcome the smalldifficulties in hisenvironment . . . and whofinally enters manhood sobulwarked with stable workand emotional habits that noadversity can quiteoverwhelmhim.”
Here’s Watson’s advice:“Never hug and kiss them.Neverletthemsitinyourlap.If you must, kiss them onceon the forehead when they
![Page 1012: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1012.jpg)
say good night. Shake handswith them in the morning.Givethemapatontheheadifthey have made anextraordinarily good job of adifficulttask.”Watsonfurtherrecommends letting childrencope with problems on theirown “almost from themoment of birth,” rotatingdifferentcaregiverstopreventunhealthy attachment to anyone adult, and otherwiseavoiding the coddling
![Page 1013: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1013.jpg)
affectionthatpreventsachildfrom“conqueringtheworld.”
Occasionally, of course,people take the oppositestance.
They’re convinced thatperseverance and especiallypassionbloomwhenchildrenare lavished withunconditional affection andsupport. These champions ofkinder and gentler parentingadvocate big hugs and longleashes and point out that
![Page 1014: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1014.jpg)
children are by their naturechallenge-seeking creatureswhose innate desire forcompetence needs only ourunconditional love andaffection to reveal itself.Once unfettered by thedemands of imperiousparents, children will followtheir own intrinsic interests,and disciplined practice andresilience in the face ofsetbackswillfollow.
![Page 1015: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1015.jpg)
Onthecontinuumbetweensupportive and demandingparenting, proponents of thispermissive “child-centered”approach fall to the left ofcenter.
Sowhich is it? Isgrit forgedin the crucible ofunrelentingly high standardsor is it nurtured in thewarmembraceoflovingsupport?
![Page 1016: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1016.jpg)
Asascientist,I’mtemptedto answer thatweneedmoreresearchonthetopic.There’salotofresearchonparenting,andsomeresearchongrit,butno research yet on parentingandgrit.
But as a mother of twoteenagers, I don’t have timefor all the data to come in.Like the parents asking methisquestion, I have tomakedecisions today.Mygirls aregrowing up, and each day of
![Page 1017: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1017.jpg)
their lives,myhusbandandIareparenting them,forbetterorforworse.What’smore,asaprofessorandalabdirector,I interact with dozens ofyoungpeople—andI’dliketoencouragetheirgrit,too.
So, as a step towardresolving the debate, I’veprobed the evidence for eachside. An advocate of old-fashioned, strict parentingsuggested I talk to gritparagon Steve Young, the
![Page 1018: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1018.jpg)
record-breaking quarterbackwhose Mormon upbringingincluded a daily paper route,Bible classes before school,and absolutely no cussing ordrinking. Meanwhile, anadvocate with a more liberalbent pointed me towardFrancesca Martinez, theoutspoken British stand-upcomic whose writer fatherand environmentalist motherallowed her to drop out ofschoolwhen shewas sixteen
![Page 1019: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1019.jpg)
and didn’t bat an eye whenshe titled her memoir Whatthe****IsNormal?!
Let’s begin with SteveYoung.
Thelegendaryquarterbackof the San Francisco 49erswas twice named MostValuable Player in theNational Football League.And he was selected MostValuable Player of Super
![Page 1020: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1020.jpg)
BowlXXIX,duringwhichhecompleted a record-breakingsix touchdown passes. Atretirement, he was thehighest-rated quarterback inNFLhistory.
“My parents were myfoundation,” Steve has said.“GoodparentingissomethingIwisheveryonecouldhave.”
Here’s a story to illustratehispoint.
ThoughStevehadbeenthestar of his high school
![Page 1021: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1021.jpg)
footballteamandwasheavilyrecruited by colleges acrossthe country, he enteredBrighamYoungUniversityastheir eighth-stringquarterback. Since sevenother quarterbacks stoodbetween Steve and playingtime,hiscoachrelegatedhimto the“hamburger squad”—aunit composed of the leastvaluable players whoseprimaryrolewastorunplays
![Page 1022: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1022.jpg)
so the BYU defensive linecouldpractice.
“Man, I wanted to gohome,” Steve recalled. “Iwenttoschoolmywholefirstsemester with my bagspacked. . . . I remembercalling [my dad] and justsaying, ‘Coaches don’t knowmy name. I’m just a bigtackling dummy for thedefense. Dad, it’s horrible.And this is just not what I
![Page 1023: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1023.jpg)
expected . . . and I think I’dliketocomehome.’ ”
Steve’s father, whomSteve describes as “theultimate tough guy,” toldhim: “You can quit. . . .Butyoucan’tcomehomebecauseI’m not going to live with aquitter. You’ve known thatsinceyouwereakid.You’renotcomingbackhere.”Stevestayed.
Allseason,Stevewasfirstto practice and last to leave.
![Page 1024: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1024.jpg)
Aftertheteam’slastgame,hestepped up his privateworkouts:“Therewasahugenet hanging at the far end ofthe field house. I squattedbehind an imaginary center;took the snap; did the three-step drop, and threw into thenet. From the beginning ofJanuary to the end ofFebruary,Ithrewover10,000spirals. My arm hurt. But Iwantedtobeaquarterback.”
![Page 1025: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1025.jpg)
Bysophomoreyear,Stevemovedupfromnumber-eightquarterback to number two.By his junior year, he wasBYU’s starting quarterback.In his senior year, Stevereceived the Davey O’Brienaward for the mostoutstanding quarterback inthecountry.
There were several othertimes in his athletic careerwhenhisconfidencefaltered.Each time, he wanted
![Page 1026: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1026.jpg)
desperately to quit. Eachtime,heappealedtohisfather—whowouldn’tlethim.
One early challenge camewhile playing baseball inmiddle school. “I wasthirteen,” Steve recalled. “Ididn’t get a hit the wholeyear,anditjustgotmoreandmoreembarrassing....Gameafter game, I couldn’t get ahit.”When theseasonended,Steve informed his dad thathe’d had it. “My dad looked
![Page 1027: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1027.jpg)
me straight in the eye andsaid, ‘You cannot quit. Youhave the ability, so you needto go back and work thisout.’ ” So Steve and his dadwent back to the field. “Irememberitbeingreallycoldand miserable and rainy andsleet and snow, and he’d bepitching the ball and I’d behitting them.” By his senioryear in high school, ascaptainofthevarsitybaseballteam,Stevewasbatting.384.
![Page 1028: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1028.jpg)
Thelessonthatpersistenceeventually delivers rewardswas one on which Stevereliedinthefouryearshesaton the bench with the SanFrancisco 49ers. Rather thanrequest a trade, Steveapprenticed himself to JoeMontana, the startingquarterback who captainedthe team to four SuperBowlvictories.“IfIwasevergoingto find out just how good Icouldget, Ineededtostayin
![Page 1029: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1029.jpg)
SanFranciscoandlearn,evenif it was brutally hard todo.. . .Imanytimesthoughtabout quitting. . . . I heardboos during my sleeplessnights,butIfearedcallingmydad. I knew what he’d say:‘Enduretotheend,Steve.’ ”
At this point inmy narrativeofSteveYoung’s improbableascent, you might concludethatparentsofgrittychildren
![Page 1030: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1030.jpg)
are authoritarian. You mightleap to the conclusion thatthey’recenteredontheirownstandards and fairlyinsensitive to their children’sparticularneeds.
Before you issue a finalverdict,though,sitdownwithSteve’s parents, Sherry andLeGrandeYoung.Andbeforeyou do, take note thatLeGrande prefers thechildhood nickname thataptlycaptureshisapproachto
![Page 1031: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1031.jpg)
life: “Grit.” “He’s all abouthard work and being toughand not whining,” Steve’sbrotherMikeoncesaidofhisfather. “The name really fitshim.”
As a corporate attorney,Grit Young seldommissed aday of work. About twenty-five years ago, Grit wasworking out at his localYMCA when a fellow gym-goer challenged him to anongoing sit-up competition.
![Page 1032: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1032.jpg)
Afterayear, eachmancoulddo about a thousand sit-upseach, at which point thechallenger bowed out. Bythen, Grit was competingagainst himself. He kept on,for years, until he could dotenthousandsit-upsinarow.
When I called to talk toSteve’s parents about theirfamous son and the waythey’d raisedhim, I expectedsternness and formality. Thefirst thing Sherry said was
![Page 1033: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1033.jpg)
“We’re delighted to talk toyou! Our Steve is a greatkid!” Grit then joked that,given my chosen field ofstudy,hewassurprisedithadtaken me so long to get tothem.
My shoulders softened abit,andIsatbackaseachtoldme how they’d learned towork hard early in life. “Wewere one generation off thefarm,” Sherry explained.“There were expectations.”
![Page 1034: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1034.jpg)
Sherry was picking cherriesbyageten.Gritdidthesame,and to earn money forbaseballmittsandclothes,hemowed lawns, deliverednewspapers on his bike tohouses miles apart, andpicked up whatever farmworkhecould.
Whenitcametimetoraisetheir children, both SherryandGritverydeliberatelysetout to provide the samechallenges. “My goal was to
![Page 1035: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1035.jpg)
teach them discipline,” Gritsaid,“andtogoatthingshardlikeIlearnedtodo.Youhaveto learn those things. Theydon’t just happen. It wasimportant to me to teach thekids to finish what youbegin.”
In no uncertain terms,Steve and his siblings weremade to understand that,whatever they signed up for,theyhad to see it through tothe end. “We told them,
![Page 1036: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1036.jpg)
you’ve got to go to all thepractices.Youcan’tsay,‘Oh,I’m tired of this.’ Once youcommit, you disciplineyourself to do it. There’sgoing to be times you don’twanttogo,butyou’vegottogo.”
Sounds strict, right? Itwas.Butifyoulistenclosely,you’ll discover that theYoungs were alsotremendouslysupportive.
![Page 1037: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1037.jpg)
Steve tells the story ofgetting tackled playing PopWarner football as a nine-year-old and looking up tosee his mom, still carryingher purse, striding right pasthim to grab a boy on theopposing team by theshoulderpadstotellhimthathewouldnotbeillegallynecktackling Steve again. AsSteve and his siblings gotolder, their home became afavorite hangout. “Our
![Page 1038: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1038.jpg)
basement was always filledwithkids,”Sherrysays.
As a corporate attorney,Grit traveled often. “Mostguys I knew would stay forthe weekend, wherever wewere, because you wouldn’tbe finished with yourbusiness on Friday, and youhadtostartagainonMonday.Notme.Ialways,alwaysdideverything I could to gethome for the weekend.”Occasionally, weekend trips
![Page 1039: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1039.jpg)
home were alsodemonstrations of thecharacterthathadearnedGrithisnickname:“OnceIwasinMontana negotiating with analuminumplant.Fridaynight,I take a taxi down to theairport,andit’sallfoggedin.All the flights werecanceled.”
I consideredwhat Imightdo in the same situation, andthen blushed a bit as Ilistened to the rest of the
![Page 1040: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1040.jpg)
story.Gritrentedacar,droveto Spokane, took a flight toSeattle, then a second flightto San Francisco, and finallya third flight—a red-eye thatarrived at JFK the nextmorningatdawn.Hethengotin another rental car anddrove back to Greenwich,Connecticut.“I’mnotpattingmyself on the back,” Gritsaid.“It’sjustthatIthoughtitwas important to bewith thekids, to support them,
![Page 1041: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1041.jpg)
whether it was athleticactivitiesoranythingelse.”
Sherry andGritwere alsoattuned to their children’semotional needs. Steve, forexample, was especiallyanxious. “We noticed therewere thingshewouldn’tdo,”Grit said. “When he was insecond grade, he refused togo to school. When he wastwelve, he wouldn’t go toBoy Scout camp. He neverslept over at another kid’s
![Page 1042: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1042.jpg)
house. He just wouldn’t doit.”
It was hard for me tosquare the image of SteveYoung, fearless all-starquarterback, with the timidboy Sherry and Grit weredescribing. Likewise, neitherSherry norGrit had any ideawhat to make of their oldestson’s fearfulness. One time,Gritsays,hewent topickupStevefromschooltotakehimtohisuncleandaunt’shouse
![Page 1043: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1043.jpg)
fortheday,andStevesimplycouldn’t stop sobbing. Hewaspetrifiedtobeawayfromhis own home. Grit wasflabbergasted. I waited tohear how he and Sherryreacted. Did they tell theirson to man up? Did theyremove some of hisprivileges?
No and no. Grit’sdescriptionof thetalkhehadwith his son when Steverefusedtogotoschoolmakes
![Page 1044: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1044.jpg)
it clear Grit did morequestioningandlisteningthanlecturing and criticizing: “Isaid, ‘Well, is somebodypicking on you?’ He says,‘No.’ Do you like yourteacher? ‘I lovemy teacher.’Well, why don’t you go toschool? ‘I don’t know. I justdon’twanttogotoschool.’ ”
Sherry ended up sitting inSteve’s second-gradeclassroom forweeks until, atlong last, Steve felt
![Page 1045: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1045.jpg)
comfortable going to schoolbyhimself.
“It was separationanxiety,”Sherrytoldme.“Atthe time, we didn’t knowwhat to call it.Butwe couldtell he was all tight inside,andwe knew that he neededtoworkthroughallthat.”
Later,when I askedSteveto elaborate on his firsttroubled semester at BYU, Ipointed out that, if someoneheard only that anecdote and
![Page 1046: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1046.jpg)
nothing else, they mightconcludethathisfather,Grit,was a tyrant. What kind ofparent could refuse a son hispleatoreturnhome?
“Okay,” Steve said. “Allright. Everything iscontextual,right?”
Ilistened.“The contextwas thatmy
dad knew me. He knew all Iwanted to do was sprinthome,andheknewthatifhe
![Page 1047: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1047.jpg)
let me do that, it would belettingmegiveintomyfears.
“It was a loving act,”Steve concluded. “It wastough,butitwasloving.”
Butit’safinelinebetweentoughloveandbullying,isn’tit?What’sthedifference?
“I knew the decision wasmine,” Steve said. “And Iknewmydaddidn’twantmeto be him. Number one, aparent needs to set a stagethat proves to the child, ‘I’m
![Page 1048: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1048.jpg)
nottryingtojusthaveyoudowhatIsay,controlyou,makeyoubelikeme,makeyoudowhat I did, ask you to makeup forwhat I didn’t do.’Mydad showed me early that itwasn’tabouthimandwhatheneeded. It truly was ‘I’mgivingyouallIgot.’
“There was an underlyingselflessness to the toughlove,” Steve continued. “Ithinkthat’svital.Ifanyofthetoughloveisabouttheparent
![Page 1049: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1049.jpg)
just trying to control you,well, kids smell it out. Inevery way possible, I knewmy parents were saying,‘We’re looking to see yoursuccess.We’ve leftourselvesbehind.’ ”
IfgettingtoknowtheYoungshelps you understand that“toughlove”isn’tnecessarilyacontradictioninterms,holdthat thought—and meet
![Page 1050: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1050.jpg)
Francesca Martinez and herparents,TinaandAlex.
NamedbytheObserverasoneof thefunniestcomics inBritain, Francesca performsto sold-out audiences aroundthe world. In a typicalroutine, she breaks the no-cussing rule of the Youngfamily, and after the show,she’s sure to violate thedrinkingprohibition.Likeherparents, Francesca is alifelong vegetarian, not
![Page 1051: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1051.jpg)
religious, and politically,somewhere to the left ofprogressive.
Francesca was diagnosedwith cerebral palsy at agetwo. She prefers the term“wobbly.” Told that theirbrain-damaged daughterwould “never lead a normallife,” Tina and Alex quicklydecided that no doctor couldforetell who their daughtermight become. Achievingcomedicstardomtakesgritno
![Page 1052: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1052.jpg)
matter who you are, butperhaps more so when it’s achallengemerelytoenunciateyour consonants or walk tothe stage. So, like otheraspiring comics, Francescahas endured four-hour drives(eachway)toperformfortenminutesfornopayandmadecountless cold calls toimpassiveandbusytelevisionproducers.Butunlikemostofher peers, she needs to do
![Page 1053: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1053.jpg)
breathingandvoiceexercisesbeforeeachshow.
“Idon’ttakecreditformyhard work and passion,” shetold me. “I think thesequalities came from myfamily, which was veryloving and very stable. Theiroverwhelming support andpositivityarewhythereisnolimittomyambition.”
Not surprisingly,counselors at Francesca’sschool were doubtful of
![Page 1054: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1054.jpg)
entertainmentasacareerpathfor a girl who struggled towalk and talk at a normalcadence. They were evenmore wary of her droppingout of high school to do so.“Oh, Francesca,” they’d saywith a sigh, “think aboutsomething more sensible.Likecomputers.”Thethoughtofanoffice jobwasaboutashorrible a fate as Francescacouldimagine.Sheaskedherparentswhatsheshoulddo.
![Page 1055: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1055.jpg)
“Go and follow yourdreams,” Alex told hisdaughter, “and if they don’twork out, then you canreassess.”
“My mum was just asencouraging,”Francescasaid.Then, with a smile:“Basically, they were happyfor me to leave formaleducationatsixteentoactontelevision.Theyletmespendmy weekends clubbing withfriends, surrounded by leery
![Page 1056: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1056.jpg)
men and cocktails withsexuallyexplicitnames.”
I asked Alex about his“follow your dream” advice.Before explaining, heremindedmethatFrancesca’sbrother Raoul was alsoallowed to drop out of highschool—toapprenticehimselfto a renowned portraitpainter. “We never putpressureon eitherof them tobecomedoctorsorlawyersoranything like that. I truly
![Page 1057: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1057.jpg)
believe that when you dosomethingyoureallywant todo, it becomes a vocation.Francescaandherbrotherareincredibly hard workers, butthey feel passionately abouttheir subjects, so to them it’snotatalloppressive.”
Tinaagreedentirely:“I’vealways had an instinctivesensethat lifeandnatureandevolution have planted inchildren their owncapabilities—their own
![Page 1058: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1058.jpg)
destiny. Like a plant, ifthey’refedandwateredintherightway, theywill grow upbeautiful and strong. It’s justa question of creating therightenvironment—asoilthatis nurturing, that is listeningandresponsivetotheirneeds.Children carry within themtheseedsoftheirownfuture.Their own interests willemergeifwetrustthem.”
Francesca connects theunconditionalsupportthather
![Page 1059: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1059.jpg)
“absurdly cool” parentslavished on her to the hopeshe maintained even whenhope seemed lost: “So muchof sticking with things isbelievingyoucando it.Thatbeliefcomesfromself-worth.And that comes from howothers have made us feel inourlives.”
So far, Alex and Tinaseem the epitome ofpermissiveparenting. I asked
![Page 1060: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1060.jpg)
them whether they seethemselvesassuch.
“Actually,” Alex said, “Ithink I’m allergic to spoiledchildren. Children must belovedandaccepted,but then,without complications, theyneed to be taught: ‘No, youcannot hit your sister on theheadwiththatstick.Yes,youmustshare.No,youdon’tgetto have everything you wantwhen you want it.’ It’s no-nonsenseparenting.”
![Page 1061: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1061.jpg)
As an example, Alexpushed Francesca to do thephysical therapy exercisesprescribed by her doctors.She hated them. For years,she and her father battled.Francesca couldn’tunderstand why she couldn’tsimply work around herlimitations,andAlexbelievedhisresponsibilitywastostandfirm.Asshesaysinherbook:“Though happy in manyways,thenextfewyearswere
![Page 1062: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1062.jpg)
punctuatedwith intense rowsrepletewithdoor-bangingandtears and the throwing ofobjects.”
Whether these skirmishescould have been handledmore skillfully is an openquestion—Alex believes hecould have done a better jobexplaining to his youngdaughter why he was soinsistent.Thatmaybeso,butwhat really strikes me aboutthis aspect of Francesca’s
![Page 1063: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1063.jpg)
childhood is the notion thatan affectionate, follow-your-dreams parent cannevertheless feel compelledto lay down the law onmatters of discipline.Suddenly, the one-dimensionalviewofAlexandTina as hippy-dippy parentsseemsincomplete.
Itwastelling,forexample,tohearAlex,whoisawriter,talk about the work ethic hemodeledforhischildren:“To
![Page 1064: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1064.jpg)
finishthings,youhavetoputthe work in. When I wasyounger, I’d meet manypeople who were writingstuff. They’d say tome, ‘Ohyeah, I am a writer as wellbut I’ve never finishedanything.’Well, in that case,youarenotawriter.Youarejustsomebodywhositsdownandwrites things on a bit ofpaper. If you’ve gotsomething to say, go aheadandsayitandfinishit.”
![Page 1065: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1065.jpg)
Tina agrees that as muchas children need freedom,theyalsoneedlimits.She’satutor as well as anenvironmental activist, andshe’swatchedalotofparentsengage in what she callsbegging-and-pleadingnegotiations with theirchildren. “We taught ourchildren to live by clearprinciples and moralguidelines,” she said. “Weexplained our reasoning, but
![Page 1066: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1066.jpg)
they always knew where theboundarieswere.
“And there was notelevision,”sheadded.“I feltit was a hypnotic medium,andIdidn’twantittoreplaceinteractions with people. Sowe simply didn’t have atelevision. If the childrenwanted to watch somethingspecial,theywouldwalkovertotheirgrandparents’.”
![Page 1067: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1067.jpg)
What can we learn from thestories of Steve Young andFrancesca Martinez? Andwhatcanwegleanfromhowother grit paragons describetheirparents?
In fact, I’ve noticed apattern. For those of us whowant to parent for grit, thepattern is a helpful blueprint,aguide formaking themanydecisions we must grapplewith while raising ourchildren.
![Page 1068: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1068.jpg)
Before I saymore, letmerepeat the caveat that, as ascientist, I’d like to collectmanymoredatapointsbeforecoming to firm conclusions.Inadecade, Ishouldknowalot more about parenting forgrit than I do now. Butbecause there’s no pausebutton for parenting thepeoplewe care about, I’ll goahead and tell you myhunches. In large part, I’mencouraged to do so because
![Page 1069: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1069.jpg)
the pattern I’ve observedmatches up with dozens ofcarefully executed researchstudies on parenting (but notgrit). The pattern alsomakessense, given what’s beenlearned about humanmotivationsinceJohnWatsondispensed his Don’t Coddle’em advice. And, finally, thepatternIseematchesupwiththe interviews of world-classathletes, artists, and scholarscompleted by psychologist
![Page 1070: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1070.jpg)
Benjamin Bloom and histeamthirtyyearsago.Thoughparentingwasnottheexplicitfocus of the Bloom study—parents were originallyincluded as “observers toverify”biographicaldetails—the importance of parentingended up as one of itsmajorconclusions.
HereiswhatIsee.First and foremost, there’s
noeither/ortrade-offbetweensupportive parenting and
![Page 1071: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1071.jpg)
demanding parenting. It’s acommonmisunderstanding tothink of “tough love” as acarefully struck balancebetweenaffectionandrespecton the one hand, and firmlyenforced expectations on theother. In actuality, there’s noreason you can’t do both.Very clearly, this is exactlywhat the parents of SteveYoung and FrancescaMartinez did. The Youngswere tough, but they were
![Page 1072: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1072.jpg)
also loving. The Martinezeswere loving, but they werealso tough. Both familieswere “child-centered” in thesense that they clearly puttheirchildren’s interests first,but neither family felt thatchildren were always thebetter judge of what to do,howhard towork, andwhentogiveuponthings.
Below is a figurerepresenting how manypsychologists now categorize
![Page 1073: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1073.jpg)
parenting styles. Instead ofonecontinuum,therearetwo.In the upper right-handquadrant are parentswho areboth demanding andsupportive. The technicalterm is “authoritativeparenting,” which,unfortunately is easilyconfused with “authoritarianparenting.” To avoid suchconfusion, I’ll refer toauthoritative parenting aswise parenting, because
![Page 1074: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1074.jpg)
parents in this quadrant areaccurate judges of thepsychological needs of theirchildren.Theyappreciatethatchildren need love, limits,andlatitudetoreachtheirfullpotential. Their authority isbased on knowledge andwisdom,ratherthanpower.
![Page 1075: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1075.jpg)
In the other quadrants arethreeothercommonparentingstyles, including theundemanding, unsupportiveapproach to raising childrenexemplified by neglectfulparents. Neglectful parenting
![Page 1076: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1076.jpg)
creates an especially toxicemotional climate, but Iwon’tsaymuchmoreaboutithere because it’s not even aplausible contender for howparentsofthegrittyraisetheirchildren.
Authoritarian parents aredemandingandunsupportive,exactly the approach JohnWatson advocated forstrengthening character inchildren. Permissive parents,
![Page 1077: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1077.jpg)
by contrast, are supportiveandundemanding.
When psychologist LarrySteinberg delivered his 2001presidential address to theSociety for Research onAdolescence, he proposed amoratorium on furtherresearch on parenting stylesbecause, as he saw it, therewassomuchevidenceforthebenefits of supportive anddemanding parenting thatscientists could profitably
![Page 1078: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1078.jpg)
move on to thornier researchquestions. Indeed, over thepast forty years, study aftercarefully designed study hasfound that the children ofpsychologically wise parentsfare better than childrenraised in any other kind ofhousehold.
In one of Larry’s studies,for example, about tenthousandAmerican teenagerscompleted questionnairesabout theirparents’behavior.
![Page 1079: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1079.jpg)
Regardless of gender,ethnicity, social class, orparents’ marital status, teenswith warm, respectful, anddemanding parents earnedhighergradesinschool,weremore self-reliant, sufferedfrom less anxiety anddepression, and were lesslikelytoengageindelinquentbehavior. The same patternreplicates in nearly everynationthat’sbeenstudiedandat every stage of child
![Page 1080: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1080.jpg)
development. Longitudinalresearch indicates that thebenefits are measurableacrossadecadeormore.
One of themajor discoveriesof parenting research is thatwhat matters more than themessages parents aim todeliverarethemessagestheirchildrenreceive.
What may appear to betextbook authoritarian
![Page 1081: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1081.jpg)
parenting—a no-televisionpolicy, for example, or aprohibition against swearing—may or may not becoercive. Alternatively, whatmay seem permissive—say,letting a child drop out ofhigh school—may simplyreflectdifferencesintherulesparentsvalueasimportant.Inother words, don’t passjudgment on that parentlecturing their child in thesupermarket cereal aisle. In
![Page 1082: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1082.jpg)
most cases, you don’t haveenoughcontext tounderstandhow the child interprets theexchange, and, at the end ofthe day, it’s the child’sexperiencethatreallymatters.
Areyouapsychologicallywise parent? Use theparenting assessment on thenext page, developed bypsychologist and parentingexpert Nancy Darling, as achecklist to find out. Howmany of these statements
![Page 1083: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1083.jpg)
would your child affirmwithouthesitation?
You’llnotice thatsomeoftheitemsareitalicized.Theseare “reverse-coded” items,meaning that if your childagreeswiththem,youmaybeless psychologically wisethanyouthink.
Supportive:Warm
IcancountonmyparentstohelpmeoutifIhave
![Page 1084: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1084.jpg)
aproblem.Myparentsspendtimejust
talkingtome.MyparentsandIdothings
thatarefuntogether.Myparentsdon’treallylikemetotellthemmytroubles.
Myparentshardlyeverpraisemefordoingwell.
Supportive:Respectful
MyparentsbelieveIhavearighttomyownpoint
![Page 1085: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1085.jpg)
ofview.MyparentstellmethattheirideasarecorrectandthatIshouldn’tquestionthem.
Myparentsrespectmyprivacy.
Myparentsgivemealotoffreedom.
MyparentsmakemostofthedecisionsaboutwhatIcando.
Demanding
![Page 1086: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1086.jpg)
Myparentsreallyexpectmetofollowfamilyrules.
Myparentsreallyletmegetawaywiththings.
MyparentspointoutwaysIcoulddobetter.
WhenIdosomethingwrong,myparentsdon’tpunishme.
Myparentsexpectmetodomybestevenwhenit’shard.
![Page 1087: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1087.jpg)
Growing up with support,respect, and high standardsconfers a lot of benefits, oneof which is especiallyrelevant to grit—in otherwords, wise parentingencourages children toemulatetheirparents.
To a certain extent, ofcourse, young childrenimitate their mothers andfathers. When we havenothing else to go by, whatother choice do we have,
![Page 1088: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1088.jpg)
really, than to mimic theaccents, habits, and attitudesof thepeople aroundus?Wetalk like they talk. We eatwhattheyeat.Weadopttheirlikesanddislikes.
Ayoungchild’sinstincttocopyadults isverystrong.Ina classic psychologyexperiment conducted morethan fifty years ago atStanford University, forexample, preschoolerswatched adults play with a
![Page 1089: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1089.jpg)
varietyof toysandthenweregiven theopportunity toplaywith the toys themselves.Half of the boys and girlswatchedanadultquietlyplaywith Tinkertoys whileignoring a child-size,inflatable doll in the sameroom. The other half of thechildren watched the adultbegin assembling theTinkertoys and, after aminute, turn to viciouslyattack the doll. The adult
![Page 1090: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1090.jpg)
pummeled the doll with hisfistsandthenamallet,tossedthe doll up in the air and,finally, while screaming andyelling, aggressively kickedthedollabouttheroom.
When given anopportunity to play with thesame toys, children who’dseen adults play quietlyfollowed suit. In contrast,children who’d watchedadults beat up the doll werelikewise aggressive, in many
![Page 1091: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1091.jpg)
cases so closely imitatingviolent adults they’d seenearlier that researchersdescribed their behavior asvirtual“carboncopies.”
Andyet,there’saworldofdifference between imitationandemulation.
As we grow older, wedevelopthecapacitytoreflecton our actions and passjudgmentonwhatweadmireand disdain in others. Whenour parents are loving,
![Page 1092: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1092.jpg)
respectful, and demanding,we not only follow theirexample,werevereit.Wenotonly comply with theirrequests, we understand whythey’re making them. Webecome especially eager topursue the same interests—for instance, it’s nocoincidence that SteveYoung’sfatherwashimselfastandout football player atBYU, or that FrancescaMartinez, like her father,
![Page 1093: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1093.jpg)
developed an early love ofwriting.
Benjamin Bloom and histeam noted the same patternintheirstudiesofworld-classperformers. Almost withoutexception, thesupportiveanddemanding parents inBloom’s studywere “modelsof theworkethicin that theywere regarded as hardworkers,theydidtheirbestinwhatever they tried, theybelieved that work should
![Page 1094: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1094.jpg)
come before play, and thatone should work towarddistantgoals.”Further,“mostoftheparentsfounditnaturaltoencouragetheirchildrentoparticipate in their favoredactivities.” Indeed, one ofBloom’s summaryconclusions was that“parents’ own interestssomehow get communicatedto the child. . . . We foundover and over again that theparents of the pianistswould
![Page 1095: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1095.jpg)
send their child to the tennislessons but they would taketheir child to the pianolessons. And we found justthe opposite for the tennishomes.”
It’s indeed remarkablehow many paragons of grithave toldme,with pride andawe, that their parents aretheir most admired andinfluential role models. Andit’s just as telling that somany paragons have, in one
![Page 1096: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1096.jpg)
way or another, developedverysimilarintereststothoseoftheirparents.Clearly,theseexemplarsofgritgrewupnotjustimitatingtheirparentsbutalsoemulatingthem.
This logic leads to thespeculative conclusion thatnot all children withpsychologically wise parentswill grow up to be gritty,because not allpsychologically wise parentsmodelgrittiness.Thoughthey
![Page 1097: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1097.jpg)
may be both supportive anddemanding, upper-right-quadrantmomsanddadsmayormaynotshowpassionandperseverance for long-termgoals.
If youwant to bring forthgrit in your child, first askhow much passion andperseverance you have foryourownlifegoals.Thenaskyourself how likely it is thatyour approach to parentingencourages your child to
![Page 1098: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1098.jpg)
emulateyou.Iftheanswertothe first question is “a greatdeal,”andyouranswertothesecond is “very likely,”you’re already parenting forgrit.
It’s not just mothers andfathers who lay thefoundationforgrit.
There’salargerecosystemofadults thatextendsbeyondthe nuclear family. All of us
![Page 1099: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1099.jpg)
are“parents”toyoungpeopleother than our own childreninthesensethat,collectively,we are responsible for“bringing forth” the nextgeneration. In this role ofsupportive but demandingmentors to other people’schildren,wecanhaveahugeimpact.
Technology entrepreneurTobi Lütke is a grit paragonwhohadsuchamentorinhislife. Tobi dropped out of his
![Page 1100: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1100.jpg)
Germanhighschoolwhenhewas sixteen without anymemorably positive learningexperiences.Asanapprenticeatanengineeringcompanyinhishometown,hemetJürgen,aprogrammerwhoworkedinasmallroominthebasement.Tobi affectionately describedJürgen as “a long-haired,fifty-something, grizzledrockerwhowould have beenright at home in any HellsAngels gang.” Under his
![Page 1101: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1101.jpg)
tutelage,Tobidiscoveredthatthe learning disabilities he’dbeen diagnosed with as afailing studentdidnothing tohamper his progress as acomputerprogrammer.
“Jürgen was a masterteacher,” Tobi said. “Hecreated an environment inwhich it was not onlypossible but easy to movethrough ten years of careerdevelopmenteveryyear.”
![Page 1102: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1102.jpg)
Eachmorning,Tobiwouldarrive at work to find aprintout of the code he’dwritten the day before,covered in red marker withcomments, suggestions, andcorrections. Jürgen wasunsparing in pointing outspecific ways Tobi’s workcould be better. “This taughtmenottotanglemyegoupinthe code I write,” Tobi said.“There are always ways toimprove it and getting this
![Page 1103: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1103.jpg)
feedbackisagift.”One day, Jürgen asked
Tobi to lead a softwareassignment for GeneralMotors. The company gaveTobi extramoney to buy hisfirst suit for the presentationand installation. Tobiexpected Jürgen todo all thetalking,butthedaybeforetheinstallation, Jürgen casuallyturned to Tobi and told himhehadsomewhereelsetobe.Tobi would be visiting
![Page 1104: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1104.jpg)
GeneralMotorsalone.Fulloftrepidation, Tobi went. Theinstallationwasasuccess.
“This pattern kept onrepeating itself,” Tobi said.“Jürgen somehow knew theextent of my comfort zoneand manufactured situationswhichwereslightlyoutsideit.Iovercamethemthroughtrialanderror, throughdoing. . . .Isucceeded.”
Tobi went on to foundShopify, a softwarecompany
![Page 1105: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1105.jpg)
thatpowerstensofthousandsof online stores and recentlyexceeded $100 million inrevenue.
Infact,emergingresearchonteaching suggests uncannyparallels to parenting. Itseems that psychologicallywise teachers can make ahugedifferenceinthelivesoftheirstudents.
![Page 1106: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1106.jpg)
RonFergusonisaHarvardeconomist who has collectedmore data comparingeffective and ineffectiveteachers thananyoneIknow.In one recent study, Ronpartnered with the GatesFoundation to study studentsand teachers in 1,892different classrooms. Hefound that teachers who aredemanding—whose studentssay of them, “My teacheraccepts nothing less than our
![Page 1107: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1107.jpg)
best effort,”and“Students inthisclassbehavethewaymyteacher wants them to”—produce measurable year-to-year gains in the academicskills of their students.Teachers who are supportiveand respectful—whosestudents say, “My teacherseems to know if somethingis bothering me,” and “Myteacherwantsus toshareourthoughts”—enhancestudents’happiness,voluntaryeffort in
![Page 1108: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1108.jpg)
class,andcollegeaspirations.It’spossible,Ronfinds,to
be a psychologically wiseteacher,justasit’spossibletobe permissive, authoritarian,or negligent. And it’s thewise teachers who seem topromote competence inaddition to well-being,engagement, and high hopesforthefuture.
Recently, psychologistsDavid Yeager and GeoffCohen ran an experiment to
![Page 1109: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1109.jpg)
see what effect the messageof high expectations inconjunction with unflaggingsupporthadonstudents.Theyasked seventh-grade teachersto provide written feedbackon student essays, includingsuggestions for improvementand any words ofencouragement they wouldnormally give. Per usual,teachers filled themarginsofthe students’ essays withcomments.
![Page 1110: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1110.jpg)
Next, teachers passed allof the marked-up essays toresearchers, who randomlysorted them into two piles.On half of the essays,researchers affixed a Post-itnotethatread:I’mgivingyouthesecommentssothatyou’llhavefeedbackonyourpaper.Thiswas the placebo controlcondition.
On the other half of theessays, researchers affixed aPost-it note that read: I’m
![Page 1111: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1111.jpg)
giving you these commentsbecause I have very highexpectations and I know thatyoucanreachthem.Thiswasthewisefeedbackcondition.
Sothatteacherswouldnotsee which student receivedwhich note, and so thatstudentswouldnotnoticethatsome of their classmates hadreceivedadifferentnotethanthey had, researchers placedeach essay in a folder for
![Page 1112: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1112.jpg)
teachers to hand back to thestudentsduringclass.
Students were then giventhe option to revise theiressaysthefollowingweek.
When the essays werecollected, David discoveredthat about 40 percent of thestudents who’d received theplacebo control Post-it notedecided to turn in a revisedessay, compared to abouttwice that number—80percent of the students—
![Page 1113: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1113.jpg)
who’d received the Post-itnote communicating wisefeedback.
Ina replicationstudywitha different sample, studentswho received the wisefeedback Post-it—“I’mgiving you these commentsbecause I have very highexpectations and I know thatyou can reach them”—madetwice as many edits to theiressays as students in theplacebocontrolcondition.
![Page 1114: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1114.jpg)
Most certainly, Post-itnotesarenosubstituteforthedailygestures,comments,andactions that communicatewarmth, respect, and highexpectations. But theseexperimentsdoilluminatethepowerful motivating effectthat a simple message canhave.
Not every grit paragon hashad the benefit of a wise
![Page 1115: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1115.jpg)
father and mother, but everyone I’ve interviewed couldpoint tosomeone in their lifewho,at the right time and inthe right way, encouragedthem to aim high andprovided badly neededconfidenceandsupport.
ConsiderCodyColeman.A couple of years ago,
Codysentmeanemail.He’dseenmyTEDtalkongritandwanted to know if we couldtalk sometime. He thought
![Page 1116: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1116.jpg)
perhaps his personal storymight be helpful. He wasmajoring in electricalengineering and computerscience at MIT and was onthecuspofgraduatingwithanear-perfect GPA. From hisperspective, talent andopportunity had very little todowithhisaccomplishments.Instead, success had been allabout passion andperseverance sustained overyearsandyears.
![Page 1117: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1117.jpg)
“Sure, I said, “let’s talk.”Here’swhatIlearned.
Codywasbornthirtymileseast of Trenton, New Jersey,at the Monmouth CountyCorrectional Institution. Hismother was declared insaneby the FBI and, when Codycame along, was imprisonedfor threatening to kill asenator’s child. Cody hasnever met his father. Cody’sgrandmother took legalcustody of Cody and his
![Page 1118: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1118.jpg)
brothers, and probably savedhis life by doing so. But shewasnotaprototypicallywiseparent.Shemayhavewantedto be loving and strict, butbothherbodyandmindwereindecline.AsCodydescribesit, he was soon doing moreparenting—and cooking andcleaning—thanshewas.
“We were poor,” Codyexplained. “Whenmy schooldidfooddrives,thefoodwentto my family, because we
![Page 1119: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1119.jpg)
were the poorest in theneighborhood. And theneighborhooditselfwasn’tallthat great.My school districtscored below average ineverycategoryimaginable.
“Tomakemattersworse,”Cody continued, “I wasn’treally an athletic or smartperson. I started out inremedialEnglishclasses.Mymath scoreswere average, atbest.”
Andthenwhathappened?
![Page 1120: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1120.jpg)
“One day, my oldestbrother—he was eighteenyears older than me—hecomes home. It was thesummer after my freshmanyearinhighschool.Hedroveup fromVirginia to pick meup to spend two weeks withhim,andonthedrivebacktohis place, he turns and asksme, ‘Where do you want togotocollege?’ ”
Cody told him, “I don’tknow. . . . I want to go to a
![Page 1121: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1121.jpg)
good school. Maybesomewhere like Princeton.”And then immediately, hetookitback:“There’snowayaschoollikePrincetonwouldacceptme.”
“Why wouldn’t Princetontake you?” Cody’s brotheraskedhim.“You’redoingallright in school. If you workharder, if you keep pushingyourself, you can get to thatlevel. You have nothing tolosebytrying.”
![Page 1122: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1122.jpg)
“That’s when a switchflipped in my head,” Codysaid. “I went from ‘Whybother?’ to ‘Why not?’ Iknew I might not get into areally good college, but Ifigured, if I try, I have achance. If I never try, then Ihavenochanceatall.”
Thenextyear,Codythrewhimself into his schoolwork.ByjunioryearhewasearningstraightAs.Asasenior,Codyset about finding the best
![Page 1123: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1123.jpg)
college in the country forcomputer science andengineering. He changed hisdream school from Princetonto MIT. During thistransformativeperiod,hemetChantel Smith, anexceptionally wise mathteacher who all but adoptedhim.
It was Chantel who paidforCody’sdriving lessons. Itwas Chantel who collected a“college dorm fund” to pay
![Page 1124: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1124.jpg)
for the supplies he’d needonce he moved. It wasChantelwhomailedsweaters,hats,gloves,andwarmsocksto him for the cold Bostonwinters, who worried abouthim every day, whowelcomed him home eachholiday break, who stood byCody at his grandmother’sfuneral. It was in Chantel’shome that Cody firstexperienced waking onChristmas morning to
![Page 1125: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1125.jpg)
presents with his name onthem, where he decoratedEastereggsfor thefirst time,and where, at the age oftwenty-four, he had his firstfamilybirthdayparty.
MIT wasn’t entirelysmooth sailing, but the newchallenges came with an“ecosystem of support,” asCody put it. Deans,professors, older students inhisfraternity,roommates,andfriends—compared to what
![Page 1126: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1126.jpg)
he’dexperiencedgrowingup,MITwasahavenofattention.
After graduating with tophonors,Codystayedontogethis master’s in electricalengineering and computerscience, earning a perfectGPA while doing so and, atthesametime,fieldingoffersfrom doctoral programs andSiliconValleyrecruiters.
In deciding between animmediately lucrative careerand graduate school, Cody
![Page 1127: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1127.jpg)
didsomehardthinkingabouthowhe’d gotten towhere hewas. Next fall, he’ll begin aPhD program in computerscience at Stanford. Here’sthe first sentence from hisapplication essay: “Mymission is to utilize mypassion for computer scienceand machine learning tobenefitsocietyatlarge,whileserving as an example ofsuccess that will shape thefutureofoursociety.”
![Page 1128: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1128.jpg)
So,CodyColemandidnothave a psychologically wisemother, father, orgrandparent. I wish he had.What he did have was abrother who said the rightthing at the right time, anextraordinarily wise andwonderful high school mathteacher, and an ecosystemofother teachers, mentors, andfellow students whocollectively showed him
![Page 1129: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1129.jpg)
what’s possible and helpedhimtogetthere.
Chantel refuses to takecredit for Cody’s success.“The truth is that Cody hastouched my life more thanI’ve touchedhis.He’s taughtmethatnothingisimpossibleandno goal is beyond reach.He’s one of the kindesthuman beings I have evermet, and I couldn’t beprouder when he calls me‘Mom.’ ”
![Page 1130: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1130.jpg)
A local radio stationrecently interviewed Cody.Toward the end of theconversation, Cody wasasked what he had to say tolisteners struggling toovercome similar lifecircumstances. “Staypositive,” Cody said. “Gopast those negative beliefs inwhat’s possible andimpossible and just give it atry.”
![Page 1131: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1131.jpg)
Cody had these finalwords:“Youdon’tneedtobeaparent tomakeadifferencein someone’s life. If you justcare about them and get toknow what’s going on, youcan make an impact. Try tounderstand what’s going onin their life and help themthrough that. That’ssomething I experiencedfirsthand. It made thedifference.”
![Page 1132: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1132.jpg)
I. When I hear that, I sometimesinterrupt with a précis of SteveMaier’s research showing that, infact, finding a way out of thesuffering is what does thestrengthening.
![Page 1133: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1133.jpg)
Chapter11
THEPLAYINGFIELDSOFGRIT
![Page 1134: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1134.jpg)
Oneday,whenshewasaboutfour years old, my daughterLucy sat at thekitchen table,strugglingtoopenalittleboxof raisins. She was hungry.Shewantedthoseraisins.Butthetopofthatboxstubbornlyresisted her efforts. After aminute or so, she put downtheunopenedboxwithasighand wandered off. I waswatching fromanother room,and Inearlygasped.Ohgod,my daughter has been
![Page 1135: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1135.jpg)
defeated by a box of raisins!Whataretheoddsshe’llgrowuptohaveanygrit?
I rushed over andencouragedLucytotryagain.I did my best to be bothsupportive and demanding.Nevertheless,sherefused.
Not long after, I found aballet studio around thecornerandsignedherup.
Likealotofparents,Ihada strong intuition that grit isenhanced by doing activities
![Page 1136: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1136.jpg)
likeballet...orpiano...orfootball . . . or really anystructured extracurricularactivity. These activitiespossess two importantfeatures that are hard toreplicate inanyother setting.First, there’s an adult incharge—ideally, a supportiveand demanding one—who isnot the parent. Second, thesepursuits are designed tocultivate interest, practice,purpose,andhope.Theballet
![Page 1137: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1137.jpg)
studio, the recital hall, thedojo,thebasketballcourt,thegridiron—these are theplayingfieldsofgrit.
The evidence onextracurricular activities isincomplete. I cannot point toa single study in which kidshavebeenrandomlyassignedto play a sport or musicalinstrument, compete on thedebate team, hold an after-
![Page 1138: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1138.jpg)
school job, or work on theschool newspaper. If youthink about it for a moment,you’llrealizewhy.Noparentwants to volunteer their kidsto do things (or not) by theflipofacoin,and forethicalreasons, no scientist canreallyforcekidstostayin(orout)ofactivities.
Nevertheless, as a parentand as a social scientist, Iwould recommend that, assoon as your child is old
![Page 1139: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1139.jpg)
enough, you find somethingthey might enjoy doingoutsideofclassandsignthemup. In fact, if I couldwaveamagicwand, I’d have all thechildren in the world engageinat leastoneextracurricularactivityoftheirchoice,andasfor those in high school, I’drequirethattheystickwithatleast one activity for morethanayear.
Do I think every momentof a child’s day should be
![Page 1140: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1140.jpg)
scripted?Not at all.But Idothink kids thrive when theyspend at least some part oftheir week doing hard thingsthatinterestthem.
Like I said, the evidence forsuch a bold recommendationis incomplete. But theresearch that has been doneis, in my view, highlysuggestive.Putitalltogether,and you have a compelling
![Page 1141: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1141.jpg)
case for kids learning grit atthe elbow of a wise balletinstructor, football coach, orviolinteacher.
For starters, a fewresearchers have equippedkids with beepers so that,throughout the day, they canbe prompted to report onwhat they’re doing and howtheyfeelatthatverymoment.When kids are in class, theyreport feeling challenged—but especially unmotivated.
![Page 1142: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1142.jpg)
Hanging out with friends, incontrast, is not verychallenging but super fun.And what aboutextracurricular activities?Whenkidsareplayingsportsormusicorrehearsingfortheschool play, they’re bothchallenged and having fun.There’s no other experiencein the lives of young peoplethat reliably provides thiscombinationofchallengeandintrinsicmotivation.
![Page 1143: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1143.jpg)
The bottom line of thisresearch is this: School’shard, but for many kids it’snot intrinsically interesting.Texting your friends isinteresting, but it’s not hard.But ballet? Ballet can beboth.
In-the-moment experience isone thing, but what aboutlong-term benefits? Do
![Page 1144: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1144.jpg)
extracurriculars pay off inanymeasurableway?
There are countlessresearch studies showing thatkids who are more involvedin extracurriculars fare betteron just about everyconceivable metric—theyearn better grades, havehigher self-esteem, are lesslikelytogetintroubleandsoforth. A handful of thesestudies are longitudinal,meaning that researchers
![Page 1145: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1145.jpg)
waited to seewhat happenedto kids later in life. Theselonger-term studies come tothe same conclusion: moreparticipation in activitiespredictsbetteroutcomes.
The same research clearlyindicates that overdosing onextracurricularsisprettyrare.These days, the averageAmerican teenager reportsspending more than threehours a day watchingtelevision and playing video
![Page 1146: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1146.jpg)
games. Additional time isdrainedawaycheckingsocialmedia feeds, texting friendslinks to cat videos, andtracking the Kardashians astheyfigureoutwhichoutfittowear—whichmakesithardtoargue that time can’t bespared for the chess club orthe schoolplay,or justaboutany other structured, skill-focused, adult-guidedactivity.
![Page 1147: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1147.jpg)
Butwhataboutgrit?Whatabout accomplishingsomethingthattakesyears,asopposed tomonths,ofwork?Ifgritisaboutstickingwithagoalfor thelong-term,andifextracurricularactivitiesareaway of practicing grit, itstands to reason that they’reespeciallybeneficialwhenwedothemformorethanayear.
In fact, lessons learnedwhile working to improvefrom one season to the next
![Page 1148: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1148.jpg)
come up repeatedly in myinterviews with paragons ofgrit.
Here’sanexample:Afteralackluster passing season hisjunior year of high schoolfootball, future NFL Hall ofFamer Steve Young wentdown to the high schoolwoodshop and fashioned awoodenfootballwithtapeforlaces.Inoneend,hescrewedinaneyehookandused thatto latch the football to a
![Page 1149: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1149.jpg)
weight machine in the highschool gym. Then, grippingthe ball, he’d move it backandforthinapassingmotion,the added resistancedeveloping his forearms andshoulders. His passingyardage doubled the nextyear.
Even more convincingevidence for the benefits oflong-term extracurricularactivitiescomesfromastudyconducted by psychologist
![Page 1150: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1150.jpg)
Margo Gardner. Margo andhercollaboratorsatColumbiaUniversity followed eleventhousandAmerican teenagersuntil they were twenty-sixyearsoldtoseewhateffect,ifany, participating in highschool extracurriculars fortwoyears, asopposed to justone,mighthaveonsuccessinadulthood.
Here’swhatMargofound:kids who spend more than ayear in extracurriculars are
![Page 1151: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1151.jpg)
significantly more likely tograduatefromcollegeand,asyoung adults, to volunteer intheircommunities.Thehoursper week kids devote toextracurriculars also predicthaving a job (as opposed tobeingunemployedasayoungadult) and earning moremoney,butonlyforkidswhoparticipate in activities fortwoyearsratherthanone.
![Page 1152: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1152.jpg)
One of the first scientists tostudy the importance offollowing through withextracurricular activities—asopposed to just dabbling—wasWarrenWillingham.
In 1978, Willingham wasthe director of the PersonalQualitiesProject.Eventoday,this study remains the mostambitious attempt ever toidentify the determinants ofsuccessinyoungadulthood.
![Page 1153: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1153.jpg)
Theprojectwasfundedbythe Educational TestingService. ETS, as it’s morecommonly called, occupies asprawling campus inPrinceton, New Jersey, andemploys more than athousand statisticians,psychologists, and otherscientists—all devoted to thedevelopment of tests thatpredictachievementinschooland theworkplace. If you’vetaken the SAT, you’ve taken
![Page 1154: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1154.jpg)
an ETS test. Ditto for theGRE, TOEFL, Praxis, andany one of three dozenadvanced placement exams.Basically, ETS is tostandardized testing whatKleenex is to tissues: Sure,there are other organizationsthat make standardized tests,but most of us are hard-pressed to think of theirnames.
So,whatmotivatedETStolook beyond standardized
![Page 1155: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1155.jpg)
tests?Better than anyone,
Willingham and otherscientists at ETS knew that,together, high school gradesand test scores did only ahalf-decent job of predictingsuccess later in life. It’sveryoften the case that two kidswith identicalgradesand testscoreswillendupfaringverydifferently later in life. Thesimple question Willinghamset out to answer wasWhat
![Page 1156: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1156.jpg)
other personal qualitiesmatter?
To find out,Willingham’steam followed severalthousand students for fiveyears, beginning in theirsenioryearofhighschool.
At the start of the study,college application materials,questionnaires, writingsamples, interviews, andschoolrecordswerecollectedfor each student. Thisinformation was used to
![Page 1157: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1157.jpg)
producenumericalratingsformore than one hundreddifferent personalcharacteristics. Theseincluded family backgroundvariables, like parentoccupation andsocioeconomicstatus,aswellas self-declared careerinterests, motivation for acollege degree, educationalgoals,andmanymore.
Then, as the studentsprogressed through college,
![Page 1158: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1158.jpg)
objectivemeasuresofsuccesswere collected across threebroad categories: First, didthestudentdistinguishhimorherself academically? Next,as a young adult, did thisindividual demonstrateleadership? And, finally, towhat extent could theseyoungmenandwomenpointto a significantaccomplishment in scienceand technology, the arts,sports, writing and speaking,
![Page 1159: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1159.jpg)
entrepreneurism, orcommunityservice?
In a sense, the PersonalQualitiesProjectwasahorserace. Each of the hundred-plus measures at the start ofthe study could have endedup as the strongest predictorof later success. It’s clearfrom reading the first report,completed several yearsbefore the final data werecollected, that Willinghamwas entirely dispassionate on
![Page 1160: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1160.jpg)
the issue. He methodicallydescribed each variable, itsrationale for being included,how itwasmeasured, and soon.
Butwhenallthedatawerefinally in, Willingham wasunequivocal and emphaticaboutwhathe’dlearned.Onehorsedidwin, andbya longstretch:follow-through.
This is how Willinghamandhisteamputanumberonit:“Thefollow-throughrating
![Page 1161: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1161.jpg)
involved evidence ofpurposeful, continuouscommitment to certain typesof activities (in high school)versus sporadic efforts indiverseareas.”
Studentswhoearnedatopfollow-through ratingparticipated in two differenthigh school extracurricularactivities for several yearseach and, in both of thoseactivities, advancedsignificantly in some way
![Page 1162: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1162.jpg)
(e.g., becoming editor of thenewspaper,winningMVPforthe volleyball team, winninga prize for artwork). As anexample, Willinghamdescribed a student whowas“on his school newspaperstaff for three years andbecamemanagingeditor,andwas on the track team forthree years and ended upwinninganimportantmeet.”
In contrast, students whohadn’tparticipatedinasingle
![Page 1163: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1163.jpg)
multiyear activity earned thelowest possible follow-throughrating.Somestudentsin this category didn’tparticipateinanyactivitiesatall inhighschool.Butmany,many others were simplyitinerant, joining a club orteam one year but then, thefollowingyear,movingon tosomethingentirelydifferent.
The predictive power offollow-through was striking:After controlling for high
![Page 1164: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1164.jpg)
school grades and SATscores, follow-through inhigh school extracurricularspredicted graduating fromcollegewithacademichonorsbetter than any variable.Likewise,follow-throughwasthe single best predictor ofholding an appointed orelected leadership position inyoung adulthood. And,finally,better thananyof themore than one hundredpersonal characteristics
![Page 1165: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1165.jpg)
Willingham had measured,follow-through predictednotable accomplishments forayoungadult inalldomains,from the arts and writing toentrepreneurism andcommunityservice.
Notably, the particularpursuits to which studentshad devoted themselves inhigh school didn’t matter—whetheritwastennis,studentgovernment, or debate team.Thekeywasthatstudentshad
![Page 1166: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1166.jpg)
signed up for something,signedupagainthefollowingyear,andduringthattimehadmadesomekindofprogress.
I learned about the PersonalQualities Project a few yearsafter I started studying grit.When I gotmyhandson theoriginalstudyreport,Ireaditcover to cover, put it downfor a moment, and thenstartedagainonpageone.
![Page 1167: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1167.jpg)
That night, I couldn’tsleep. Instead, I lay awakethinking:Holy smokes!WhatWillingham calls “follow-through” sounds a lot likegrit!
Immediately—desperately—I wanted to see if I couldreplicatehisfindings.
Onemotivewaspractical.Like any self-report
questionnaire, the Grit Scaleis ridiculously fakeable. Inresearch studies, participants
![Page 1168: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1168.jpg)
have no real incentive to lie,butit’shardtoimagineusingtheGritScaleinahigh-stakessettingwhere, in fact, there’ssomething to gain bypretending that “I finishwhatever I begin.”Quantifying grit asWillingham had done was ameasurement strategy thatcould not easily be gamed.Not,atleast,withoutoutrightlying. In Willingham’s ownwords: “Looking for clear
![Page 1169: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1169.jpg)
signs of productive follow-through is a useful way tomine the student’s trackrecord.”
But the more importantgoal was to see whetherfollow-throughwouldpredictthesameshowing-up-instead-of-dropping-out outcomesthatarethehallmarkofgrit.
For the support of a newlongitudinalstudy,Iturnedtothe largest philanthropicfunder in education: the Bill
![Page 1170: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1170.jpg)
and Melinda GatesFoundation.
I soon learned that thefoundation is especiallyinterested in why collegestudents drop out in suchlargenumbers.Atpresent,thedropout rate for two- andfour-year colleges in theUnited States is among thehighest in the world.Escalating tuitions and thebyzantine labyrinth offinancial aid in this country
![Page 1171: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1171.jpg)
are two contributing factors.Woefully inadequateacademic preparation isanother. Still, students withsimilar financialcircumstances and identicalSAT scores drop out at verydifferent rates. Predictingwho will persist throughcollege and earn their degreeandwhowon’t is among themoststubbornproblemsinallofsocialscience.Nobodyhasaverysatisfyinganswer.
![Page 1172: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1172.jpg)
InameetingwithBillandMelinda Gates, I had anopportunity to explain myperspective in person.Learning to follow throughon something hard in highschool, I said, seemed thebest-possible preparation fordoing the same thing later inlife.
In that conversation, Ilearned that Bill himself haslong appreciated theimportance of competencies
![Page 1173: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1173.jpg)
other than talent.Back in thedays when he had a moredirect role in hiring softwareprogrammers at Microsoft,forinstance,hesaidhe’dgiveapplicants a programmingtask he knew would requirehours and hours of tedioustroubleshooting. This wasn’tan IQ test, or a test ofprogrammingskills.Rather,itwas a test of a person’sability to muscle through,presson,gettothefinishline.
![Page 1174: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1174.jpg)
Bill only hired programmerswho finished what theybegan.
With generous support fromthe Gates Foundation, Irecruited 1,200 seniors and,justasWillinghamhaddone,asked them to name theirextracurricular activities (ifthey had any), when they’dparticipatedinthem,andhowthey’d distinguished
![Page 1175: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1175.jpg)
themselves doing them, if atall.Aroundthelab,whilewewere doing this study, webegan calling this measurewhat it looks like: the GritGrid.
Directions: Please listactivities in which youspent a significantamount of time outsideof class. They can beany kind of pursuit,including sports,
![Page 1176: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1176.jpg)
extracurricularactivities, volunteeractivities,research/academicactivities,paidwork,orhobbies. If you do nothave a second or thirdactivity, please leavethoserowsblank:
Activity Gradelevelsof
participation9-10-11-12
Achievements,awards,
leadership
![Page 1177: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1177.jpg)
positions,ifany
Following Willingham’slead, my research teamcalculatedGritGridscoresbyquantifying multiyearcommitment and
![Page 1178: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1178.jpg)
advancement in up to twoactivities.
Specifically, each activitystudents did for twoyears ormore earned a grit point;activities students did foronly one year earned nopoints and weren’t scoredfurther. Activities thatstudents pursued formultipleyearsandinwhichtheycouldpoint to some kind ofadvancement (for example,member of the student
![Page 1179: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1179.jpg)
government one year andtreasurer the next) eachearned a second point.Finally, when advancementcould reasonably be deemed“high”versusjust“moderate”(president of the studentbody,MVPof the basketballteam, employee of themonth), we awarded a thirdgritpoint.
In sum, students couldscoreanywherefromzeroonthe Grit Grid (if they’d
![Page 1180: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1180.jpg)
participated in no multiyearcommitments at all) to sixpoints (if they pursued twodifferent multiyearcommitments and, in both,demonstrated highachievement).
As expected, we foundthatstudentswithhigherGritGrid scores rated themselveshigheringrit,andsodidtheirteachers.
Thenwewaited.
![Page 1181: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1181.jpg)
Aftergraduatingfromhighschool,studentsinoursampleended up at dozens ofcolleges throughout thecountry.Aftertwoyears,only34 percent of the 1,200students in our study wereenrolled in a two- or four-year college. Just as weexpected, theoddsof stayingin school depended heavilyon Grit Grid scores: 69percent of students whoscored6outof6on theGrit
![Page 1182: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1182.jpg)
Gridwere still in college. Incontrast, just 16 percent ofstudents who scored 0 out 6werestillontracktogettheircollegedegrees.
In a separate study, weapplied the same Grit Gridscoring system to thecollegeextracurriculars of noviceteachers. The results werestrikingly similar. Teacherswho, in college, haddemonstrated productivefollow-through in a few
![Page 1183: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1183.jpg)
extracurricular commitmentswere more likely to stay inteaching and, furthermore,were more effective inproducing academic gains intheir students. In contrast,persistence and effectivenessinteachinghadabsolutelynomeasurable relationship withteachers’ SAT scores, theircollegeGPAs, or interviewerratings of their leadershippotential.
![Page 1184: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1184.jpg)
Considered together, theevidenceI’vepresentedsofarcould be interpreted in twodifferent ways. I’ve beenarguing that extracurricularactivitiesareawayforyoungpeople to practice, andthereforedeveloppassionandperseverance, for long-termgoals. But it’s also possiblethat following through withextracurriculars is somethingonly gritty people do. Theseexplanations aren’t mutually
![Page 1185: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1185.jpg)
exclusive: it’s entirelypossible that both factors—cultivationandselection—areatplay.
My best guess is thatfollowing through on ourcommitmentswhilewe growup both requires grit and, atthesametime,buildsit.
One reason I think so isthat,ingeneral,thesituationsto which people gravitatetend to enhance the verycharacteristicsthatbroughtus
![Page 1186: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1186.jpg)
there in the first place. Thistheory of personalitydevelopmenthasbeendubbedthe corresponsive principleby Brent Roberts, theforemost authority on whatleads to enduring changes inhow people think, feel, andactindifferentsituations.
When Brent was apsychology graduate studentat Berkeley, the prevailingview was that, afterchildhood, personalities are
![Page 1187: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1187.jpg)
moreorless“setlikeplaster.”Brent and other personalityresearchers have sincecollectedenough longitudinaldata—following, literally,thousands of people acrossyears and decades—to showthat personalities do, in fact,changeafterchildhood.
Brent and otherpersonality researchers havefound that a key process inpersonality developmentinvolves situations and
![Page 1188: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1188.jpg)
personality traits reciprocally“calling” each other. Thecorresponsive principlesuggests that the very traitsthat steer us toward certainlife situations are the verysame traits that thosesituations encourage,reinforce,andamplify.Inthisrelationship there is thepossibility of virtuous andviciouscycles.
Forinstance,inonestudy,Brent and his collaborators
![Page 1189: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1189.jpg)
followed a thousandadolescents in New Zealandastheyenteredadulthoodandfound jobs. Over the years,hostile adolescents ended upin lower-prestige jobs andreported difficulties payingtheir bills. These conditions,in turn, led to increases inlevels of hostility, whichfurther eroded theiremployment prospects. Bycontrast, more agreeableadolescentsenteredavirtuous
![Page 1190: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1190.jpg)
cycle of psychologicaldevelopment. These “nicekids” secured higher-statusjobsofferinggreaterfinancialsecurity—outcomes thatenhanced their tendencytowardsociability.
Sofar, therehasn’tbeenacorresponsive principle studyofgrit.
Let me speculate, though.Left to her own devices, alittlegirlwho,afterfailingtoopen a box of raisins and
![Page 1191: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1191.jpg)
sayingtoherself,“Thisistoohard! I quit!” might enter avicious cycle that reinforcesgivingup.Shemightlearntogive up one thing afteranother, each time missingthe opportunity to enter thevirtuous cycle of struggle,followed by progress,followedbyconfidencetotrysomethingevenharder.
Butwhataboutalittlegirlwhose mother takes her toballet, even though it’shard?
![Page 1192: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1192.jpg)
Even though the little girldoesn’treallyfeellikeputtingonherleotardatthatmoment,because she’s a little tired.Even though, at the lastpractice, her ballet teacherscolded her for holding herarms the wrong way, whichclearly stung a bit. What ifthat little girl was nudged totry and try again and, at onepractice, experienced thesatisfaction of abreakthrough? Might that
![Page 1193: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1193.jpg)
victory encourage the littlegirl topracticeotherdifficultthings? Might she learn towelcomechallenge?
The year after WarrenWillingham published thePersonal Qualities Project,Bill Fitzsimmons became thedean of admissions atHarvard.
Two years later, when Iapplied to Harvard, it was
![Page 1194: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1194.jpg)
Bill who reviewed myapplication. I know because,at some point as anundergraduate, I foundmyself involved in acommunity service projectwith Bill. “Oh, Miss SchoolSpirit!” he exclaimed whenwewereintroduced.Andthenhetickedoff,withremarkableaccuracy, the variousactivities I’d pursued in highschool.
![Page 1195: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1195.jpg)
IrecentlycalledBilltoaskwhat he thought aboutextracurricular follow-through. Not surprisingly, hewas intimately familiar withWillingham’sresearch.
“I have it heresomewhere,” he said,seemingly scanning hisbookshelf. “It’s never farfromreach.”
Okay,sodidheagreewithWillingham’s conclusions?Did Harvard admissions
![Page 1196: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1196.jpg)
really care about anythingother than SAT scores andhighschoolgrades?
Iwantedtoknow,becauseWillingham’s opinion, at thetime he published hisfindings, was that collegeadmissions offices weren’tweighing follow-through inextracurriculars as heavily ashis research suggested theyoughttobe.
Each year, BillFitzsimmons explained,
![Page 1197: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1197.jpg)
several hundred students areadmitted to Harvard on themerits of truly outstandingacademic credentials. Theirearly scholarlyaccomplishments suggestthey will at some pointbecome world-classacademics.
But Harvard admits atleast as many students who,inBill’swords,“havemadeacommitment to pursuesomething they love, believe
![Page 1198: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1198.jpg)
in, and value—and [havedone] so with singularenergy, discipline, and plainoldhardwork.”
Nobody in the admissionsoffice wants or needs thesestudents to pursue the sameactivities when they get tocampus. “Let’s take athleticsas an example,” Bill said.“Let’s say the person getshurt,ordecidesnottoplay,ordoesn’tmake the team.Whatwehavetendedtofindisthat
![Page 1199: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1199.jpg)
all that energy, drive, andcommitment—all that grit—that was developed throughathletics can almost alwaysbe transferred to somethingelse.”
Bill assured me that, infact,Harvardwas paying theutmost attention to follow-through.Afterdescribingourmore recent researchconfirming Willingham’sfindings, he toldme they areusing a very similar rating
![Page 1200: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1200.jpg)
scale: “We ask ouradmissionsstafftodoexactlywhat it appears you’re doingwithyourGritGrid.”
This helped explain whyhe’dmaintained such a clearmemory, more than a yearafter he’d read myapplication, of how I’d spentmytimeoutsideofclasses inhigh school. It was in myactivities, as much asanything else in my record,that he found evidence that
![Page 1201: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1201.jpg)
I’d prepared myself for therigors—and opportunities—ofcollege.
“My sense, from being inadmissions for over fortyyears,” Bill concluded, “isthat most people are bornwith tremendous potential.The real question is whetherthey’reencouragedtoemploytheirgoodold-fashionedhardwork and their grit, if youwill, to its maximum. In theend,thosearethepeoplewho
![Page 1202: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1202.jpg)
seem to be the mostsuccessful.”
I pointed out thatextracurricular follow-through might be a meresignal of grit, rather thansomethingthatwoulddevelopit.Billagreed,butreaffirmedhis judgment that activitiesaren’t just a signal. Hisintuition was that followingthrough on hard thingsteaches a young personpowerful, transferable
![Page 1203: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1203.jpg)
lessons. “You’re learningfrom others, you’re findingout more and more throughexperience what yourpriorities are, you’redevelopingcharacter.
“In some cases,” Billcontinued, “students get intoactivities because somebodyelse, maybe the parent,maybe the counselor,suggests it. But what oftenhappens is that theseexperiences are actually
![Page 1204: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1204.jpg)
transformative, and thestudents actually learnsomething very important,and then they jump in andcontribute to these activitiesin ways that they and theirparents and their counselorneverwould’veimagined.”
What surprised me mostabout my conversation withBill was how much heworriedaboutthekidswho’d
![Page 1205: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1205.jpg)
been denied the opportunityto practice grit inextracurricularactivities.
“More and more highschools have diminished oreliminatedartsandmusicandotheractivities,”Billtoldme,and then explained that, ofcourse, it was primarilyschools serving poor kidswhoweremaking these cuts.“It’s the least level playingfield one could possiblyimagine.”
![Page 1206: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1206.jpg)
Research by Harvardpolitical scientist RobertPutnam and his collaboratorsreveals that affluentAmerican high schoolstudents have beenparticipating inextracurricular activities atconsistentlyhighratesforthepastfewdecades.Incontrast,participation among poorstudents has been droppingprecipitously.
![Page 1207: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1207.jpg)
The widening gap inextracurricular participationbetween rich and poor has afew contributing factors,Putnam explains. Pay-to-playsportsactivities like travelingsoccerteamsareoneobstacleto equal participation. Evenwhen participation is “free,”not all parents can afford theuniforms.Not all parents areable or willing to drive theirkidstoandfrompracticesandgames.Formusic,thecostof
![Page 1208: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1208.jpg)
private lessons andinstruments can beprohibitive.
JustasPutnamwouldhavepredicted, there is aworrisome correlationbetween family income andGritGridscores.Onaverage,GritGrid scores for the highschool seniors in our samplewho qualified for federallysubsidized meals were a fullpoint lower than those for
![Page 1209: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1209.jpg)
students who were moreprivileged.
Like Robert Putnam,Geoffrey Canada is aHarvard-trained socialscientist.
Geoff is about asgritty asthey come. His passion isenabling kids growing up inpoverty to realize theirpotential.Recently,Geoffhasbecome something of a
![Page 1210: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1210.jpg)
celebrity. But for decades hetoiled in relativeobscurityasthe director of a radicallyintensive education programinNewYork City called theHarlemChildren’sZone.Thefirst kids to make it all theway through are now incollege, and the program’sunusually comprehensiveapproach, coupled withunusually successful results,has attracted nationalattention.
![Page 1211: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1211.jpg)
A few years ago, Geoffcame to Penn to deliver ourcommencement speech. Imanaged to shoehorn aprivatemeeting intohisbusyschedule. Given our limitedtime, I got straight to thepoint.
“I know you’re trained asa social scientist,” I began.“AndIknowthereare thingswehave tonsofevidence forandaren’tdoingineducation,and there are thingswe have
![Page 1212: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1212.jpg)
no evidence for and keepdoinganyway. But Iwant toknow, from all you’ve seenand done, what you reallythink is the way to dig kidsoutofpoverty.”
Geoff sat forward and puthishandstogetherlikehewasabout to pray. “I’ll tell youstraight. I’ma fatherof four.I’ve watched many, manykids who were not my owngrow up. Imay not have therandom-assignment, double-
![Page 1213: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1213.jpg)
blindstudiestoproveit,butIcan tell you what poor kidsneed.Theyneedallthethingsyou and I give to our ownchildren.Whatpoorkidsneedisalot.Butyoucansumitupbysayingthatwhattheyneedisadecentchildhood.”
About a year later, Geoffgave a TED talk, and I waslucky enough to be in theaudience. Much of whatHarlem Children’s Zone did,Canadaexplained,wasbased
![Page 1214: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1214.jpg)
on rock-solid scientificevidence—preschooleducation, for instance, andsummerenrichmentactivities.But there’s one thing hisprogram provided withoutsufficient scientific evidenceto justify the expense:extracurricularactivities.
“You know why?” heasked. “Because I actuallylikekids.”
Theaudiencelaughed,andhe said it again: “I actually
![Page 1215: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1215.jpg)
likekids.”“You’ve never read a
study from MIT that saysgiving your kid danceinstruction is going to helpthem do algebra better,” headmitted. “But youwill givethatkiddanceinstruction,andyou will be thrilled that thatkid wants to do danceinstruction, and it will makeyourday.”
![Page 1216: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1216.jpg)
GeoffreyCanada is right.AlltheresearchI talkedabout inthis chapter isnonexperimental. I don’tknowifthere’lleverbeadaywhenscientistsfigureoutthelogistics—and ethics—ofrandomly assigning kids toyearsofballet classand thenwaiting to see if the benefittransfers to masteringalgebra.
But,infact,scientistshavedone short-term experiments
![Page 1217: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1217.jpg)
testing whether doing hardthings teachesaperson todootherhardthings.
Psychologist RobertEisenberger at theUniversityof Houston is the leadingauthority on this topic. He’srun dozens of studies inwhich rats are randomlyassigned to do somethinghard—like press a levertwenty times to get a singlepellet of rat chow—orsomething easy, like press
![Page 1218: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1218.jpg)
thatlevertwotimestogetthesamereward.Afterward,Bobgives all the rats a differentdifficult task. In experimentafter experiment, he’s foundthe same results: Comparedto rats in the “easycondition,” rats who werepreviously required to workhardforrewardssubsequentlydemonstrate more vigor andenduranceonthesecondtask.
My favorite of Bob’sexperiments is among his
![Page 1219: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1219.jpg)
most clever. He noticed thatlaboratory rats are generallyfedinoneoftwoways.Someresearchers use wire-meshhoppers filled with chow,requiring rats to gnaw at thefood pellets through smallopenings in the mesh. Otherresearchersjustscatterpelletson thefloorof thecage.Bobfiguredthatworkingforyoursupper, so to speak, mightteach rats to work harder onan effortful training task. In
![Page 1220: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1220.jpg)
fact, that’s exactly what hefound. He began hisexperimentbytrainingyoungrats to run down a narrowplank for a reward. Then, hedivided the rats into twogroups. One group lived incages with hopper feeders,and the other in cageswherefood pellets were scatteredaboutthefloor.Afteramonthof working to obtain foodfrom the hopper, ratsperformed better on the
![Page 1221: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1221.jpg)
runway task than rats whoinsteadmerelywanderedoverto their foodwhen theywerehungry.
Because his wife was ateacher, Bob had theopportunity to try short-termversions of the sameexperiments with children.Forinstance,inonestudy,hegave pennies to second andthird graders for countingobjects,memorizingpictures,and matching shapes. For
![Page 1222: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1222.jpg)
some children, Bob rapidlyincreased the difficulty ofthese tasks as the childrenimproved. Other childrenwere repeatedly given easyversionsofthesametasks.
All the children gotpenniesandpraise.
Afterward, the children inbothconditionswereaskedtodo a tedious job that wasentirely different from theprevious tasks: copyinga listof words onto a sheet of
![Page 1223: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1223.jpg)
paper. Bob’s findings wereexactlythesameaswhathe’dfound with rats: childrenwho’d trained on difficult(rather than easy) tasksworkedharderonthecopyingtask.
Bob’s conclusion? Withpractice, industriousness canbelearned.
In homage to the earlierwork of Seligman andMaieron learned helplessness,where the inability to escape
![Page 1224: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1224.jpg)
punishment led animals togive up on a secondchallengingtask,Bobdubbedthis phenomenon learnedindustriousness. His majorconclusion was simply thatthe association betweenworkinghardandrewardcanbe learned. Bob will gofurther and say that withoutdirectly experiencing theconnection between effortandreward,animals,whetherthey’reratsorpeople,default
![Page 1225: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1225.jpg)
to laziness. Calorie-burningeffort is, after all, somethingevolution has shaped us toavoidwheneverpossible.
MydaughterLucywasstillababywhen I first readBob’swork on learnedindustriousness, and hersister,Amanda,wasatoddler.With both girls, I soondiscovered Iwas ill-suited toplay the role Bob had in his
![Page 1226: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1226.jpg)
experiments. It was difficultformetocreatethenecessarycontingency for learning—inother words, an environmentin which the acknowledgedrule was If you work hard,you’ll be rewarded. If youdon’t,youwon’t.
Indeed, I struggled toprovidethesortoffeedbackIknew my children needed. Ifoundmyself enthusiasticallypraisingthemnomatterwhatthey did. And this is one of
![Page 1227: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1227.jpg)
the reasons extracurricularactivities offer superiorplaying fields for grit—coaches and teachers aretaskedwithbringingforthgritin childrenwho are not theirown.
AttheballetclasswhereIdropped off the girls eachweek, there was a terrificteacher waiting to receivethem. This teacher’s passionforballetwas infectious.Shewaseverybitassupportiveas
![Page 1228: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1228.jpg)
Iwas,and,frankly,aheckofa lotmoredemanding.Whena student ambled in late toclass, theygota stern lectureabout the importance ofrespecting other people’stime. If a student forgot toweartheirleotardthatday,orlefttheirballetshoesathome,they sat and watched theother children for the entireclass and weren’t allowed toparticipate.Whenamovewasexecuted incorrectly, there
![Page 1229: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1229.jpg)
were endless repetitions andadjustmentsuntil,at last, thisteacher’shighstandardsweresatisfied. Sometimes, theselessonswereaccompaniedbyshort lectures on the historyof ballet, and how eachdancer is responsible forcarryingonthattradition.
Harsh? I don’t think so.Highstandards?Absolutely.
And so it was in balletclass,morethanathome,thatLucy and Amanda got to
![Page 1230: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1230.jpg)
rehearse developing aninterest, diligently practicethings they couldn’t yet do,appreciate the beyond-the-self purpose of their efforts,and, when bad dayseventuallybecamegoodones,acquire the hope to try, tryagain.
Inour family,we liveby theHardThingRule.Ithasthreeparts. The first is that
![Page 1231: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1231.jpg)
everyone—including Momand Dad—has to do a hardthing. A hard thing issomething that requires dailydeliberate practice. I’ve toldmy kids that psychologicalresearchismyhardthing,butIalsopracticeyoga.Dadtriesto get better and better atbeinga realestatedeveloper;he does the same withrunning.My oldest daughter,Amanda, has chosen playingthe piano as her hard thing.
![Page 1232: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1232.jpg)
She did ballet for years, butlaterquit.SodidLucy.
This brings me to thesecondpartoftheHardThingRule: You can quit. But youcan’t quit until the season isover, the tuition payment isup, or some other “natural”stopping point has arrived.You must, at least for theinterval to which you’vecommitted yourself, finishwhatever you begin. In otherwords, you can’t quit on a
![Page 1233: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1233.jpg)
day when your teacher yellsatyou,oryou losea race,oryouhave tomissa sleepoverbecause of a recital the nextmorning.Youcan’tquitonabadday.
And, finally, the HardThingRulestatesthatyougetto pick your hard thing.Nobody picks it for youbecause, after all, it wouldmake no sense to do a hardthingyou’renotevenvaguelyinterested in. Even the
![Page 1234: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1234.jpg)
decision to try ballet cameafter a discussion of variousother classes my daughterscouldhavechoseninstead.
Lucy, in fact, cycledthrough a half-dozen hardthings. She started eachwithenthusiasm but eventuallydiscovered that she didn’twant to keep going withballet, gymnastics, track,handicrafts, or piano. In theend, she landed on viola.She’s been at it for three
![Page 1235: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1235.jpg)
years, duringwhich time herinteresthaswaxedratherthanwaned. Last year, she joinedthe school and all-cityorchestras, andwhen I askedher recently if shewanted toswitch her hard thing tosomethingelse,shelookedatmelikeIwascrazy.
Nextyear,Amandawillbeinhighschool.Hersisterwillfollow the year after.At thatpoint, the Hard Thing Rulewill change. A fourth
![Page 1236: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1236.jpg)
requirement will be added:each girl must commit to atleast one activity, eithersomething new or the pianoand viola they’ve alreadystarted,foratleasttwoyears.
Tyrannical?Idon’tbelieveit is. And if Lucy’s andAmanda’s recent commentson the topic aren’t disguisedapple-polishing, neither domydaughters.They’d like togrow grittier as they getolder,and,likeanyskill,they
![Page 1237: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1237.jpg)
know grit takes practice.They know they’re fortunatetohave theopportunity todoso.
For parents who wouldliketoencouragegritwithoutobliterating their children’scapacity to choose their ownpath, I recommend the HardThingRule.
![Page 1238: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1238.jpg)
Chapter12
ACULTUREOFGRIT
ThefirstfootballgameIeverwatched from beginning to
![Page 1239: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1239.jpg)
endwasSuperBowlXLVIII.The game took place onFebruary 2, 2014, and pittedthe Seattle Seahawks againstthe Denver Broncos. TheSeahawkswon,43–8.
Thedayaftertheirvictory,Seahawks head coach PeteCarrollwas interviewed by aformer member of the SanFrancisco49ers.
“I knowwhen I waswiththe (Forty-) Niners,” theinterviewerbegan,“youwere
![Page 1240: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1240.jpg)
there....Itmeantsomethingto be a Niner, not a footballplayer. When you and JohnSchneider are looking for aplayer, tell me: What is thatphilosophy, what does itmeantobeaSeahawk?”
Pete chuckled softly. “I’mnotgoingtogiveitalltoyou,but...”
“Comeon,man.Giveittome,Pete.”
“Iwill tell you thatwe’relookingforgreatcompetitors.
![Page 1241: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1241.jpg)
That’s really where it starts.Andthat’stheguysthatreallyhave grit. The mindset thatthey’re always going tosucceed, that they’ve gotsomething to prove. They’reresilient, they’renotgoing tolet setbacks hold them back.They’re not going to bedeterred, you know, bychallenges and hurdles andthings....It’sthatattitude—wereallyrefertoitasgrit.”
![Page 1242: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1242.jpg)
Ican’tsayIwassurprised,eitherbyPete’scommentsorby his team’s triumphantperformancethedaybefore.
Why not? Because ninemonthsearlier,I’dreceivedacall from Pete. Apparently,he’d just watched my TEDtalk on grit. What promptedhis call were two urgentemotions.
First, he was curious—eagertolearnmoreaboutgritthan I’d been able to convey
![Page 1243: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1243.jpg)
in the six minutes TED hadallottedme.
Second, he was annoyed.NotbymostofwhatIhadtosay.Itwasjustthepartattheend that irked him. Science,I’dconfessedinthattalk,hadat that point disappointinglylittle to say about buildinggrit.Petelatertoldmethathejust about jumped out of hischair, practically yelling atmy on-screen image thatbuilding grit is exactly what
![Page 1244: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1244.jpg)
the Seahawks culture is allabout.
We ended up talking forroughly an hour: me on oneend of the line, sitting atmydeskinPhiladelphia,andPeteand his staff on the other,huddled around aspeakerphone in Seattle. Itoldhimwhat Iwas learningin my research, and Petereciprocated by telling meabout what he was trying to
![Page 1245: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1245.jpg)
accomplish with theSeahawks.
“Come and watch us. Allwedoishelppeoplebegreatcompetitors. We teach themhowtopersevere.Weunleashtheir passion. That’s all wedo.”
Whetherwe realize it or not,the culture inwhichwe live,and with which we identify,
![Page 1246: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1246.jpg)
powerfully shapes just abouteveryaspectofourbeing.
By culture, I don’t meanthe geographic or politicalboundaries that divide onepeople fromanotherasmuchas the invisiblepsychologicalboundariesseparatingusfromthem.At itscore,aculture isdefined by the shared normsand values of a group ofpeople. In other words, adistinctcultureexistsanytimea group of people are in
![Page 1247: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1247.jpg)
consensus about how we dothings around here and why.As for how the rest of theworld operates, the sharperthe contrast, the stronger thebonds among those in whatpsychologists call the “in-group.”
So it is that the SeattleSeahawks and the KIPPcharter schools—as much asany nation—are bona fidecultures.Ifyou’reaSeahawk,you’re not just a football
![Page 1248: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1248.jpg)
player. If you’re a KIPPster,you’re not just a student.Seahawks and KIPPsters dothings in a certain way, andtheydosoforcertainreasons.Likewise, West Point has adistinct culture—one that ismore than two centuries old,and yet, as we’ll soondiscover,continuestoevolve.
For many of us, thecompaniesweworkforareanimportant cultural force inour lives. For instance,
![Page 1249: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1249.jpg)
growing up,my dad liked torefer to himself as aDuPonter. All the pencils inour house were company-issued, embossed withphrases likeSafetyFirst, andmydadwould lightupeverytime a DuPont commercialcame on television,sometimes even chiming inwith the voice-over: “Betterthings for better living.” Ithink my dad only met theCEOofDuPont ahandfulof
![Page 1250: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1250.jpg)
times, but he’d tell stories ofhis good judgment the wayyoumight speak of a familywarhero.
How do you know you’repart of a culture that, in avery real sense, has becomepartofyou?Whenyouadopta culture, you make acategorical allegiance to thatin-group.You’renot“sortof”a Seahawk, or “sort of” aWest Pointer. You either areor you aren’t. You’re in the
![Page 1251: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1251.jpg)
group, or out of it. You canuse a noun, not just anadjective or a verb, todescribe your commitment.Somuchdepends, as it turnsout, on which in-group youcommitto.
Thebottomlineoncultureandgrit is: If youwant to begrittier, find a gritty cultureandjoinit.Ifyou’realeader,and you want the people inyour organization to be
![Page 1252: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1252.jpg)
grittier, create a grittyculture.
I recently called DanChambliss,thesociologistwemet in chapter 3 who spentthe first six years of hisprofessional life studyingswimmers.
My question for Dan waswhether, in the threedecadessince his landmark study ofexpertise, he’d changed his
![Page 1253: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1253.jpg)
mind about any of itsprovocativeconclusions.
Did he, for example, stillbelieve talent was largely ared herring when it came tounderstanding the origins ofworld-class excellence? Didhe stand by the observationthat going from your localclub team to beingcompetitive at the state andnationallevelsand,finally,toworld-class, Olympic-levelexpertise necessitated
![Page 1254: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1254.jpg)
qualitative improvements inskill,notjust“morehours”inthepool?Andwasmystifyingexcellence, at the end of theday, really the confluence ofcountless, perfectly executedyetmundane,doableacts?Yes,yes,andyes.“But I left out the most
important thing,” Dan said.“The real way to become agreat swimmer is to join agreatteam.”
![Page 1255: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1255.jpg)
Thatlogicmightstrikeyouasstrange.Youmightassumethat first a person becomes agreatswimmerandthenheorshe joins a great team. Andit’s true,ofcourse, thatgreatteamsdon’t take justanyone.Therearetryouts.Therearealimited number of spots.There are standards.And themore elite the team, thefiercer the desire of thosealready on the team to keepthosestandardshigh.
![Page 1256: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1256.jpg)
WhatDanwasgettingatisthe reciprocal effect of ateam’s particular culture onthepersonwhojoinsit.Inhismanyyears in andoutof thepool, he’d seen the arrow ofcausality between a greatteam and a great individualperformer go both ways. Ineffect, he’d witnessed thecorresponsive principle ofpersonality development:he’d seen that the verycharacteristics that are
![Page 1257: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1257.jpg)
selected for certain situationsare, in turn, enhanced bythem.
“Look, when I startedstudying Olympians, Ithought, ‘What kind ofoddball gets up every day atfour in themorning to go toswimming practice?’ Ithought, ‘These must beextraordinary people to dothat sort of thing.’ But thething is, when you go to aplace where basically
![Page 1258: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1258.jpg)
everybody you know isgetting up at four in themorning to go to practice,that’s just what you do. It’sno big deal. It becomes ahabit.”
Over and over, Dan hadobserved new swimmers joinateamthatdidthingsanotchortwobetterthanwhatthey’dbeen used to. Very quickly,the newcomer conformed tothe team’s norms andstandards.
![Page 1259: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1259.jpg)
“Speaking for myself,”Danadded,“Idon’thavethatmuch self-discipline. But ifI’m surrounded by peoplewho are writing articles andgiving lectures and workinghard, I tend to fall in line. IfI’m in a crowd of peopledoing things a certainway, Ifollowalong.”
The drive to fit in—toconform to the group—ispowerfulindeed.Someofthemost important psychology
![Page 1260: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1260.jpg)
experiments in history havedemonstrated how quickly,andusuallywithoutconsciousawareness, the individualfalls in linewithagroupthatis acting or thinking adifferentway.
“So it seems tome,”Danconcluded, “that there’s ahard way to get grit and aneasyway.Thehardwayistodo it by yourself. The easyway is to use conformity—thebasichumandrivetofitin
![Page 1261: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1261.jpg)
—because ifyou’rearoundalot of people who are gritty,you’regoingtoactgrittier.”
Short-termconformityeffectsarenotwhatexcitemeaboutthe power of culture toinfluencegrit.Notexactly.
What excites me most isthe idea that, in the longrun,culture has the power toshapeour identity.Over timeand under the right
![Page 1262: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1262.jpg)
circumstances,thenormsandvalues of the group towhichwe belong become our own.We internalize them. Wecarry themwith us.Thewaywedothingsaroundhereandwhy eventually becomes ThewayIdothingsandwhy.
Identity influences everyaspectofourcharacter,butithas special relevance to grit.Often, the critical gritty-or-not decisions we make—togetuponemoretime;tostick
![Page 1263: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1263.jpg)
it out through thismiserable,exhausting summer; to runfive miles with ourteammateswhen on our ownwemightonlyrunthree—areamatterofidentitymorethananything else. Often, ourpassion and perseverance donot spring from a cold,calculating analysis of thecosts and benefits ofalternatives. Rather, thesource of our strength is the
![Page 1264: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1264.jpg)
personweknowourselves tobe.
JamesMarch,anexpertondecision making at StanfordUniversity, explains thedifference this way:Sometimes,wereverttocost-benefit analyses to makechoices. Of course, Marchdoesn’tmeanthat,indecidingwhat to order for lunch orwhen to go to bed, we takeout a pad of paper and acalculator.What hemeans is
![Page 1265: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1265.jpg)
that,sometimeswhenmakingchoices, we take intoconsideration how we mightbenefit, and what we’ll haveto pay, and how likely it isthat these benefits and costswillbewhatwe think they’llbe.We can do all of this inour heads, and indeed, whenI’m deciding what to orderfor lunch or when to go tobed,Ioftenthinkthroughthepros and the cons before
![Page 1266: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1266.jpg)
making a decision. It’s verylogical.
But other times, Marchsays, we don’t think throughthe consequences of ouractions at all. We don’t askourselves: What are thebenefits?Whatarethecosts?What are the risks? Instead,weaskourselves:WhoamI?What is this situation? Whatdoessomeonelikemedoinasituationlikethis?
Here’sanexample:
![Page 1267: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1267.jpg)
Tom Deierlein introducedhimselftomethisway:“Iama West Pointer, AirborneRanger,andtwo-timeCEO.Ifoundedandrunanonprofit.Iam not special orextraordinary in any way.Exceptone:grit.”
OnactivedutyinBaghdadduring the summer of 2006,Tom was shot by a sniper.Thebulletshatteredhispelvisand sacrum. There was noway to know how the bones
![Page 1268: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1268.jpg)
wouldknitback togetherandwhat sort of functionalityTom might have when theydid. Doctors told him hemightneverwalkagain.
“You don’t know me,”Tom replied simply. Andthen, to himself, he made apromisetoruntheArmyTen-Miler, a race he’d beentraining to runbeforehewasshot.
When,sevenmonthslater,hewasfinallywellenoughto
![Page 1269: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1269.jpg)
get out of bed and beginphysical therapy, Tomworked fiercely,unrelentingly, doing all theassigned exercises and thenmore. Sometimes, he’d gruntin pain or shout outencouragements to himself.“The other patients were alittle startled at first,” Tomsays,“buttheygotusedtoit,and then—all in good fun—they’d mock me with fakegruntsoftheirown.”
![Page 1270: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1270.jpg)
After a particularly toughworkout, Tom got “zingers,”sharp bolts of pain that shotdown his legs. “They’d onlylast a second or two,” Tomsays, “but they’d come backat random times throughoutthe day, literally making mejump from the shock.”Without fail, each day, Tomset a goal, and for a fewmonths, the pain andperspirationwere paying off.Finally, he could just barely
![Page 1271: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1271.jpg)
walkwithawalker,thenwithjust a cane, thenonhis own.Hewalked faster and farther,then was able to run on thetreadmill for a few secondswhile holding onto therailings, and then for a fullminute, and on and on until,after four months ofimproving,hehitaplateau.
“My physical therapistsaid, ‘You’re done. Goodjob.’ And I said, ‘I’m stillcoming.’And she said, ‘You
![Page 1272: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1272.jpg)
did what you needed to do.You’re good.’ And I said,‘No,no,I’mstillcoming.’ ”
And thenTomkept goingfor a full eight monthsbeyond thepointwhere therewere any noticeableimprovements. Technically,his physical therapist wasn’tallowedtotreathimanymore,but Tom came back on hisown to use the equipmentanyway.
![Page 1273: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1273.jpg)
Was there any benefit tothose extra months? Maybe.Maybenot.Tomcan’tsayforsure that the extra exercisesdid anygood.Hedoes knowthat he was able to starttraining for the Army Ten-Miler the next summer.Before getting shot, he’daimed to run seven-minutemiles, completing the race inseventyminutesorless.Aftergetting shot, he revised hisgoal:hehopedtoruntwelve-
![Page 1274: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1274.jpg)
minutemiles and to finish intwo hours. His finish time?One hour and fifty-sixminutes.
Tomcan’tsaythatrunningthe Army Ten-Miler—and,after that, two triathlons—weredecisionsrootedincostsandbenefits,either.“Isimplywasn’tgoingtofailbecauseIdidn’t care or didn’t try.That’snotwhoIam.”
Indeed, the calculatedcosts and benefits of passion
![Page 1275: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1275.jpg)
and perseverance don’talwaysaddup,at least in theshort run. It’s often more“sensible” to give up andmove on. It can be years ormore before grit’s dividendspayoff.
And that’s exactly whyculture and identity are socritical to understanding howgritty people live their lives.Thelogicofanticipatedcostsand benefits doesn’t explain
![Page 1276: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1276.jpg)
their choices very well. Thelogicofidentitydoes.
The population of Finland isjust over five million. Thereare fewer Finns in the worldthanNewYorkers.This tiny,cold Nordic country—so farnorth that, in the depth ofwinter, they get barely sixhours of daylight—has beeninvaded numerous times bylarger, more powerful
![Page 1277: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1277.jpg)
neighbors. Whether thosemeteorological and historicalchallenges contribute to howFinns see themselves is agood question. Regardless, itis undeniable that the Finnssee themselves as among theworld’sgrittiestpeople.
TheclosestwordtogritinFinnish is sisu (pronouncedsee-sue).Thetranslationisn’tperfect. Grit specifies havinga passion to accomplish aparticular top-level goal and
![Page 1278: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1278.jpg)
the perseverance to followthrough. Sisu, on the otherhand, is really just aboutperseverance. In particular,sisureferstoasourceofinnerstrength—a sort ofpsychological capital—thatFinns believe they’re bornwith by dint of their Finnishheritage. Quite literally, sisurefers to the insides of aperson,theirguts.
In 1939, Finland was theunderdog in theWinterWar,
![Page 1279: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1279.jpg)
battling a Soviet army thatboasted three times as manysoldiers, thirtytimesasmanyaircraft, and a hundred timesasmanytanks.Finnishtroopsheld their ground for severalmonths—dramatically longerthan the Soviets or anyoneelsemight have expected. In1940, Time magazine ran afeatureonsisu:
The Finns havesomething they call
![Page 1280: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1280.jpg)
sisu. It is a compoundofbravadoandbravery,offerocityandtenacity,of the ability to keepfighting after mostpeoplewouldhavequit,and to fight with thewill to win. The Finnstranslate sisu as “theFinnishspirit”butitisamuchmoregutfulwordthanthat.
![Page 1281: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1281.jpg)
In the sameyear, theNewYork Times ran a featurecalled “Sisu: A Word ThatExplains Finland.” A Finnexplained his countrymen tothe journalist this way: “Atypical Finn is an obstinatesortoffellowwhobelievesingetting the better of badfortunebyprovingthathecanstandworse.”
When I lecture on grit tomy undergraduate classes, Ilike to include a brief
![Page 1282: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1282.jpg)
digression on sisu. I ask mystudents the rhetoricalquestion: Can we forge aculture—as Seahawks coachPeteCarrollclearlythinkswecan—that celebrates andsupportssuchqualitiesassisuandgrit?
A few years ago, bycomplete coincidence, ayoungFinnishwomannamedEmilia Lahti was in theaudience when I mentionedsisu. After the lecture, she
![Page 1283: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1283.jpg)
rushed to greet me andconfirmed that my outsiderviewofsisuwascorrect.Weagreed there was a pressingneed for a systematicinvestigation of sisu, howFinns thinkabout it,howit’spropagated.
Emilia became mygraduate student the nextyear,completinghermaster’sthesis on exactly thosequestions. She asked athousand Finns how they
![Page 1284: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1284.jpg)
thought about sisu anddiscovered that most have agrowth mindset about itsdevelopment. When asked,“Do you think sisu can belearnedordeveloped throughconsciouseffort?”83percentsaid, “Yes.” One respondentthen offered: “For example,participation in Finnishscouting association jaunts,where thirteen-year-oldsmaybe in charge of ten-year-oldsalone in thewoods, seems to
![Page 1285: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1285.jpg)
have some correlation withsisu.”
Asascientist,Idon’t takeseriously the notion thatFinns, or members of anyother nationality, have actualreserves of energy hidden intheir intestines, awaitingreleaseatthecriticalmoment.Still, there are two powerfullessons we can take fromsisu.
First, thinking of yourselfas someone who is able to
![Page 1286: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1286.jpg)
overcome tremendousadversity often leads tobehavior that confirms thatself-conception. If you’re aFinn with that “sisu spirit,”you get up again no matterwhat. Likewise, if you’re aSeattle Seahawk, you’re acompetitor.Youhavewhat ittakes to succeed. You don’tlet setbacks hold you back.Gritiswhoyouare.
Second,eveniftheideaofanactual innerenergysource
![Page 1287: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1287.jpg)
ispreposterous, themetaphorcouldn’t be more apt. Itsometimesfeelslikewehavenothing left to give, and yet,in those dark and desperatemoments, we find that if wejust keep putting one foot infront of the other, there is away to accomplish what allreason seems to argueagainst.
![Page 1288: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1288.jpg)
The idea of sisu has beenintegraltoFinnishcultureforcenturies.Butculturescanbecreated inmuch shorter timeframes. In my quest tounderstandwhatgives rise togrit, I’ve encountered a feworganizations with especiallygritty leaders at the helmwho, in my view, havesuccessfully forged a cultureofgrit.
Consider, for example,Jamie Dimon, the CEO of
![Page 1289: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1289.jpg)
JPMorganChase. Jamie isn’tthe only one of the bank’s250,000-plus employees whosays,“IwearthisjerseyandIbleed this blood.” Otheremployeesmuchlowerintherankssaythingslike“WhatIdo every day for our clientsactuallymatters.Noonehereis insignificant. And everydetail, every employee,matters....Iamproudtobepartofthisgreatcompany.”
![Page 1290: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1290.jpg)
JamiehasbeentheCEOofJPMorgan Chase, the largestbankintheUnitedStates,formore than a decade. In the2008 financial crisis, Jamiesteeredhisbanktosafety,andwhile other banks collapsedentirely, JPMorgan Chasesomehow turned a $5 billionprofit.
Coincidentally, the mottoof Jamie’s prep school almamater, the Browning School,is “grytte,” an Old English
![Page 1291: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1291.jpg)
version of grit defined in an1897 yearbook as “firmness,courage, determination . . .whichalonewinthecrownofgenuine success in allundertakings.” In Jamie’ssenior year at Browning, hiscalculus teacher had a heartattack, and the substituteteacherdidn’tknowcalculus.Half the boys quit; the otherhalf,includingJamie,decidedto stickwith it and spent theentire year in a separate
![Page 1292: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1292.jpg)
classroom, alone, teachingthemselves.
“You have to learn to getover bumps in the road andmistakes and setbacks,” hetoldmewhen Icalled to talkabouttheculturehe’sbuiltatJPMorgan Chase. “Failuresaregoingtohappen,andhowyou deal with them may bethe most important thing inwhether you succeed. Youneedfierceresolve.Youneed
![Page 1293: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1293.jpg)
to take responsibility. Youcallitgrit.Icallitfortitude.”
Fortitude is to JamieDimon what sisu is toFinland. Jamie recalls thatgettingfiredfromCitibankatage thirty-three, and thentaking a full year to ponderwhatlessonstotakefromtheepisode, made him a betterleader. And he believes infortitudeenough tomake itacore value for the entireJPMorgan Chase bank. “The
![Page 1294: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1294.jpg)
ultimatethingisthatweneedtogrowovertime.”
Is it really possible, Iasked, for a leader toinfluence the culture of suchan enormous corporation?True,thecultureofJPMorganChase has, with someaffection, been described as“thecultofJamie.”Butthereare literally thousands andthousands of JPMorganChase employees Jamie hasnevermetinperson.
![Page 1295: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1295.jpg)
“Absolutely,” Jamie says.“It takes relentless—absolutely relentless—communication.It’swhatyousayandhowyousayit.”
It may also be how oftenyou say it. By all accounts,Jamie is a tireless evangelist,crossingthecountrytoappearat what he calls town hallmeetingswithhisemployees.Atonemeetinghewasasked,“What do you look for inyour leadership team?” His
![Page 1296: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1296.jpg)
answer? “Capability,character, andhow they treatpeople.” Later, he told methat he asks himself twoquestions about seniormanagement.First: “Would Ilet them run the businesswithout me?” Second:“Would I let my kids workforthem?”
JamiehasafavoriteTeddyRoosevelt quote he likes torepeat:
![Page 1297: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1297.jpg)
It is not the critic whocounts; not the manwhopointsouthowthestrongmanstumbles,orwherethedoerofdeedscould have done thembetter. The creditbelongstothemanwhoisactually in the arena,whose face is marredby dust and sweat andblood; who strivesvaliantly; who errs,who comes short again
![Page 1298: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1298.jpg)
and again, becausethere is no effortwithout error andshortcoming; but whodoes actually strive todo the deeds; whoknows greatenthusiasms, the greatdevotions; who spendshimself in a worthycause; who at the bestknows in the end thetriumph of highachievement, and who
![Page 1299: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1299.jpg)
at theworst, ifhe fails,at least fails whiledaring greatly, so thathisplaceshallneverbewith those cold andtimidsoulswhoneitherknow victory nordefeat.
And here is how Jamietranslates the poetry ofRoosevelt into theproseof aJPMorgan Chase manual,titledHow We Do Business:
![Page 1300: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1300.jpg)
“Have a fierce resolve ineverything you do.”“Demonstrate determination,resiliency,andtenacity.”“Donot let temporary setbacksbecome permanent excuses.”And, finally, “Use mistakesandproblemsasopportunitiesto get better—not reasons toquit.”
Anson Dorrance has thechallenge of instilling grit in
![Page 1301: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1301.jpg)
considerably fewer people.Thirty-one women, to beexact,whichis thefullrosterof the women’s soccer teamat the University of NorthCarolina at Chapel Hill.Anson is the winningestcoach in women’s soccerhistory. His record includestwenty-two nationalchampionships in thirty-oneyearsofcompetition.In1991,he coached the U.S.
![Page 1302: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1302.jpg)
Women’s National Team toitsfirstworldtitle.
During his younger,playing days,Ansonwas thecaptain of the UNC men’ssoccer team. He wasn’tespecially talented, but hisfull-throttle, aggressiveplaying in every minute ofpractice and competitionearned the admiration of histeammates, who nicknamedhim Hack and Hustle. Hisfatheroncedeclared,“Anson,
![Page 1303: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1303.jpg)
you’re the most confidentpersonwithoutanytalentI’veever met.” To which Ansonquickly replied, “Dad, I’mtakingthatasacompliment.”Manyyears later,asacoach,Ansonobservedthat“talentiscommon; what you invest todevelop that talent is thecritical final measure ofgreatness.”
ManyofAnson’sadmirersattribute his unprecedentedsuccess to recruitment.
![Page 1304: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1304.jpg)
“That’s simply incorrect,” hetoldme.“We’reout-recruitedby five or six schools on aregular basis. Ourextraordinarysuccessisaboutwhatwe do once the playersgethere.It’sourculture.”
Culture building, Ansonsaid,isamatterofcontinuousexperimentation. “Basically,we’ll try anything, and if itworks,we’llkeepdoingit.”
Forinstance,afterlearningabout my research on grit,
![Page 1305: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1305.jpg)
Anson asked each of hisplayers to fill out the GritScale and made sure eachreceived their score. “To behonest, I was absolutelyshocked. With only one ortwo exceptions, the gritranking on your test is theway I would have evaluatedtheirgrit.”Ansonnowmakessure the entire team scoresthemselves on grit eachspring so that they have “adeeper appreciation for the
![Page 1306: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1306.jpg)
criticalqualitiesofsuccessfulpeople.” Each player gets tosee her score because, asAnson put it, “in some casesthe scale captures them, andin some cases it exposesthem.”Returningplayerstakethe scale again—andagain—each year so they cancompare their grit now towhatitusedtobe.
Another experiment thatstuckistheBeepTest,whichbeginseveryTarHeelseason.
![Page 1307: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1307.jpg)
All the players line up,shoulder to shoulder, and atthe sound of an electronicbeep, jog to a line twentymetersaway,arrivingin timeforthesoundofanotherbeep,which signals them to turnaroundandjogbacktowherethey started. Back and forththeyrun,pickingupthepaceas the interval between thebeeps gets shorter andshorter. Within minutes, theplayersareinaflat-outsprint
![Page 1308: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1308.jpg)
—at which point, the beepscomefasterstill.Onebyone,players drop out, invariablyfalling to all fours in utterexhaustion when they do.How far they get, likeeverythingelsetheplayersdointrainingandcompetition,iscarefully recorded and,without delay, posted in thelocker room for everyone tosee.
The Beep Test wasoriginally designed by
![Page 1309: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1309.jpg)
Canadian exercisephysiologists as a test ofmaximalaerobiccapacity,butgauging fitness is only onereason Anson likes it. LiketheresearchersattheHarvardFatigue Laboratory who, in1940, designed a treadmilltest to assess perseverancethroughphysicalpain,Ansonsees the Beep Test as atwofold test of character. “Igive a little speechbeforehandaboutwhatthisis
![Page 1310: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1310.jpg)
goingtoprovetome,”hetoldme. “If you do well, eitheryou have self-disciplinebecause you’ve trained allsummer, or you have themental toughness to handlethe pain that most peoplecan’t. Ideally, of course, youhave both.” Just before thefirst beep, Anson announces,“Ladies, this isa testofyourmentality.Go!”
How else does Ansonbuild a culture of grit? Like
![Page 1311: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1311.jpg)
JamieDimon,heputsalotofstock in communication. It’scertainly not the only thingthat he does, but as aphilosophyandEnglishmajorhe has a special appreciationfor thepowerofwords:“Forme,languageiseverything.”
Overtheyears,Ansonhasdeveloped a list of twelvecarefully worded core valuesthat define what it means tobe a UNC Tar Heel, asopposed to just any run-of-
![Page 1312: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1312.jpg)
the-millsoccerplayer.“Ifyouwant to create a greatculture,” he told me, “youhave to have a collection ofcore values that everyonelives.” Half the team’s corevalues are about teamwork.Halfareaboutgrit.Together,they define a culture Ansonand his players refer to as“thecompetitivecauldron.”
But a lot of organizationshave core values, I pointedout, that are flagrantly
![Page 1313: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1313.jpg)
ignored on a daily basis.Anson agreed. “Of course,there’s nothing motivationalabout the statement thatwithinyourcultureyouworkhard.Imean,it’ssobanal.”
His solution to rescuingcorevaluesfrombanalitywasin some ways entirelyunpredictable and in otherwaysexactlywhatyoumightexpect from someone withAnson’s humanitiesbackground.
![Page 1314: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1314.jpg)
Inspiration struck whileAnsonwas readinganarticleabout Joseph Brodsky, theRussian exile and Nobellaureate poet. Brodsky,Anson learned, required hisgraduate students atColumbia University tomemorize scores of Russianpoems each semester.Naturally, most studentsconsidered this demandunreasonable and antiquated,and they marched into his
![Page 1315: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1315.jpg)
officetotellhimso.Brodskysaid they coulddowhat theyliked, but if they didn’tmemorizetherequiredverses,theywouldn’tgettheirPhDs.“So they walked out of hisoffice,”Ansonrecalled,“withtheir tails tucked firmlybetween their legs, and theygottowork.”Whathappenednext was, as Anson put it,“simply transformational.”Quite suddenly, uponcommitting a verse to
![Page 1316: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1316.jpg)
memory, Brodsky’s students“felt and lived and breathedRussia.” What was dead onthepagehadcometolife.
Rather than read thisanecdote and quickly forgetit, Anson immediatelyappreciated its relevance tothe top-level goal he wastrying to accomplish. Likejust about everything else hereads,sees,ordoes,heaskedhimself, How can this help
![Page 1317: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1317.jpg)
me develop the culture Iwant?
Each year that you playsoccer for Anson Dorrance,you must memorize threedifferent literaryquotes,eachhandpickedtocommunicateadifferent core value. “Youwill be tested in front of theteaminpreseason,”hismemoto the team reads, “and thentested again in every playerconference. Not only do youhave to memorize them, but
![Page 1318: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1318.jpg)
youhavetounderstandthem.So reflect on them aswell....”
By senior year, Anson’sathletes know all twelve byheart,beginningwiththefirstcore value—We don’t whine—and its correspondingquote,courtesyofplaywrightGeorge Bernard Shaw: “Thetruejoyinlifeistobeaforceof fortune instead of afeverish, selfish little clod ofailments and grievances
![Page 1319: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1319.jpg)
complaining that the worldwill not devote itself tomakingyouhappy.”
Verbatim memorization is aproud, centuries-old traditionat West Point. You can findthe very, very long list ofsongs, poems, codes, creeds,and miscellany that all first-year cadets—“plebes” inWest Point parlance—arerequired to memorize in a
![Page 1320: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1320.jpg)
document West Point callstheBugleNotes.
But West Point’s currentsuperintendent, LieutenantGeneralRobertCaslen, is thefirst to point out that words,even those committed tomemory, don’t sustain aculture when they divergefromactions.
Take, for example,Schofield’s Definition ofDiscipline.Thesewords, firstspoken inan1879address to
![Page 1321: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1321.jpg)
the cadets by thensuperintendent JohnSchofield, are the sort you’dexpect a West Pointer toknow by heart. The passagethat cadets must memorizebegins:“Thedisciplinewhichmakes the soldiers of a freecountry reliable in battle isnot to be gained by harsh ortyrannical treatment. On thecontrary,suchtreatmentisfarmorelikelytodestroythan tomakeanarmy.”
![Page 1322: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1322.jpg)
Schofieldgoesontosay—and the cadets mustmemorize this, too—that thevery same commands can beissued in a way that inspiresallegiance or seedsresentment. And thedifferencecomesdowntooneessential thing: respect.Respect of subordinates fortheir commander? No,Schofield says.Theoriginofgreat leadership begins with
![Page 1323: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1323.jpg)
therespectofthecommanderforhissubordinates.
The irony of recitingSchofield’s uplifting words,even as you’re being yelledand screamed at byupperclassmen, was not loston Caslen when hecommitted them to memoryasaneighteen-year-oldplebein 1971. In that era, hazingwas not only tolerated butencouraged. “It was thesurvivalists who succeeded,”
![Page 1324: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1324.jpg)
Caslenrecalled.“Itwasn’tsomuch thephysical challengesas the mental toughnessrequired to cope with all theyellingandscreaming.”
Indeed, forty years ago,170ofthecadetswhostartedBeast Barracks quit before itwas over. That’s 12 percent,double the proportion whodropped out of Beast by thetime Icame toWestPoint tostudygrit a decade ago.Last
![Page 1325: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1325.jpg)
year, attrition was down tolessthan2percent.
One explanation for thisdownwardtrendishazing,or,rather, the lack thereof. Thepracticeof inflictingphysicaland psychological stress onfirst-year cadets was longconsideredanecessarypartoftougheningupfutureofficers.Asecondbenefit,sothelogicwent, was to cull the weak,effectively eliminatingweakness in the corps by
![Page 1326: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1326.jpg)
pushing out those whocouldn’t handle it. Over thedecades, the list of approvedhazing rituals wasprogressively curtailed, andin1990,hazingwasofficiallybannedaltogether.
So, eliminating hazingmightexplaindecliningBeastattrition in the late twentiethcentury,butwhatexplainsthelast decade’s precipitousdrop? Is West Pointadmissionsdoingabetter job
![Page 1327: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1327.jpg)
ofselectingforgrit?Fromtheyear-to-year data on grit I’veseen, absolutely not. Theaverage grit scores ofincoming cadets haven’tchanged since West Pointbegancollectingthem.
According to GeneralCaslen, what’s happened atthe academy is a deliberatechange in culture. “Whenonly the survivalists succeed,that’s anattritionmodel,” heexplained. “There’s another
![Page 1328: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1328.jpg)
kind of leadership. I call it adevelopmental model. Thestandards are exactly thesame—high—butinonecase,you use fear to get yoursubordinates to achieve thosestandards. And in the othercase, you lead from thefront.”
On the battlefield, leadingfrom the front means, quiteliterally, getting out in frontwith your soldiers, doing thesame hard work, and facing
![Page 1329: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1329.jpg)
the same mortal risks. AtWestPoint, itmeans treatingcadets with unconditionalrespect and, when they fallshort of meeting theacademy’s extraordinarilyhigh standards, figuring outthe support they need todevelop.
“For example,” Caslenexplained, “on the physicalfitnesstest,iftherearecadetsthat struggle with the two-milerunandI’mtheirleader,
![Page 1330: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1330.jpg)
what I’m going to do is sitdown with them and puttogether a training program.I’m going to make sure theplan is sensible. Someafternoons, I’m going to say,‘Okay,let’sgorun,’or‘Let’sgoworkout,’ or ‘Let’s go dointervals.’Iwillleadfromthefront to get the cadet to thestandard. Very often, thecadetwhowasunabletodoitontheirownallofasuddenisnowmotivated,andoncethey
![Page 1331: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1331.jpg)
start to improve, theirmotivation increases, andwhen they meet thoseobjectives they gain evenmore confidence. At somepoint, they figure out how todothingsontheirown.”
Caslen’s example broughttominda storyWestPointerTomDeierleintoldmeoftheeven-tougher-than-Beasttraining he endured tobecome an Airborne Ranger.At one point in the training,
![Page 1332: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1332.jpg)
he was hanging off a rockface—a climb he’d alreadyfailed once—with everymuscleinhisbodyshakinginrebellion. “I can’t!” Tomshouted to the Rangerinstructor on the plateauabove. “I expected him toshout back, ‘That’s right.Quit! You’re a loser!’ Thisguy, for whatever reason,instead says, ‘Yes you can!Get up here!’ And I did. Iclimbed up, and I swore to
![Page 1333: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1333.jpg)
myselfI’dneversay‘Ican’t’again.”
As for critics of WestPoint’s new developmentalculture,Caslenpointsoutthatthe academic, physical, andmilitary standards forgraduating from West Pointhave, if anything, grownmore stringent over time.He’s convinced that theacademy is producing finer,stronger, and more capableleaders than ever before. “If
![Page 1334: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1334.jpg)
you want to measure WestPoint by how much yellingand screaming goes onaround here, then I’m justgoing to let you complain.Youngmenandwomentodayjust don’t respond to yellingandscreaming.”
Other than objectivestandards of performance,what else hasn’t changed atWest Point in the last tenyears? Norms of politenessand decorum remain so
![Page 1335: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1335.jpg)
strongthat,duringmyvisit,Ifound myself checking mywatch to make sure I was afew minutes early for eachappointment and, withoutthinking, addressed everyman and woman I met by“sir”and“ma’am.”Also, thegrayfull-dressuniformswornbycadetsonformaloccasionsremain the same, makingtoday’s cadets part of the“long gray line” of WestPointers stretching back two
![Page 1336: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1336.jpg)
centuries before them.Finally, cadet slang is stillspoken fluently by WestPointers and includes suchimprobably defined terms asfirsties for “fourth-yearcadets,” spoony for “neat inphysical appearance,” andhuah for everything from “Iunderstandyou”to“gungho”to“agreed”to“greatjob.”
Caslenisn’tsonaiveas tothink that four years ofdevelopmental culture at
![Page 1337: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1337.jpg)
West Point will reliably turn2s and 3s on the Grit Scaleinto 5s. But then again, thevarsity athletes, classpresidents,andvaledictorianswho make it through WestPoint’s two-year admissionsprocess aren’t exactly thebottom of the barrel in grit.Importantly,he’sseenpeoplechange. He’s watched cadetsdevelop. He has a growthmindset. “You never reallyknowwhoisgoingtobecome
![Page 1338: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1338.jpg)
a Schwarzkopf or aMacArthur.”
Two years after Pete Carrollcalledtotalkaboutgrit,IgotonaplanetoSeattle.Iwantedto see firsthand what Petemeant when he said theSeahawks were building thegrittiestcultureintheNFL.
By then I’d read hisautobiography,Win Forever,in which he talks about
![Page 1339: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1339.jpg)
discovering the power ofpassion and perseverance inhisownlife:
Personally, I havelearned that if youcreate a vision foryourself and stick withit, you can makeamazing things happenin your life. Myexperience is that onceyouhavedonetheworkto create the clear
![Page 1340: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1340.jpg)
vision, it is thediscipline and effort tomaintainthatvisionthatcan make it all cometrue. The two go handin hand. The momentyou’ve created thatvision, you’re on yourway, but it’s thediligence with whichyou stick to that visionthat allows you to getthere.
![Page 1341: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1341.jpg)
Getting that acrossto players is a constantoccupation.
I’d also watched Pete talkabout grit and culture in hismanyinterviews.Inone,Peteisonstageinanauditoriumatthe University of SouthernCalifornia, returning as anhonored guest to the schoolwherehe’dcoached theUSCTrojans to a record six winsinsevenchampionshipgames
![Page 1342: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1342.jpg)
over nine years. “What’snew? What are youlearning?” Pete’s interviewerasked. Pete recounteddiscovering my research ongritanditsresonancewithhisown decades-in-the-makingapproachtocoaching.“Inourprogram,” Pete said, hiscoaching staff reinforces aculture of grit throughinnumerable “competitiveopportunities and momentsand illustrations. . . . Really
![Page 1343: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1343.jpg)
what we’re doing is we’rejusttryingtomakethemmoregritty. We’re trying to teachthemhowtopersevere.We’retrying to illustrate to themhow they can demonstratemorepassion.”
Thenhegaveanexample.Inpractice,Seahawksplaytowin—offensiveanddefensiveplayers compete against eachother with the full-throatedaggression and destroy-the-enemy intensity of a real
![Page 1344: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1344.jpg)
game. The ritual of weeklycompetition-level practice,dubbed CompetitionWednesdays, can be tracedback to Anson Dorrance,whosebookoncoachingPetedevoured when he wascraftinghisownapproach.“Ifyouthoughtofitaswhowaswinningandwhowas losing,you’d miss the wholepoint. . . . It’s really the guyacross fromus thatmakesuswho we are.” Our opponent,
![Page 1345: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1345.jpg)
Pete explained, createschallenges that help usbecomeourbestselves.
Outsiders to Seahawkscultureeasilymissthatpoint.“Guys don’t understand itrightaway,”Petesaid.“Theydon’t get it, but in time weworkourwaythroughit.”ForPete, this means sharing—inthe most transparent way—everythingthatgoesoninhisownhead, his objectives, thereasoning behind his
![Page 1346: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1346.jpg)
approach. “If I didn’t talkabout it, theywouldn’t knowthat.They’dbethinking,‘AmIgoing towinoramIgoingto lose?’ But when we talkaboutitenough,theycometoan appreciation of why theycompete.”
Pete admitted that someplayers may have more toteachthantheyhavetolearn.Seahawk free safety EarlThomas, for example, cameto him as “the most
![Page 1347: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1347.jpg)
competitive, gritty guy youcould ever imagine. . . . Hepushes and practices withmarvelous intensity. Hefocuses, studies, doeseverything.”Butthemagicofculture is that one person’sgrit can provide a model forothers.Onadailybasis,Earl“demonstrates in so manydifferent ways what he’s allabout.” If each person’s gritenhances grit in others, then,over time, you might expect
![Page 1348: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1348.jpg)
what social scientist JimFlynn calls a “socialmultiplier”effect. Ina sense,it’sthemotivationalanalogueof the infinity cube of self-reflecting mirrors Jeff Bezosbuilt as a boy—one person’sgrit enhances the grit of theothers,which in turn inspiresmore grit in that person, andsoon,withoutend.
What does Earl Thomashave to say about being aSeahawk? “My teammates
![Page 1349: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1349.jpg)
have been pushing me sincedayone.They’re helpingmeto get better, and vice versa.You have to have a genuineappreciation for teammateswhoarewillingtoputinhardwork, buy into the system,and never be satisfied withanything but continuing toevolve. It’s incredible to seethe heights we’re reachingfromthathumbleattitude.”
![Page 1350: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1350.jpg)
By the time I got around tovisiting the Seahawks’training facility,mycuriosityhaddoubled.Makingittothechampionship game insuccessive years isnotoriously hard, but theSeahawkshaddefiedtheoddsand made it to the SuperBowlagainthatyear.Insharpcontrast to the prior year’swin, which Seattle fanscelebrated with a blue andgreen ticker-tape parade that
![Page 1351: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1351.jpg)
was the largest publicgathering inSeattle’shistory,this year’s loss resulted inhowling, weeping, and thegnashingofteeth—overwhatsports commentators deemed“the worst call in NFLhistory.”
Here’s a recap: Withtwenty-six seconds on theclock, the Seahawks havepossessionoftheballandareoneyard away fromagame-winning touchdown.
![Page 1352: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1352.jpg)
EveryoneexpectsPetetocalla running play. It’s not justthat theendzone is soclose.It’s also because theSeahawks have MarshawnLynch, whose nickname isBeast Mode and who’swidelyagreedtobethesinglebest running back in theentireNFL.
Instead, Seahawksquarterback Russell Wilsonthrows a pass, the ball isintercepted, and the New
![Page 1353: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1353.jpg)
England Patriots take homethetrophy.
Since Super Bowl XLIXwas only the third footballgame I’d watched withoutinterruption in my entire life—the second being the NFCchampionship game theSeahawks hadwon theweekbefore—I can’t offer anexpert opinion on whether,indeed, passing instead ofrunning was the epitome ofcoaching misjudgment.What
![Page 1354: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1354.jpg)
interested me more when Iarrived in Seattle was Pete’sreactionandthatofthewholeteam.
Pete’s idol, basketballcoach John Wooden, wasfond of saying, “Success isnever final; failure is neverfatal. It’s courage thatcounts.” What I wanted toknowishowacultureofgritcontinues not just in theafterglow of success, but intheaftermathoffailure.What
![Page 1355: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1355.jpg)
IwantedtoknowishowPeteand the Seahawks found thecouragetocontinue.
AsIlookbackonitnow,myvisit has an “in themoment”feel:
My appointment beginswith a meeting in Pete’soffice—yes, it’s the corneroffice,butno,it’snothugeorfancy, and the door isapparently always open,
![Page 1356: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1356.jpg)
literally, allowing loud rockmusic to spill out into thehallway.“Angela,”Peteleansin to ask, “how can this daybehelpfultoyou?”
I explain my motive.Today I’mananthropologist,here to take notes onSeahawks culture. If I had apithhelmet,I’dbewearingit.
And that, of course, getsPete all excited. He tells methatit’snotjustonething.It’samillionthings.It’samillion
![Page 1357: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1357.jpg)
details.It’ssubstanceandit’sstyle.
After a day with theSeahawks, I have to agree.It’s countless small things,each doable—but each soeasy to botch, forget, orignore. And though thedetailsarecountless,therearesomethemes.
The most obvious islanguage. One of Pete’scoaches once said, “I speakfluentCarroll.”And to speak
![Page 1358: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1358.jpg)
Carroll is to speak fluentSeahawk: Always compete.You’re either competing oryou’re not. Compete ineverything you do. You’re aSeahawk24-7.Finish strong.Positiveself-talk.Teamfirst.
During my day with theteam, I can’t tell you howmany times someone—aplayer, a coach, a scout—enthusiasticallyoffersuponeofthesemorsels,butIcantellyou I don’t once hear
![Page 1359: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1359.jpg)
variations. One of Pete’sfavorite sayings is “Nosynonyms.”Whynot?“Ifyouwant to communicateeffectively, you need to beclear with the words youuse.”
Everybody Imeetpepperstheir sentences with theseCarrollisms. And whilenobodyhasquitetheneutron-powered, teenage energy ofthe sixty-three-year-old headcoach, the rest of the
![Page 1360: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1360.jpg)
Seahawksfamily,astheyliketocallthemselves,arejustasearnest inhelpingmedecodewhat these dictums actuallymean.
“Compete,” I’m told, isnotwhatI thinkit is. It’snotabouttriumphingoverothers,a notion I’ve always beenuneasy about. Competemeans excellence. “Competecomes from the Latin,”explains Mike Gervais, thecompetitive-surfer-turned-
![Page 1361: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1361.jpg)
sports-psychologist who isone of Pete’s partners inculture building. “Quiteliterally, it means strivetogether. It doesn’t haveanything in its origins aboutanotherpersonlosing.”
Miketellsmethattwokeyfactorspromoteexcellence inindividuals and in teams:“deep and rich support andrelentless challenge toimprove.”Whenhesaysthat,a lightbulb goes on in my
![Page 1362: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1362.jpg)
head. Supportive anddemanding parenting ispsychologically wise andencourages children toemulate their parents. Itstands to reason thatsupportive and demandingleadership would do thesame.
I begin to get it. For thisprofessional football team,it’snotsolelyaboutdefeatingother teams, it’s aboutpushingbeyondwhatyoucan
![Page 1363: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1363.jpg)
do today so that tomorrowyou’re just a little bit better.It’s about excellence. So, forthe Seahawks, Alwayscompete means Be all youcan be, whatever that is foryou.Reachforyourbest.
Afteroneof themeetings,anassistant coachcatchesuptomeinthehallwayandsays,“I don’t know if anyone’smentionedfinishingtoyou.”
Finishing?
![Page 1364: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1364.jpg)
“One thing we reallybelieve in here is the idea offinishing strong.” Then hegives me examples:Seahawks finish a gamestrong, playing their heartsout to the last second on theclock. Seahawks finish theseason strong. Seahawksfinisheverydrill strong.AndI ask, “But why just finishstrong?Doesn’titmakesensetostartstrong,too?”
![Page 1365: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1365.jpg)
“Yes,” the coach says,“but starting strong is easy.And for the Seahawks,‘finishing’ doesn’t literallymean‘finishing.’ ”
Of course not. Finishingstrong means consistentlyfocusing and doing yourabsolute best at everymoment,fromstarttofinish.
Soonenough,Irealizeit’snot only Pete doing thepreaching. At one point,duringameetingattendedby
![Page 1366: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1366.jpg)
more than twenty assistantcoaches, the entire roomspontaneouslybreaksoutintoa chant, in perfect cadence:Nowhining.Nocomplaining.Noexcuses. It’s likebeing ina choir of all baritones.Before this, they sang out:Always protect the team.Afterward:Beearly.
Be early? I tell them that,after reading Pete’s book, Imade“Beearly”aresolution.So far, I had yet to be early
![Page 1367: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1367.jpg)
for almost anything. Thiselicited some chuckles.Apparently, I’m not the onlywho struggles with that one.But just as important, thisconfession gets one of theguys talking about why it’simportant to be early: “It’sabout respect. It’s about thedetails.It’saboutexcellence.”Okay,okay,I’mgettingit.
Around midday, I give alecture on grit to the team.This is after giving similar
![Page 1368: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1368.jpg)
presentations to the coachesand the scouts, and beforetalking to the entire front-officestaff.
Aftermostoftheteamhasmovedontolunch,oneoftheSeahawks asks me what heshould do about his littlebrother. His brother’s verysmart, he says, but at somepoint, his grades startedslipping. As an incentive, hebought a brand-new Xboxvideo-game console and
![Page 1369: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1369.jpg)
placed it, still in itspackaging, in his brother’sbedroom. The deal was that,when the report card comeshome with A’s, he gets tounwrap the game. At first,this scheme seemed to beworking,but thenhisbrotherhit a slump. “Should I justgivehim theXbox?”heasksme.
Before I can answer,another player says, “Well,
![Page 1370: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1370.jpg)
man, maybe he’s just notcapableofA’s.”
I shake my head. “Fromwhat I’ve been told, yourbrother is plenty smartenough to bring home A’s.Hewasdoingitbefore.”
Theplayeragrees.“He’sasmart kid. Trust me, he’s asmartkid.”
I’m still thinking whenPetejumpsupandsays,withgenuine excitement: “First ofall,thereisabsolutelynoway
![Page 1371: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1371.jpg)
you give that game to yourbrother. You got himmotivated. Okay, that’s astart. That’s a beginning.Now what? He needs somecoaching!Heneeds someoneto explain what he needs todo,specifically,togetbacktogood grades! He needs aplan! He needs your help infiguringoutthosenextsteps.”
This reminds me ofsomething Pete said at thestartofmyvisit:“Everytime
![Page 1372: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1372.jpg)
I make a decision or saysomethingtoaplayer,Ithink,‘How would I treat my ownkid?’ You know what I dobest?I’magreatdad.Andina way, that’s the way Icoach.”
Attheendoftheday,I’min the lobby, waiting for mytaxi. Pete is there with me,makingsure Igetoffokay. Irealize I haven’t asked himdirectly how he and theSeahawks found the courage
![Page 1373: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1373.jpg)
to continue after he’d made“the worst call ever.” Petelater told Sports Illustratedthat it wasn’t the worstdecision, it was the “worstpossible outcome.” Heexplained that like everyother negative experience,and every positive one, “itbecomespartofyou.I’mnotgoing to ignore it. I’m goingto face it. And when itbubbles up, I’m going to
![Page 1374: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1374.jpg)
thinkaboutitandgetonwithit.Anduseit.Useit!”
Just before I leave, I turnand look up. And there,twentyfeetaboveus,infoot-high chrome letters, is theword CHARACTER. In myhand, I’m holding a bag ofblue and green Seahawkswag, including a fistful ofbluerubberbraceletsstampedingreenwithLOB:LoveOurBrothers.
![Page 1375: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1375.jpg)
Chapter13
CONCLUSION
Thisbookhasbeenaboutthepower of grit to help youachieve your potential. Iwrote it because what we
![Page 1376: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1376.jpg)
accomplish in the marathonof life depends tremendouslyon our grit—our passion andperseverance for long-termgoals. An obsession withtalent distracts us from thatsimpletruth.
This book has been myway of taking you out for acoffeeand tellingyouwhat Iknow.
I’malmostdone.Let me close with a few
final thoughts. The first is
![Page 1377: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1377.jpg)
thatyoucangrowyourgrit.I see two ways to do so.
On your own, you can growyour grit “from the insideout”: You can cultivate yourinterests. You can develop ahabit of daily challenge-exceeding-skill practice. Youcan connect your work to apurpose beyond yourself.And you can learn to hopewhenallseemslost.
You can also grow yourgrit “from the outside in.”
![Page 1378: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1378.jpg)
Parents, coaches, teachers,bosses, mentors, friends—developingyourpersonalgritdepends critically on otherpeople.
Mysecondclosingthoughtisabout happiness. Success—whether measured by whowins the National SpellingBee, makes it through WestPoint,orleadsthedivisioninannual sales—is not the only
![Page 1379: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1379.jpg)
thing you care about. Surely,you also want to be happy.And while happiness andsuccess are related, they’renotidentical.
Youmightwonder,IfIgetgrittier and become moresuccessful,willmyhappinessplummet?
Some years ago, I soughtto answer this question bysurveying two thousandAmerican adults. The graphbelowshowshowgrit relates
![Page 1380: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1380.jpg)
to life satisfaction, measuredonascalethatrangedfrom7to35andincludeditemssuchas, “If I could live my lifeover, I would change almostnothing.”Inthesamestudy,Imeasured positive emotionssuch as excitement andnegative emotions such asshame. I found that thegrittier a person is, themorelikely they’ll enjoy a healthyemotional life. Even at thetop of the Grit Scale, grit
![Page 1381: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1381.jpg)
wenthandinhandwithwell-being, no matter how Imeasuredit.
When my students and Ipublished this result, we
![Page 1382: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1382.jpg)
ended our report this way:“Arethespousesandchildrenof the grittiest people alsohappier? What about theircoworkers and employees?Additional inquiry is neededto explore the possibledownsidesofgrit.”
Idon’tyethaveanswerstothose questions, but I thinkthey’re good ones to ask.When I talk togrit paragons,and they tellmehow thrilledthey are to work as
![Page 1383: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1383.jpg)
passionately as they do for apurpose greater thanthemselves, I can’t tellwhethertheirfamiliesfeelthesameway.
Idon’tknow,forexample,whether all those yearsdevotedtoatop-levelgoalofsingular importancecomesatacostIhaven’tyetmeasured.
What I have done is askmy daughters, Amanda andLucy, what it’s like to growup with a gritty mom.
![Page 1384: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1384.jpg)
They’vewatchedme attemptthingsI’veneverdonebefore—like write a book—andthey’ve seen me cry when itgot really rough. They’veseen how torturous it can beto hack away at innumerabledoable,buthard-to-do,skills.They’veasked,atdinner:“Dowealwayshave to talkaboutdeliberatepractice?Whydoeseverythinghavetocomebacktoyourresearch?”
![Page 1385: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1385.jpg)
Amanda and Lucy wishI’d relax a little and, youknow,talkmoreaboutTaylorSwift.
But they don’t wish theirmother was anything otherthanaparagonofgrit.
In fact,AmandaandLucyaspire to achieve the same.They’ve glimpsed thesatisfaction that comes fromdoing something important—for yourself and others—anddoing it well, and doing it
![Page 1386: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1386.jpg)
eventhoughit’ssoveryhard.Theywantmoreofthat.Theyrecognize that complacencyhas its charms, but noneworth trading for thefulfillment of realizing theirpotential.
Here’s another question Ihaven’tquiteansweredinmyresearch: Can you have toomuchgrit?
![Page 1387: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1387.jpg)
Aristotle argued that toomuch(ortoolittle)ofagoodthing is bad. He speculated,for example, that too littlecourage is cowardice but toomuchcourageisfolly.Bythesame logic, you can be tookind, too generous, toohonest, and too self-controlled. It’s an argumentthat psychologists AdamGrant and Barry Schwartzhave revisited. Theyspeculate that there’s an
![Page 1388: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1388.jpg)
inverted-U function thatdescribes the benefits of anytrait,withtheoptimalamountbeingsomewherebetweentheextremes.
So far,with grit I haven’tfound the sort of inverse UthatAristotlepredictedorthatBarry and Adam have foundfor other traits, likeextroversion. Regardless, Irecognizethattherearetrade-offs to any choice, and I canappreciate how that might
![Page 1389: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1389.jpg)
apply to grit. It isn’t hard tothink of situations in whichgivingupisthebestcourseofaction.Youmay recall timesyoustuckwithanidea,sport,job, or romantic partnerlongerthanyoushouldhave.
In my own experience,giving up on piano when itbecame clear I had neitherinterest in it nor obvioustalentwas a great decision. Icould have given up evenearlier, actually, and saved
![Page 1390: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1390.jpg)
my teacher from having tolistentomesight-readall thepieces I hadn’t practiced theweek before. Giving up onbecoming fluent in Frenchwas also a good idea, eventhough I did enjoy it andpicked it up more quicklythan I did piano. Less timespent on piano and Frenchfreed up time for pursuits Ifoundmoregratifying.
So,finishingwhateveryoubeginwithout exception is a
![Page 1391: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1391.jpg)
good way to missopportunities to startdifferent, possibly better,things.Ideally,evenifyou’rediscontinuingoneactivityandchoosing different lower-order goals, you’re stillholding fast to your ultimateconcern.
One reason I don’t worrymuch about an epidemic ofgrit is that such a prospectseems so removed from ourcurrent reality. How many
![Page 1392: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1392.jpg)
days have you come homefrom work and said to yourpartner, “Gosh, everyone atthe office is just too gritty!They stick with their mostvalued goals too long! Theytrytoohard!Iwishtheywerelesspassionate!”
Recently, I asked threehundred American adults totake theGrit Scale and, afterreceiving their scores, to tellmehow they felt.Many saidthey were happy with their
![Page 1393: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1393.jpg)
scores, and some wanted tobe grittier. Nevertheless, inthe entire sample, therewasn’t a single person who,uponreflection,aspired tobelessgritty.
I’m certain most of uswouldbebetteroffwithmoregrit, not less. There may beexceptions—gritoutlierswhodon’t need to be any grittier—but those exceptions arerare.
![Page 1394: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1394.jpg)
I’vebeenasked,onmorethanone occasion,why I feel gritistheonlythingthatmatters.Infact,Idon’t.
Icantellyou,forexample,thatgritisnottheonlythingIwantmy children to developastheyroundthecornerfromchildhood to maturity. Do Iwant them to be great atwhatever they do?Absolutely.Butgreatnessandgoodnessaredifferent,and if
![Page 1395: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1395.jpg)
forced to choose, I’d putgoodnessfirst.
As a psychologist, I canconfirm that grit is far fromthe only—or even the mostimportant—aspect of aperson’scharacter. In fact, instudiesofhowpeoplesizeupothers, morality trumps allother aspects of character inimportance. Sure, we takenotice if our neighbors seemlazy, but we’re especiallyoffendedif theyseemtolack
![Page 1396: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1396.jpg)
qualities like honesty,integrity,andtrustworthiness.
So, grit isn’t everything.Therearemanyotherthingsapersonneedsinordertogrowand flourish. Character isplural.
One way to think aboutgrit is to understand how itrelates to other aspects ofcharacter. In assessing gritalong with other virtues, Ifind three reliable clusters. Irefer to them as the
![Page 1397: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1397.jpg)
intrapersonal, interpersonal,andintellectualdimensionsofcharacter.Youcouldalsocallthem strengths ofwill, heart,andmind.
Intrapersonal characterincludes grit. This cluster ofvirtues also includes self-control, particularly as itrelates to resistingtemptations like texting andvideo games. What thismeans is that gritty peopletendtobeself-controlledand
![Page 1398: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1398.jpg)
vice versa. Collectively,virtuesthatmakepossibletheaccomplishmentofpersonallyvalued goals have also beencalled “performancecharacter” or “self-management skills.” Socialcommentator and journalistDavid Brooks calls these“resume virtues” becausethey’rethesortsofthingsthatget us hired and keep usemployed.
![Page 1399: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1399.jpg)
Interpersonal characterincludes gratitude, socialintelligence, and self-controlover emotions like anger.These virtues help you getalong with—and provideassistance to—other people.Sometimes, these virtues arereferred to as “moralcharacter.” David Brooksprefers the term “eulogyvirtues” because, in the end,they may be more importantto how people remember us
![Page 1400: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1400.jpg)
than anything else.Whenwespeakadmiringlyofsomeonebeing a “deeply good”person,Ithinkit’sthisclusterof virtues we’re thinkingabout.
And, finally, intellectualcharacterincludesvirtueslikecuriosity and zest. Theseencourage active and openengagementwiththeworldofideas.
My longitudinal studiesshow these three virtue
![Page 1401: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1401.jpg)
clusters predict differentoutcomes. For academicachievement,includingstellarreportcardgrades,theclustercontaining grit is the mostpredictive. But for positivesocial functioning, includinghowmany friends you have,interpersonal character ismore important. And for apositive, independent posturetoward learning, intellectualvirtuetrumpstheothers.
![Page 1402: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1402.jpg)
Intheend, thepluralityofcharacteroperatesagainstanyone virtue being uniquelyimportant.
I’m often asked whetherencouraging grit doeschildren a disservice bysetting expectationsunreasonably high. “Careful,Dr. Duckworth, or childrenwillallgrowupthinkingthey
![Page 1403: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1403.jpg)
canbeUsainBolt,WolfgangMozart,orAlbertEinstein.”
Ifwe can’t beEinstein, isit worth studying physics? Ifwe can’t be Usain Bolt,should we go for a run thismorning?Isthereanypointintrying to run a little faster orlongerthanwedidyesterday?Inmyview, these are absurdquestions. If my daughtersays to me, “Mom, Ishouldn’t practice my pianotoday because I’ll never be
![Page 1404: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1404.jpg)
Mozart,” I’ll say in reply,“You’re not practicing pianotobeMozart.”
We all face limits—notjust in talent, but inopportunity. But more oftenthanwe think, our limits areself-imposed. We try, fail,and conclude we’ve bumpedour heads against the ceilingofpossibility.Ormaybeaftertaking just a few steps wechange direction. In either
![Page 1405: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1405.jpg)
case,weneverventureas faraswemighthave.
To be gritty is to keepputting one foot in front ofthe other. To be gritty is toholdfasttoaninterestingandpurposeful goal. To be grittyis to invest, day after weekafter year, in challengingpractice.Tobegrittyistofalldown seven times, and riseeight.
Iwas interviewedrecentlyby a journalist. As he was
![Page 1406: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1406.jpg)
packinguphisnotes,hesaid,“So, it’s obvious you couldhave talked all day. Youreallylovethissubject.”
“Oh, gosh. Is thereanything as interestingas thepsychology of achievement?Couldtherebeanythingmoreimportant?”
Hechuckled.“Youknow,”he said, “I absolutely lovewhatIdo,too.It’samazingtomehowmanypeopleIknowwho’rewell into their forties
![Page 1407: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1407.jpg)
andhaven’t really committedtoanything.Theydon’tknowwhatthey’remissing.”
Onefinalthought.Earlier thisyear, the latest
MacArthur genius awardswere announced. One of thewinners was Ta-NehisiCoates, the journalist whosesecond book, Between theWorld and Me, has been anextraordinarybestseller.
![Page 1408: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1408.jpg)
Eight years ago, Coateswas unemployed, recentlylaid off by Time magazine,and scrambling to getfreelancework.Itwasahardtime. He guesses he gainedthirtypoundsfromthestrain.“IknewwhatkindofwriterIwanted to be. I was notbecoming thatkindofwriter.I was banging my headagainst a wall and nothingwascomingout.”
![Page 1409: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1409.jpg)
His wife, he says, was“unerringlysupportive.”Still,they had a young son. Therewere practical realities. “Iwas considering driving acab.”
Hefinallygotbackonhisfeet, and after pushingthrough the “extraordinarystress”ofhisbook,hebegantohithisstride.“Thewritingwasvery,verydifferent.Thesentences had much morepower.”
![Page 1410: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1410.jpg)
In his three-minute videoposted on the MacArthurwebsite,thefirstthingCoatessays is: “Failure is probablythe most important factor inall of my work. Writing isfailure. Over and over andover again.” Then heexplains, that as a boy, hewas insatiably curious.Growing up inBaltimore, hewas particularly obsessedwith the idea of physicalsafety, and the lack thereof,
![Page 1411: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1411.jpg)
and has remained so since.Journalism, he says, lets himkeepaskingthequestionsthatinteresthim.
Toward the end of thevideo, Coates offers the bestdescriptionofwhatit’sliketowritethatI’veeverheard.Togive you a sense of hisintonation, and the cadence,I’ve laid out the words as Iheardthem—asapoem:
Thechallengeofwriting
![Page 1412: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1412.jpg)
Istoseeyourhorriblenessonpage.
ToseeyourterriblenessAndthentogotobed.
Andwakeupthenextday,Andtakethathorriblenessandthatterribleness,
Andrefineit,Andmakeitnotsoterribleandnotsohorrible.
Andthentogotobedagain.
Andcomethenextday,Andrefineitalittlebitmore,Andmakeitnotsobad.
![Page 1413: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1413.jpg)
Andthentogotobedthenextday.
Anddoitagain,Andmakeitmaybeaverage.Andthenonemoretime,Ifyou’relucky,Maybeyougettogood.
Andifyou’vedonethat,That’sasuccess.
Youmight thinkCoates isespeciallymodest.He is.Buthe’s also especially gritty.And I’ve yet to meet a
![Page 1414: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1414.jpg)
MacArthur Fellow, Nobellaureate, or Olympicchampionwhosaysthatwhatthey achieved came in anyotherway.
“You’re no genius,” mydad used to say when I wasjustalittlegirl.Irealizenowhe was talking to himself asmuchashewastalkingtome.
If you define genius asbeing able to accomplishgreat things in life without
![Page 1415: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1415.jpg)
effort, thenhewas right: I’mnogenius,andneitherishe.
But if, instead, youdefinegenius as working towardexcellence, ceaselessly, withevery element of your being—then, in fact, my dad is agenius,andsoamI,andsoisCoates,and,ifyou’rewilling,soareyou.
![Page 1416: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1416.jpg)
ACKNOWLEDGMENTS
WhenIpickupabookforthefirst time, I immediately flipto the Acknowledgments.Likemanyreaders,I’meagerto peek behind the curtain; Iwant to meet the cast andcrew responsible for the
![Page 1417: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1417.jpg)
show.Writingmy own bookhas only deepened myappreciation for the teameffort that any workrepresents. If you like thisbook,pleaseknowthatcreditfor its creation is sharedamong the wonderful humanbeings recognized here. It’stime for these manysupporterstostepoutintothefootlights for a moment andtake a well-deserved bow. IfI’veleftanyoneinthewings,
![Page 1418: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1418.jpg)
I apologize; any omissionsareinadvertent.
First and foremost, Iwantto thank my collaborators. Iwrote this book in the first-person singular, using “I”when, in fact, pretty mucheverything I’ve done as aresearcher or writer wasaccomplished by a plurality.The“we”whodeservecredit—in particular coauthors onpublished research—arenamed individually in the
![Page 1419: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1419.jpg)
Notes. On their behalf, Iextend a heartfelt thanks toour research teams who,collectively, made thisresearchpossible.
As for the book itself, Ihave three individuals tothank in particular: First andforemost, I am eternallygrateful to my editor, RickHorgan, who improved mywriting and thinking morethan I thought was possible.If I’m lucky, he’ll let me
![Page 1420: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1420.jpg)
work with him again (andagain).MaxNesterakwasmyday-to-day editor, researchassistant,andconscience.Putsimply, were it not forMax,this book would not be inyour hands today. And,finally, my fairy godfatherand agent, Richard Pine, isthe person who originally,andfinally,madethisbookareality. Eight years ago,Richard wrote me an emailasking,“Hasanyoneevertold
![Page 1421: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1421.jpg)
youthatyouought towriteabook?” I demurred. Grittyand gallant, he kept asking,butneverpushing,untilIwasready. Thank you, Richard,foreverything.
The following scholarswere kind enough to reviewdrafts of this book, discusstheirrelevantwork,orboth—of course, any errors thatremain are mine: ElenaBodrova, MihályCsíkszentmihályi, Dan
![Page 1422: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1422.jpg)
Chambliss,JeanCôté,SidneyD’Mello,BillDamon,NancyDarling, Carol Dweck, BobEisenberger, AndersEricsson, Lauren Eskreis-Winkler, Ronald Ferguson,James Flynn, Brian Galla,MargoGardner,AdamGrant,James Gross, Tim Hatton,Jerry Kagan, Scott BarryKaufman, Dennis Kelly,Emilia Lahti, Reed Larson,Luc Leger, Deborah Leong,Susan Mackie, Steve Maier,
![Page 1423: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1423.jpg)
Mike Matthews, DarrinMcMahon, Barbara Mellers,Cal Newport, GabrielleOettingen, Daeun Park, PatQuinn,AnnRenninger,BrentRoberts,ToddRogers, JamesRounds, Barry Schwartz,Marty Seligman, Paul Silvia,Larry Steinberg, Rong Su,PhilTetlock,Chia-JungTsay,Eli Tsukayama, ElliotTucker-Drob, GeorgeVaillant, Rachel White, DanWillingham, Warren
![Page 1424: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1424.jpg)
Willingham, AmyWrzesniewski, and DavidYeager.
I was shocked, and sodeeply moved, that thefollowing individuals werewilling to share their storiesfor this book; even when Iwasn’table to includedetailsin the book itself, theirperspectives deepened myunderstanding of grit and itsdevelopment: HemalathaAnnamalai, Kayvon
![Page 1425: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1425.jpg)
Asemani,Michael Baime, JoBarsh, Mark Bennett, JackieBezos,JulietBlake,GeoffreyCanada, Pete Carroll, RobertCaslen, Ulrik Christensen,KerryClose,RoxanneCoady,Kat Cole, Cody Coleman,Daryl Davis, Joe de Sena,TomDeierlein,JamieDimon,Anson Dorrance, AuroraFonte, Franco Fonte, BillFitzsimmons,RowdyGaines,Antonio Galloni, BruceGemmell, Jeffrey Gettleman,
![Page 1426: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1426.jpg)
Jane Golden, TempleGrandin, Mike Hopkins,Rhonda Hughes, MichaelJoyner,NoaKageyama,PaigeKimble, Sasha Kosanic,Hester Lacey, Emilia Lahti,Terry Laughlin, Joe Leader,Michael Lomax, DavidLuong, Tobi Lütke, WarrenMacKenzie, WillyMacMullen, Bob Mankoff,Alex Martinez, FrancescaMartinez, Tina Martinez,Duff McDonald, Bill
![Page 1427: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1427.jpg)
McNabb,BernieNoe,ValerieRainford, Mads Rasmussen,AnthonySeldon,WillShortz,Chantel Smith, AreTraasdahl, Marc Vetri, ChrisWink, Grit Young, SherryYoung, Steve Young, SamZell,andKaiZhang.
Many friends and familymembers helped improveearlier drafts. For theirinvaluablecomments,IthankSteve Arnold, BenMalcolmson, Erica Dewan,
![Page 1428: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1428.jpg)
Feroz Dewan, JoeDuckworth,JordanEllenberg,Ira Handler, DonaldKamentz,AnnetteLee,SusanLee, Dave Levin, FeliciaLewis, Alyssa Matteucci,David Meketon, EvanNesterak, Rick Nichols,Rebecca Nyquist, TanyaSchlam, Robert Seyfarth,Naomi Shavin, Paul Solman,Danny Southwick, SharonParker, Dominic Randolph,Richard Shell, Paolo Terni,
![Page 1429: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1429.jpg)
Paul Tough, Amy Wax, andRichWilson.
The figures in this bookarecourtesyofStephenFew.A world expert on datavisualization, Stephen is alsothe soul of generosity andpatience.
I am immensely gratefulfor the unflagging support ofso many outstandingindividuals at Simon &Schuster.Theonlyhardthingabout writing this book was
![Page 1430: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1430.jpg)
the writing; everything else,these remarkable folks madeeasy.Inparticular,I’dliketothank Nan Graham, whoseoptimism, energy, andgenuine affection for herauthors have no parallel.Katie Monaghan and BrianBelfiglio masterfullyorchestrated a world-classpublicity campaign, ensuringthat this book would end upin your hands. For masterfulhandling of this book’s
![Page 1431: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1431.jpg)
production, I thank CarlaBenton and her team. DavidLamb, you’re a total pro;your commitment toexcellence at every stage oftheeditorialprocessmadeallthe difference. And, finally,for this book’s beautifulcover, I am grateful to JayaMiceli.
Huge thanks to theworld-class team at InkWellManagement, including ElizaRothstein, Lindsey Blessing,
![Page 1432: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1432.jpg)
and Alexis Hurley. Youhandle somuch sowell, andwith utter grace andprofessionalism.
Like the grit paragonsprofiled in this book, I’vebenefited from especiallysupportive and demandingteachers. Matthew Carrtaughtmetowriteandtolovewords. Kay Mersethreminded me, at so manycriticaljunctures,thateachofus is the author of our own
![Page 1433: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1433.jpg)
life story. Marty Seligmantaught me that the rightquestion is at least asimportantastherightanswer.The late Chris Petersonshowedmethatatrueteacherisonewhoputsstudentsfirst.SigalBarsade showedme, ininnumerable ways, what itmeans to be a professor andhowtobeagoodone.WalterMischelshowedmethatatitsapogee,scienceisanart.AndJimHeckman taughtme that
![Page 1434: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1434.jpg)
genuine curiosity is the bestcompaniontotruegrit.
Iamdeeplygratefultotheinstitutions and individualswho have supported myresearch, including theNational Institute on Aging,the Bill & Melinda GatesFoundation, the PinkertonFoundation,theRobertWoodJohnson Foundation, theKIPP Foundation, the JohnTempleton Foundation, theSpencerFoundation,theLone
![Page 1435: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1435.jpg)
Pine Foundation, the WaltonFamily Foundation, theRichardKingMellon FamilyFoundation,theUniversityofPennsylvania ResearchFoundation,AccoBrands,theMichigan RetirementResearch Center, theUniversity of Pennsylvania,Melvyn and Carolyn Miller,ArielKor,andAmyAbrams.
Theboardandstaffof theCharacterLabdeservespecialthanks because they are the
![Page 1436: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1436.jpg)
past, present, and mostdefinitely the future of all Ido.
And, finally, thank you tomy family. Amanda andLucy, your patience, goodhumor, and storiesmade thisbookpossible.MomandDad,you gave up everything foryour children, and we loveyouforthat.Jason,youmakemeabetterpersoneveryday—thisbookisforyou.
![Page 1437: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1437.jpg)
RECOMMENDEDREADING
Brooks,David.The Road toCharacter. New York:RandomHouse,2015.
Brown, Peter C., Henry L.Roediger III,andMarkA.
![Page 1438: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1438.jpg)
McDaniel. Make It Stick:The Science of SuccessfulLearning. Cambridge,MA:BelknapPress,2014.
Damon,William.ThePathtoPurpose: How YoungPeopleFindTheirCallingin Life. New York: FreePress,2009.
Deci, Edward L. withRichard Flaste. Why WeDo What We Do:Understanding Self-
![Page 1439: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1439.jpg)
Motivation. New York:PenguinGroup,1995.
Duhigg, Charles.The Powerof Habit: Why We DoWhat We Do in Life andBusiness. New York:RandomHouse,2012.
Dweck, Carol.Mindset: TheNew Psychology ofSuccess. New York:RandomHouse,2006.
Emmons,RobertA.Thanks!:How the New Science ofGratitude Can Make You
![Page 1440: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1440.jpg)
Happier. New York:Houghton MifflinHarcourt,2007.
Ericsson,Anders andRobertPool. Peak: Secrets fromthe New Science ofExpertise. New York:Houghton MifflinHarcourt,2016.
Heckman, James J., JohnEric Humphries, and TimKautz (eds.).TheMyth ofAchievement Tests: TheGED and the Role of
![Page 1441: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1441.jpg)
Character in AmericanLife. Chicago: UniversityofChicagoPress,2014.
Kaufman, Scott Barry andCarolyn Gregoire. Wiredto Create: Unraveling theMysteries of the CreativeMind.NewYork:Perigee,2015.
Lewis, Sarah. The Rise:Creativity, the Gift ofFailure, and the Searchfor Mastery. New York:SimonandSchuster,2014.
![Page 1442: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1442.jpg)
Matthews,Michael D.HeadStrong: How Psychologyis Revolutionizing War.New York: OxfordUniversityPress,2013.
McMahon,DarrinM.DivineFury:AHistoryofGenius.New York: Basic Books,2013.
Mischel, Walter. TheMarshmallow Test:Mastering Self-Control.NewYork: Little, Brown,2014.
![Page 1443: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1443.jpg)
Oettingen, Gabriele.Rethinking PositiveThinking: Inside the NewScience of Motivation.New York: PenguinGroup,2014.
Pink, Daniel H. Drive: TheSurprising Truth AboutWhat Motivates Us. NewYork: Riverhead Books,2009.
Renninger, K. Ann andSuzanne E. Hidi. ThePower of Interest for
![Page 1444: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1444.jpg)
Motivation andEngagement. New York:Routledge,2015.
Seligman, Martin E. P.Learned Optimism: HowToChangeYourMindandYour Life. New York:AlfredA.Knopf,1991.
Steinberg, Laurence. Age ofOpportunity:Lessonsfromthe New Science ofAdolescence. New York:Houghton MifflinHarcourt,2014.
![Page 1445: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1445.jpg)
Tetlock, Philip E. and DanGardner.Superforecasting: The ArtandScienceofPrediction.NewYork:Crown,2015.
Tough, Paul. How ChildrenSucceed: Grit, Curiosity,and the Hidden Power ofCharacter. New York:Houghton MifflinHarcourt,2012.
Willingham, Daniel T. WhyDon’t Students LikeSchool: A Cognitive
![Page 1446: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1446.jpg)
Scientist AnswersQuestions About How theMind Works and What ItMeans for the Classroom.San Francisco: Jossey-Bass,2009.
![Page 1447: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1447.jpg)
ABOUTTHEAUTHOR
![Page 1448: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1448.jpg)
PHOTOBYZACHTERIS
Angela Duckworth is aprofessorofpsychologyatthe University of
![Page 1449: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1449.jpg)
Pennsylvania and a 2013MacArthur Fellow. Shestudies grit and otherattributes that predictsuccess in life. A formermiddle and high schoolmath teacher, Angelarecently co-founded theCharacterLab, anonprofitwhose mission is toadvance the science andpractice of characterdevelopmentinchildren.
![Page 1450: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1450.jpg)
MEETTHEAUTHORS,WATCHVIDEOSANDMOREAT
SimonandSchuster.comauthors.simonandschuster.com/Angela-
Duckworth
![Page 1451: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1451.jpg)
WehopeyouenjoyedreadingthisScribner
eBook.
Joinourmailinglistandgetupdatesonnewreleases,deals,bonuscontentandothergreatbooksfromScribnerandSimon
&Schuster.
![Page 1452: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1452.jpg)
CLICKHERETOSIGNUP
orvisitusonlinetosignupateBookNews.SimonandSchuster.com
![Page 1453: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1453.jpg)
NOTES
CHAPTER1:SHOWINGUPmore than 14,000 applicants:
For more information on WestPoint, including its admissionsprocess,seewww.usma.edu.
drop out before graduation:Data provided by the UnitedStatesMilitaryAcademy.
![Page 1454: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1454.jpg)
“new cadet to Soldier”:“Information for New Cadetsand Parents,” United StatesMilitary Academy–West Point,2015,www.usma.edu/parents/SiteAssets/Info-4-New-Cadets_Class-of-19.pdf.
“West Point toughens you”:Ibid.
andwhowouldleave:Formoreon Jerry’s views aboutpredictingWestPointoutcomes,see Jerome Kagan, AnArgument for Mind (NewHaven, CT: Yale UniversityPress,2006),49–54.
![Page 1455: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1455.jpg)
West Point admissions: FormoreinformationontheWholeCandidateScoreanditshistory,see Lawrence M. Hanser andMustafa Oguz, United StatesService Academy Admissions:Selecting for Success at theMilitary Academy/West Pointand as an Officer (SantaMonica, CA: RANDCorporation,2015).
thosewiththelowest:AngelaL.Duckworth, ChristopherPeterson,MichaelD.Matthews,and Dennis R. Kelly, “Grit:
![Page 1456: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1456.jpg)
Perseverance and Passion forLong-term Goals,” Journal ofPersonality and SocialPsychology 92 (2007): 1087–1101.
“I was tired, lonely,frustrated”: Michael D.Matthews, Head Strong: HowPsychology Is RevolutionizingWar (New York: OxfordUniversityPress,2014),16.
“never give up” attitude: MikeMatthews, professor ofengineering psychology at theU.S.MilitaryAcademyatWest
![Page 1457: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1457.jpg)
Point, in conversation with theauthor,May25,2015.
physical fitness marks: HanserandOguz,SelectingforSuccess.
seventy-one cadets haddroppedout:Duckworthetal.,“Grit.”
55percentofthesalespeople:Lauren Eskreis-Winkler,Elizabeth P. Shulman, Scott A.Beal,andAngelaL.Duckworth,“The Grit Effect: PredictingRetention in the Military, theWorkplace, School and
![Page 1458: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1458.jpg)
Marriage,” Frontiers inPsychology5(2014):1–12.
graduate degree were grittier:Duckworth,etal.,“Grit.”
ashighas80percent:Formoreinformation on college dropoutrates in the United States, see“Institutional Retention andGraduation Rates forUndergraduate Students,”National Center for EducationStatistics, last updated May2015,http://nces.ed.gov/programs/coe/indicator_cva.asp
![Page 1459: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1459.jpg)
“wherewedecide”:DickCouch,ChosenSoldier:TheMakingofaSpecialForcesWarrior(NewYork: Three Rivers Press,2007),108.
42 percent of the candidates:Eskreis-Winkler et al., “TheGritEffect.”
Success in the military,business, and education:Ibid. Importantly, the bivariateassociations between grit andoutcomes were in all casessignificantaswell.
![Page 1460: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1460.jpg)
toall273spellers:Duckworthetal.,“Grit.”
SAT scores and grit: Ibid. Seealso Kennon M. Sheldon, PaulE. Jose, ToddB.Kashdan, andAaron Jarden, “Personality,Effective Goal-Striving, andEnhanced Well-Being:Comparing 10 CandidatePersonality Strengths,”Personality and SocialPsychology Bulletin 1 (2015),1–11. In this one-yearlongitudinalstudy,gritemergedas a more reliable predictor of
![Page 1461: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1461.jpg)
goal attainment than any othermeasured personality strength.Likewise, my colleagues PhilTetlock and Barbara Mellershavefoundintheir longitudinalresearch that people whoforecast future events withastonishing accuracy areconsiderablygrittierthanothers:“The strongest predictor ofrising into the ranks ofsuperforecasters is perpetualbeta,thedegreetowhichoneiscommitted to belief updatingand self-improvement. It isroughlythreetimesaspowerful
![Page 1462: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1462.jpg)
a predictor as its closest rival,intelligence.” See Philip E.Tetlock and Dan Gardner,Superforecasting: The Art andScience of Prediction (NewYork:Crown,2015),page192.
CHAPTER2:DISTRACTEDBYTALENTin the classroom: The school I
taught atwas created byTeachFor America alumnus DanielOscar,andinmyview,thebestteacherintheschoolwasaguynamed Neil Dorosin. Both
![Page 1463: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1463.jpg)
Daniel and Neil are still in thevanguardofeducationreform.
“I was a little behind”: DavidLuong,inaninterviewwiththeauthor,May8,2015.
learning came easy: KarlPearson, The Life, Letters andLaboursofFrancisGalton,vol.1 (Cambridge, UK: CambridgeUniversityPress,1930),66.
“capacity for hard labor”:Francis Galton, HereditaryGenius (London: Macmillan,1869),38.It’simportanttonotehere that Galton’s fascination
![Page 1464: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1464.jpg)
with heredity was misguided.Whilehisconclusionsabouttheimportance of zeal and hardwork and ability have beensupported by modern research,hiserroneousconclusionsaboutheredityandracehavenot.
“eminently importantdifference”: Charles Darwin,Letter to Francis Galton,December 23, 1869. FrederickBurkhardt et al., ed., TheCorrespondence of CharlesDarwin, vol. 17, 1869
![Page 1465: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1465.jpg)
(Cambridge, UK: CambridgeUniversityPress,2009),530.
supernatural intelligence: SeeLeonard Mlodinow, TheUpright Thinkers: The HumanJourneyfromLivinginTreestoUnderstanding the Cosmos(New York: Pantheon Books,2015), 195. Catharine MorrisCox, “The Early Mental TraitsofThreeHundredGeniuses,”inGenetic Studies of Genius, vol.2, ed. Lewis M. Terman,(Stanford, CA: StanfordUniversityPress,1926),399.
![Page 1466: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1466.jpg)
“no great quickness”: CharlesDarwin, The Autobiography ofCharles Darwin (London:Collins Clear-Type Press,1958),140–41.
data presented itself: Adam S.Wilkins, “Charles Darwin:Genius or Plodder?” Genetics183(2009):773–77.
“The Energies of Men”:William James, “The Energiesof Men,” Science 25 (1907):321–32.
that our talents vary: Talentsare, of course, plural. For
![Page 1467: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1467.jpg)
interested readers, see HowardGardner,Frames of Mind: TheTheoryofMultipleIntelligences(New York: Basic Books,1983). Also, Ellen Winner,Gifted Children: Myths andRealities (New York: BasicBooks, 1996). Robert J.Sternberg and James C.Kaufman, “Human Abilities,”Annual Review of Psychology49(1998):479–502.
twice as likely to single outeffort: Survey of America’sInner Financial Life, WorthMagazine,November1993.
![Page 1468: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1468.jpg)
about athletic ability: “CBSNewsPoll:DoesPracticeMakePerfect in Sports?,”CBSNewswebsite, April 6, 2014,www.cbsnews.com/news/cbs-news-poll-does-practice-make-perfect-in-sports.
endorse “intelligence”: The 60Minutes/Vanity Fair Poll,VanityFair,January2010.
more likely to succeed: Chia-Jung Tsay and Mahzarin R.Banaji, “Naturals and Strivers:Preferences and Beliefs AboutSources of Achievement,”
![Page 1469: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1469.jpg)
Journal of Experimental SocialPsychology47(2011):460–65.
naturals were rated higher:Chia-Jung Tsay, “PrivilegingNaturals Over Strivers: TheCosts of theNaturalnessBias,”Personality and SocialPsychologyBulletin(2015).
favorthenatural:Ibid.“technical skills can flourish”:
“Juilliard Pre-College,” TheJuilliard School, accessedAugust 10, 2015,http://www.juilliard.edu/youth-adult-programs/juilliard-pre-college
![Page 1470: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1470.jpg)
a self-fulfilling prophecy:Robert Rosenthal, “PygmalionEffect,” in The CorsiniEncyclopediaofPsychology,ed.Irving B. Weiner and W.Edward Craighead (Hoboken,NJ: John Wiley & Sons, Inc.,2010),1398–99.
“Iwanted to get better”:Chia-JungTsay,assistantprofessoratthe University College LondonSchool of Management, in aninterviewwiththeauthor,April8,2015.
![Page 1471: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1471.jpg)
“TheWarforTalent”:ElizabethChambers et al., “TheWar forTalent,”McKinsey Quarterly 3(1998):44–57.
becameabest-sellingbook:EdMichaels, Helen Handfield-Jones, and Beth Axelrod, TheWar for Talent (Boston:HarvardBusinessSchoolPress,2001).
“Whatdowemeanbytalent?”:Ibid.,xii.
“like comparing SAT scores”:John Huey, “How McKinsey
![Page 1472: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1472.jpg)
Does It,” Fortune, November1993:56–81.
onbeing“bright”:Ibid.,56.The War on Common Sense:
Duff McDonald, “McKinsey’sDirty War: Bogus ‘War forTalent’ Was Self-Serving (andFailed),” New York Observer,November5,2013.
Gladwell has also critiqued:MalcolmGladwell,“TheTalentMyth,” New Yorker, July 22,2002.
largest corporate bankruptcy:Clinton Free, NormanMacintosh, and Mitchell Stein,
![Page 1473: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1473.jpg)
“Management Controls: TheOrganizational Fraud Triangleof Leadership, Culture, andControl in Enron,” IveyBusiness Journal, July 2007,http://iveybusinessjournal.com/publication/management-controls-the-organizational-fraud-triangle-of-leadership-culture-and-control-in-enron/.
firing the bottom 15 percent:Ibid.
“alwaysasteportwobehind”:Scott Barry Kaufman, directorof the Imagination Institute, inan interview with the author,
![Page 1474: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1474.jpg)
May 3, 2015. Also seewww.scottbarrykaufman.com.
“I was so driven”: Scott BarryKaufman, “From Evaluation toInspiration: Scott BarryKaufman atTEDxManhattanBeach,”YouTubevideo,postedJanuary6, 2014,https://youtu.be/HQ6fW_GDEpA
“does achievement trumppotential?”:Ibid.
“I had this grit”: Kaufman,interview.
![Page 1475: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1475.jpg)
deemed insufficiently bright: Iknow two other people whosetested aptitude wasn’tparticularly prognostic of whatthey would go on to achieve.ThefirstisDarrinMcMahon,aneminent historian at DartmouthCollege. In Darrin’s book,Divine Fury: A History ofGenius (New York: BasicBooks,2013),hepointsoutthatgenius incites ambivalence. Ononehand,theideathatafewofusstandabovetherestbyvirtueof our God-given gifts holdstimeless appeal. On the other
![Page 1476: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1476.jpg)
hand, we love the idea ofequality;weliketothinkweallhave the same chance ofsucceeding in life. In a recentconversation on this topic,Darrin told me, “What we areseeing play out now is thedemocratization of genius. Partof us wants to believe thateveryone can be a genius.” Iwas never a very good historystudent, and sometimes Iwasavery poor one. So I was morethan a little surprised that Icouldn’t put Darrin’s bookdown.Itwasbeautifullywritten.
![Page 1477: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1477.jpg)
The meticulous research andcarefulargumentationsomehowdid not get in the way of ittellinga story.And then,at theveryend,onpage243, Igot tothe acknowledgments: “I haveundoubtedly suffered frommanydelusionsinmylife—andundoubtedly suffer from manystill. But being a genius is notoneofthem.”ThenDarrinsays,with humor and affection, thatwhen he was growing up, hisparents saw to it that their son“never got too big for hisbritches.”Andevenmoretothe
![Page 1478: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1478.jpg)
point,he recallsbeing testedasa child for his school’s giftedprogram. There were “shapesand pictures and the like,” butthe only thing he rememberswithcertaintyis“Ididn’tpass.”Darrin rememberswatching hisclassmates “trundle off eachweek to special classes for thespecially endowed.” And thenhe reflects on whether gettinglabeled nongifted was, in theend, a blessing or a curse: “Atanearlyage,Iwastold,withalltheobjectivityofscience,thatIwas not the recipient of gifts. I
![Page 1479: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1479.jpg)
might have just thrown in thetowelthenandthere,butIamastubbornsort,andIspentmanyyears disputing the verdict,working away to prove tomyself and to others, dammit,that I had not been slighted atbirth.” Similarly, MichaelLomax was not easilyidentifiable as any kind ofprodigy.Nevertheless,hehasanillustrious résumé: he ispresident and CEO of theUnited Negro College Fund, aleadership position he has heldformore than a decade.Before
![Page 1480: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1480.jpg)
that, Michael was president ofDillard University. He hastaught English at EmoryUniversity, Spelman College,andMorehouseCollegeandwasa two-time mayoral candidatefor the city of Atlanta.“Honestly, I wasn’t consideredthe smartest kid,”Michael toldme recently. When he wassixteen,hismotherneverthelesswrote to the president ofMorehouse College to askwhether her son could beadmittedtoitsprepschool.“Ofcourse,therewasnoprepschool
![Page 1481: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1481.jpg)
at Morehouse!” Michaelchuckled. The Morehousepresident decided, on the basisof Michael’s outstandinggrades, to admit him as afreshman to the college. “I gotthere. I hated it. I wanted toleave. Iwas number one inmyclass,butIwantedtotransfer.IgotitinmyheadthatIwouldbeabetterfitatWilliamsCollege,so I applied. I had doneeverything,andtheywereaboutto admit me, and then thedirectorofadmissionssaid,‘Oh,by the way, we need an SAT
![Page 1482: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1482.jpg)
score.’ ” Because he’d beenadmitted toMorehousewithouta formal application, MichaelhadnevertakentheSATbefore.“That test was make-or-breakforme. I sat down and took it.And I didn’t dowell.Williamsdidn’t admit me.” So Michaelstayed atMorehouse andmadethe best of it, graduating PhiBeta Kappa with a degree inEnglish. Later, he earned hismaster’sdegreeinEnglishfromColumbia University, and hisPhD in American and AfricanAmericanliteraturefromEmory
![Page 1483: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1483.jpg)
University. Now sixty-eightyearsold,Michaeltoldme,“Atmy age, I think it’s charactermore than genius. I know allkinds of very talented peoplewhosquandertheirgreattalents,or who are dissatisfied andunhappy because they thinktalentisenough.Infact,itain’teven near enough. What I tellmy kids, what I try to tell mygrandchildren, and anybody Iget a chance to mentor is this:It’s the sweat, it’s the hardwork, it’s the persistence, it’sthe determination. It is the
![Page 1484: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1484.jpg)
getting up and dusting yourselfoff. That’swhat it’s all about.”In anticipation of hate mailaboutthispassageongiftedandtalented programs, let me saythis: I am wholeheartedly infavor of giving kids all theintellectualstimulationtheycanhandle.Atthesametime,Iurgeopening those programs to allchildren who might benefit.Thirty years ago, BenjaminBloomsaid it best: “We in thiscountry have come to believethatwecan tellwho’sgoing tobe a great musician by giving
![Page 1485: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1485.jpg)
musical aptitude tests, who’sgoing to be a greatmathematician by givingmathematics aptitude tests.Doing that counts some peoplein and others out far tooearly. . . . All the childrenshouldbegivenopportunitiestoexplorefieldsthattheymightbeinterestedin.”RonaldS.Brandt,“On Talent Development: AConversation with BenjaminBloom,” EducationalLeadership43(1985):33–35.
![Page 1486: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1486.jpg)
CHAPTER3:EFFORTCOUNTSTWICE“The Mundanity of
Excellence”: Daniel F.Chambliss, “The Mundanity ofExcellence: An EthnographicReport on Stratification andOlympic Swimmers,”Sociological Theory 7 (1989):70–86.
“dozens of small skills”: Ibid.,81.
“Youneed to jazz it up”: Ibid.,86.
![Page 1487: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1487.jpg)
“wehaveforathleticsuccess”:Ibid.,78.
“distinguishes the best amongourathletes”:Ibid,78.
“It’seasytodo”:Ibid.,79.“anatomical advantages”:
Daniel F. Chambliss, professorof sociology at HamiltonCollege, in an interview withtheauthor,June2,2015.
“how itcametobe”:This is aninformal translation, FriedrichNietzsche, Menschliches,Allzumenschliches: Ein Buchfür Freie Geister (Leipzig:
![Page 1488: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1488.jpg)
Alfred Kröner Verlag, 1925),135.
“out of the ground bymagic”:FriedrichNietzsche,Human,AllToo Human: A Book for FreeSpirits, trans. R. J. Hollingdale(Cambridge, UK: CambridgeUniversityPress,1986),80.
“grows somewhat cool”: Ibid.,86.
“thecultofthegenius”:Ibid.“activeinonedirection”:Ibid.“giftedness, inborn talents!”:
Ibid.
![Page 1489: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1489.jpg)
human flourishing: MartySeligman lays out the rationalefor Positive Psychology in hispresidential address to theAmerican PsychologicalAssociation, reprinted inAmerican Psychologist 54(1999):559–62.
talentishowquickly:Thewordtalent is used differently bydifferentpeople,but I think themost intuitive definition is theone I’ve offered here. Forevidence that individuals dodiffer in the rate at which they
![Page 1490: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1490.jpg)
acquireskills,seePaulB.Baltesand Reinhold Kliegl, “FurtherTesting of Limits of CognitivePlasticity: Negative AgeDifferences in a MnemonicSkill Are Robust,”Developmental Psychology 28(1992): 121–25. See also TomStafford and Michael Dewar,“TracingtheTrajectoryofSkillLearning with a Very LargeSample of Online GamePlayers,” PsychologicalScience, 25 (2014), 511–18.Finally, see the work of DavidHambrick and colleagues on
![Page 1491: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1491.jpg)
factors other than practice thatlikely influence skillacquisition; for example, seeBrooke N. Macnamara, DavidZ. Hambrick, and Frederick L.Oswald, “Deliberate Practiceand Performance in Music,Games, Sports, Education, andProfessions: AMeta-Analysis,”Psychological Science 25(2014): 1608–18. A critique ofthis meta-analysis bypsychologist Anders Ericsson,whoseworkweexploreindepthin chapter 7, is posted on his
![Page 1492: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1492.jpg)
website:https://psy.fsu.edu/faculty/ericsson/ericsson.hp.html
“going to be the renaissancepeople”: “Oral HistoryInterview with WarrenMacKenzie, 2002 October 29,”Archives of American Art,Smithsonian Institution,www.aaa.si.edu/collections/interviews/oral-history-interview-warren-mackenzie-12417.
“ourtrueinterestlay”:Ibid.“40 or 50 pots in a day”:
Warren MacKenzie, potter, in
![Page 1493: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1493.jpg)
an interview with the author,June16,2015.
“continue to engage thesenses”: Warren MacKenzie,Artist’s Statement, SchallerGallery,https://www.schallergallery.com/artists/macwa/pdf/MacKenzie-Warren-statement.pdf.
“the most exciting things”:“Oral History,” Archives ofAmericanArt.
“inmyworktoday”:Ibid.“first 10,000 pots are
difficult”:AlexLauer,“Livingwith Pottery: Warren
![Page 1494: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1494.jpg)
MacKenzie at 90,” Walker ArtCenterblog,February16,2014,http://blogs.walkerart.org/visualarts/2014/02/16/living-with-pottery-warren-mackenzie-at-90.
“Garp was a naturalstoryteller”: John Irving, TheWorldAccordingtoGarp(NewYork:Ballantine,1978),127.
“the great storyteller”: PeterMatthiessen, quoted in “Life&Times:JohnIriving,”NewYorkTimes,http://www.nytimes.com/books/97/06/15/lifetimes/irving.html
![Page 1495: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1495.jpg)
Garp “couldmake things up”:Irving,Garp,127.
“mylackoftalent”:JohnIrving,The Imaginary Girlfriend: AMemoir(NewYork:Ballantine,1996),10.
SAT verbal score was 475:Sally Shaywitz, OvercomingDyslexia:ANewandCompleteScience-based Program forReadingProblemsatAnyLevel(New York: Alfred A. Knopf,2003),345–50.
“lazy”and“stupid”:Ibid.,346.
![Page 1496: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1496.jpg)
“frequentlymisspelledwords”:Irving,ImaginaryGirlfriend,9.
“slowly—and with my finger”:Shaywitz, OvercomingDyslexia,346.
“you have to overextendyourself”:Ibid.,347.
“nomatterhowdifficultitis”:Ibid.
“Rewriting is what I do best”:John Irving, “Author Q&A,”Random House OnlineCatalogue,2002.
“to have to go slowly”:Shaywitz, OvercomingDyslexia,347.
![Page 1497: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1497.jpg)
“sickening work ethic”: 60Minutes, CBS, December 2,2007,http://www.cbsnews.com/news/will-smith-my-work-ethic-is-sickening.AlyricinoneofWillSmith’s raps goes: “If you sayyou’regoingtorunthreemiles,and you only run two, I don’teverhavetoworryaboutlosingin nothing to you.” See “WillSmith Interview: Will Power,”Reader’s Digest, December2006.
![Page 1498: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1498.jpg)
“or I’m going to die”: TavisSmiley, PBS, December 12,2007.
“healthyyoungmen”: ClarkW.Heath, What People Are: AStudy of Normal Young Men(Cambridge, MA: HarvardUniversityPress,1945),7.
foronlyfourminutes:KatharineA.Phillips,GeorgeE.Vaillant,and Paula Schnurr, “SomePhysiologic Antecedents ofAdult Mental Health,” TheAmericanJournalofPsychiatry144(1987):1009–13.
![Page 1499: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1499.jpg)
“strength of will”: Heath,NormalYoungMen,75.
“becomestoosevere”:Ibid.,74.“with mental health”: Phillips,
Vaillant, and Schnurr, “SomePhysiologic Antecedents,”1012.
“I’m not all that persistent”:George Vaillant, professor atHarvard Medical School andformer director of the GrantStudy, in an interviewwith theauthor,April8,2015.
“neverwritetheplayorbook”:William Safire, “On Language;
![Page 1500: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1500.jpg)
The Elision Fields,” New YorkTimes,August13,1989.
“Eighty percent of success inlifeisshowingup”:Ibid.
less than they’d expected:Consumer Reports, “HomeExercise Machines,” August2011.
“beating on your craft”: Todayshow,NBC,June23,2008.
CHAPTER4:HOWGRITTYAREYOU?Grit Scale: The original twelve-
itemGritScale,fromwhichthis
![Page 1501: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1501.jpg)
ten-itemversionisadapted,waspublished in Duckworth et al.,“Grit.”Thecorrelationbetweenthese two versions of the scaleis r = .99. Note also that, asyou’ll learn in chapter 9, I’verevised item2,adding,“Idon’tgive up easily” to “Setbacksdon’tdiscourageme.”
howyourscorescompare:Datafor these norms are fromDuckworth et al., “Grit” Study1.Notethattherearenumerouslimitations of any measure,including self-reportquestionnaires like the Grit
![Page 1502: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1502.jpg)
Scale. For an extendeddiscussion, see Angela L.Duckworth and David S.Yeager,“MeasurementMatters:Assessing Personal QualitiesOther Than Cognitive Abilityfor Educational Purposes,”Educational Researcher 44(2015):237–51.
“work in East Africa”: JeffreyGettleman, East Africa bureauchieffortheNewYorkTimes,inan interview with the author,May22,2015.
![Page 1503: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1503.jpg)
“itwastheeasiesttofulfilltherequirements”: AbigailWarren, “Gettleman SharesAnecdotes, Offers Advice,”Cornell Chronicle, March 2,2015,http://www.news.cornell.edu/stories/2015/03/gettleman-shares-anecdotes-offers-advice.
“Iwantedtomakeitapartofmylife”:Gettleman,interview.
“who wants to work for aboring newspaper?”: MaxSchindler, “New York TimesReporter Jeffrey Gettleman ’94ChroniclesHisTimeinAfrica,”
![Page 1504: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1504.jpg)
Cornell Daily Sun, April 6,2011.
“I was pretty lostacademically”: Gettleman,interview.
“have a life philosophy”: PeteCarroll, head coach of theSeattle Seahawks, in aninterviewwith the author, June2,2015.
they have ever been donebefore: For more on Pete’sperspective, see Pete Carroll,Win Forever: Live, Work, andPlay Like a Champion (New
![Page 1505: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1505.jpg)
York:Penguin,2010).Someofthe quotations in this section,and later in the book, are frominterviews with the authorbetween2014and2015.Othersare from Pete’s book or publictalks.
“drive all my actions”: Carroll,WinForever,73.
“andfillingbinders”:Ibid.,78.goalsinahierarchy:Materialin
this chapter on the hierarchicalstructure of goals from AngelaDuckworthandJamesJ.Gross,“Self-control and Grit: Related
![Page 1506: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1506.jpg)
but Separable Determinants ofSuccess.”CurrentDirectionsinPsychological Science 23(2014): 319–25. On goalhierarchies more generally, seeArie W. Kruglanski et al., “ATheory of Goal Systems,” inAdvances in ExperimentalSocial Psychology 34 (2002):331–78. And, finally, for areview of goal-setting theory,see Edwin A. Locke and GaryP. Latham, “Building aPractically Useful Theory ofGoal Setting and TaskMotivation: A 35-Year
![Page 1507: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1507.jpg)
Odyssey,” AmericanPsychologist57(2002):705–17.
an “ultimate concern”: RobertA.Emmons,ThePsychologyofUltimate Concerns: Motivationand Spirituality in Personality(New York: Guildford Press,1999).
when he retired in 1987: IraBerkow, “Sports of the Times;Farewell, Sweet Pitcher,” NewYorkTimes,June23,1987.
“dayafterday,yearafteryear”:Pat Jordan, “Tom Terrific andHis Mystic Talent,” Sports
![Page 1508: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1508.jpg)
Illustrated, July 24, 1972,http://www.si.com/vault/1972/07/24/612578/tom-terrific-and-his-mystic-talent.
“then I eat cottage cheese”:Ibid.
“helpmebehappy”:Ibid.“positive fantasizing”: Gabriele
Oettingen,“FutureThoughtandBehaviour Change,” EuropeanReviewofSocialPsychology 23(2012): 1–63. For a terrificsummary, and practicalsuggestions,ongoalsettingandplanning, see GabrieleOettingen, Rethinking Positive
![Page 1509: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1509.jpg)
Thinking: Inside the NewScience of Motivation (NewYork:Penguin,2014).
reportedly gave his personalpilot: James Clear, “WarrenBuffett’s ‘Two List’ Strategy:How to Maximize Your Focusand Master Your Priorities,”Huffington Post, originallyposted October, 24, 2014,updated December 24, 2014,http://www.huffingtonpost.com/james-clear/warren-buffetts-two-list-strategy-how-to-maximize-your-focus-_b_6041584.html.
![Page 1510: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1510.jpg)
a more important end: Forinstance, in one study, youngadults wrote down their high-level, mid-level, and low-levelgoals;overthenexttwoweeks,they reported on dailyfrustrations.Peoplewhosegoalsdemonstratedamoreorganized,hierarchical structuresubsequently demonstratedgreater resilience in the face ofdaily frustrations. In particular,when confronted withfrustrating experiences, theymaintained a sense that theywereincontrolofattainingtheir
![Page 1511: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1511.jpg)
goals.Inarelatedstudy,amorehierarchical goal structurepredictedfeelinglessangerandannoyance in the face of dailyfrustrations over the next twoweeks. See Michael D.Robinson and SaraK.Moeller,“Frustrated, but Not Flustered:The Benefits of HierarchicalApproach Motivation toWeatheringDailyFrustrations,”Motivation and Emotion 38(2014):547–59.
“improvise, adapt, overcome”:Michael Martel, Improvise,Adapt, Overcome: Achieve the
![Page 1512: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1512.jpg)
Green Beret Way (Seattle:Amazon Digital Services, Inc.,2012).
“made mine wither”: RobertMankoff,HowAboutNever—IsNeverGood for You?:My LifeinCartoons (NewYork:HenryHoltandCompany,2014),34.
“I’ve written this book”: SydHoff, Learning to Cartoon(New York: StravonEducationalPress,1966),vii.
“How could anyone do morethan twenty-seven
![Page 1513: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1513.jpg)
cartoons?”: Mankoff, HowAboutNever,38.
“I’mthefunniestguyyouevermet”: Bob Mankoff, cartooneditorof theNewYorker, in aninterview with the author,February10,2015.
“I’mgoingtobeacartoonist”:Mankoff,interview.
“wallpaper my bathroom”:Mankoff,HowAboutNever,44.
“youtoowereoneofthebest”:Ibid.,46.
“Ilookedupallthecartoons”:Mankoff,interview.
![Page 1514: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1514.jpg)
“I had complete confidence”:Ibid.
“things never work out”:Mankoff, How About Never,114.
301 exceptionallyaccomplished: Cox, “EarlyMentalTraits.”
“Cox’s First Ten”: Ibid., 181.Presented here in alphabeticalorderbylastname.
“with somewhat lesspersistence”:Ibid.,187.
CHAPTER5:GRITGROWS
![Page 1515: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1515.jpg)
worth our attention:Psychologist Steve Heine hasdone research showing that ifyou think something is genetic,then you think it is “natural”and therefore the way things“should be.” For example, ifyou tell obese people thatobesityhasageneticbasis,theyreduce theirdietingefforts.SeeIlan Dar-Nimrod and Steven J.Heine, “Genetic Essentialism:On the Deceptive Determinismof DNA,” PsychologicalBulletin 137 (2011): 800–18.Perhaps peoplewould not have
![Page 1516: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1516.jpg)
suchaknee-jerkreactioniftheyunderstood better that theinterplaybetweengenesandtheenvironment is complex anddynamic. The interested readermight find the work of ElliotTucker-Drob on this topicespecially illuminating; forexample, see Daniel A. Brileyand Elliot M. Tucker-Drob,“Comparing theDevelopmentalGenetics of Cognition andPersonality Over the LifeSpan,” Journal of Personality(2015):1–14.
![Page 1517: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1517.jpg)
150yearsago:TimothyJ.Hattonand Bernice E. Bray, “LongRun Trends in the Heights ofEuropean Men, 19th–20thCenturies,” Economics andHumanBiology 8 (2010): 405–13.
averageisfivefeetteninches:Alison Moody, “AdultAnthropometric Measures,Overweight and Obesity,” inHealth Survey for England2013, ed. Rachel Craig andJennifer Mindell (London:Health and Social CareInformationCentre,2014).
![Page 1518: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1518.jpg)
gain of more than six inches:Hatton, “Long Run Trends.”YvonneSchonbeck et al., “TheWorld’s Tallest Nation HasStopped Growing Taller: TheHeight ofDutchChildren from1955 to 2009,” PediatricResearch73(2013):371–77.
honesty and generosity: SeeEric Turkheimer, ErikPettersson, and Erin E. Horn,“APhenotypicNullHypothesisfortheGeneticsofPersonality,”Annual Review of Psychology65(2014):515–40.
![Page 1519: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1519.jpg)
Ditto for IQ: Richard E. Nisbettet al., “Intelligence: NewFindings and TheoreticalDevelopments,” AmericanPsychologist67(2012):130–59.
enjoying the great outdoors:Niels G. Waller, David T.Lykken, and Auke Tellegen,“OccupationalInterests,LeisureTimeInterests,andPersonality:Three Domains or One?Findings from the MinnesotaTwin Registry.” In AssessingIndividual Differences inHuman Behavior: NewConcepts, Methods, and
![Page 1520: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1520.jpg)
Findings, ed. David JohnLubinski and René V. Dawis(Palo Alto, CA: Davies-BlackPublishing,1995):233–59.
havinga sweet tooth:FionaM.Breen,RobertPlomin,andJaneWardle, “Heritability of FoodPreferences in YoungChildren,” Physiology &Behavior88(2006):443–47.
endupachain-smoker:GaryE.Swan et al., “Smoking andAlcohol Consumption in AdultMale Twins: GeneticHeritability and Shared
![Page 1521: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1521.jpg)
Environmental Influences,”Journal of Substance Abuse 2(1990):39–50.
getting skin cancer: PaulLichtenstein et al.“Environmental and HeritableFactors in the Causation ofCancer—Analyses of Cohortsof Twins from Sweden,Denmark, and Finland,” NewEngland Journal of Medicine343(2000):78–85.
carry a tune: Elizabeth Theuschand Jane Gitschier, “AbsolutePitch Twin Study and
![Page 1522: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1522.jpg)
Segregation Analysis,” TwinResearch and Human Genetics14(2011):173–78.
dunkabasketball:LisaM.GuthandStephenM.Roth, “GeneticInfluence and AthleticPerformance,”Current Opinionin Pediatrics 25 (2013): 653–58.
solve a quadratic equation:BonamyOliver et al., “ATwinStudy of Teacher-ReportedMathematics Performance andLow Performance in 7-Year-Olds,” Journal of EducationalPsychology96(2004):504–17.
![Page 1523: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1523.jpg)
“I could only swimbreaststroke”: Chambliss,interview.
“I had horribly bad coaches”:Chambliss, interview. Thetremendous importance ofteacherqualitytotrajectoriesofacademic achievement isdocumented in Eric A.Hanushek, “Valuing Teachers:HowMuch Is a Good TeacherWorth?” Education Next 11(2011),40–45.
researchers in London:Personal communication withRobert Plomin, June 21, 2015.
![Page 1524: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1524.jpg)
For a review of heritability ofpersonality traits, seeTurkheimer, Pettersson, andHorn, “Phenotypic NullHypothesis.” It’s worth notingthat there are behavioralgeneticsstudiesthatdonotrelyon twins, and also thatheritability is a topic toocomplex to fully summarizehere. In particular, there areinteractions between differentgenes, between genes and theenvironment, and epigeneticeffects. Relatedly, there is anongoing debate as to the
![Page 1525: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1525.jpg)
proportion of environmentalinfluence that can be attributedto parenting. Definitivelyteasing apart the effects ofparenting from genetic heritageis difficult. Chiefly, this isbecause you can’t randomlyswap human children to livewithdifferentparents.However,youcandoexactlythatwithratpupsand theirmoms.Youcan,for example, randomly assignrat pups to grow up with verynurturing mothers or verynegligent ones. NeurobiologistMichael Meaney has done
![Page 1526: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1526.jpg)
exactly that, and he has foundthat nurturing rats—who lickandgroomandnursetheirpupsmore than average—raise pupswho are less stressed whendealing with challengingsituations. The effects last intoadulthood, and in fact, rat pupswhoareborn to low-lickmomsbut,withintwenty-fourhoursofbirth, are switched to be raisedbyhigh-lickmoms, growup tobe high-lick moms themselves.See Darlene Francis, JosieDiorio,DongLiu, andMichaelJ. Meaney, “Nongenomic
![Page 1527: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1527.jpg)
Transmission AcrossGenerations of MaternalBehavior and Stress ResponsesintheRat,”Science286(1999):1155–58.
traitsarepolygenic:ChristopherF. Chabris et al., “The FourthLaw of Behavioral Genetics,”Current Directions inPsychological Science 24(2015):304–12.
at least 697 different genes:Andrew R. Wood et al.,“DefiningtheRoleofCommonVariation in the Genomic andBiologicalArchitectureofAdult
![Page 1528: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1528.jpg)
Human Height,” NatureGenetics46(2014):1173–86.
as many as twenty-fivethousanddifferentgenes:“ABrief Guide to Genomics,”National Human GenomeResearchInstitute,lastmodifiedAugust 27, 2015,http://www.genome.gov/18016863
Wechsler Adult IntelligenceScale: The Wechsler tests arenow published by Pearson’sClinicalAssessment.
in the last fifty years:Informationon theFlynneffect
![Page 1529: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1529.jpg)
comes from personalcommunications with JamesFlynn from 2006 to 2015. Formore information on the Flynneffect, see JamesR.Flynn,AreWeGettingSmarter?:RisingIQin the Twenty-First Century(Cambridge, UK: CambridgeUniversityPress,2012).SeealsoJakob Pietschnig and MartinVoracek, “One Century ofGlobal IQ Gains: A FormalMeta-Analysis of the FlynnEffect (1909–2013),”Perspectives on PsychologicalScience 10 (2015):282–306. In
![Page 1530: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1530.jpg)
thisanalysisof271independentsamples, totaling almost fourmillion people from thirty-onecountries, a few key findingsemerged: IQ gains areubiquitousandpositiveoverthepast century; gains have variedin magnitude by domain ofintelligence; gains have beenless dramatic in recent years;and, finally, candidate causesinclude, in addition to socialmultiplier effects, changes ineducation, nutrition, hygiene,medical care, and test-takingsophistication.
![Page 1531: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1531.jpg)
the social multiplier effect:William T. Dickens and JamesR. Flynn, “HeritabilityEstimates Versus LargeEnvironmental Effects: The IQParadox Resolved,”Psychological Review 108(2001):346–69.
Grit and age: These data areoriginally reported inDuckworthetal.,“Grit,”1092.
moreconscientious,confident,caring, and calm: AvshalomCaspi, Brent W. Roberts, andRebeccaL.Shiner,“Personality
![Page 1532: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1532.jpg)
Development: Stability andChange,” Annual Review ofPsychology56(2005):453–84.
“the maturity principle”: Ibid.,468.
“doesn’t come overnight”:Shaywitz, OvercomingDyslexia,347.
“you’re late, you’re fired”:Bernie Noe, head of school,Lakeside School, Seattle, in aninterview with the author, July29,2015.
interest without purpose: KenM. Sheldon, “Becoming
![Page 1533: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1533.jpg)
Oneself: The Central Role ofSelf-Concordant GoalSelection,” Personality andSocial Psychology Review 18(2014): 349–65. Seepsychologist Ken Sheldon’swork on enjoyment andimportance as the twocomponents of what he callsautonomously motivated goals.Ken points out that all of ushave responsibilities we mustfulfill out of obligation ornecessity. But no matter howmuch we think we care aboutexternallymotivatedgoals,their
![Page 1534: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1534.jpg)
accomplishment rarely fulfillsus in the way that interestingand purposeful goals do. A lotof the people in Ken’s studiesare highly educated and verycomfortably upper-middle-classyet sorely lacking inautonomously motivated goals.They tell Ken they feel likethey’re in the passenger seat oftheir own lives. By followingthese individuals over time,Ken’s learned that they’re lesslikelytoaccomplishtheirgoals;even when they do achievethem, they derive less
![Page 1535: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1535.jpg)
satisfaction from having doneso. Recently, I collected datafrom hundreds of adults, agestwenty-five to seventy-five andfound that Ken’s measure ofautonomous motivationcorrelatespositivelywithgrit.
CHAPTER6:INTEREST“follow your passion”: Indiana
University,“WillShortz’s2008Commencement Address,”CSPAN, http://www.c-span.org/video/?205168-
![Page 1536: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1536.jpg)
1/indiana-university-commencement-address.
“to follow my passion”:Princeton University, “JeffBezos’ 2010 BaccalaureateRemarks,” TED,https://www.ted.com/talks/jeff_bezos_gifts_vs_choices
“won’tbeabletostickwithit”:Taylor Soper, “Advice fromAmazonFounderJeffBezos:BeProud of Your Choices, NotYourGifts,”GeekWire,October13, 2013,http://www.geekwire.com/2013/advice-amazon-founder-jeff-bezos-proud-choices-gifts.
![Page 1537: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1537.jpg)
asksthesamequestions:HesterLacey, “The Inventory,”published weekly in theFinancialTimes.
“IlovewhatIdo”:HesterLacey,journalist for the FinancialTimes, in an interviewwith theauthor,June2,2015.
fits their personal interests:Mark Allen Morris, “A Meta-Analytic Investigation ofVocational Interest-Based JobFit, and Its Relationship to JobSatisfaction, Performance, and
![Page 1538: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1538.jpg)
Turnover” (PhD dissertation,UniversityofHouston,2003).
happier with their lives: RongSu, Louis Tay, and Qi Zhang,“Interest Fit and LifeSatisfaction: A Cross-CulturalStudy in Ten Countries”(manuscriptinpreparation).”
perform better: Christopher D.Nye, Rong Su, James Rounds,andFritzDrasgow,“VocationalInterests and Performance: AQuantitative Summary of over60 Years of Research,”
![Page 1539: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1539.jpg)
Perspectives on PsychologicalScience7(2012),384–403.
very real constraints: See CalNewport, So Good They Can’tIgnore You: Why Skills TrumpPassion in the Quest for WorkYouLove (NewYork:HachetteBookGroup, 2012). Cal pointsout that getting very good atsomethingandthereforemakingyourselfvaluabletoothersoftenprecedes identifying what youdoasyourpassion.
“strength of [our] interest”:William James, Talks toTeachersonPsychology;andto
![Page 1540: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1540.jpg)
Students on Some of Life’sIdeals (New York: Henry HoltandCompany,1916),114.
“engaged”atwork:Gallup,Stateof the Global Workplace:Employee Engagement InsightsforBusinessLeadersWorldwide(Washington, DC:Gallup, Inc.,2013).
food could be this good: Julie& Julia, dir. Nora Ephron,ColumbiaPictures,2009.
“I was hooked, and for life”:MarilynMellowes,“AboutJuliaChild,” PBS, June 15, 2005,
![Page 1541: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1541.jpg)
http://www.pbs.org/wnet/americanmasters/julia-child-about-julia-child/555.
“I could really fall in lovewith”:RowdyGaines,Olympicgold medalist swimmer, in aninterviewwith the author, June15,2015.
“I’m glad I went this way”:Marc Vetri, chef, in aninterview with the author,February2,2015.
writing a cookbook forAmericans: Julia Child withAlex Prud’homme,My Life in
![Page 1542: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1542.jpg)
France (New York: Alfred A.Knopf,2006).
“zero interest in the stove”:Ibid.,3.
“to find my true passion”:Mellowes,“AboutJuliaChild.”
“No Career Direction”:“FleetingInterestinEverything,No Career Direction,” Reddit,accessed June 17, 2015,https://www.reddit.com/r/jobs/comments/1asw10/fleeting_interest_in_everything_no_career
“They’re holding out forperfection”: Barry Schwartz,DorwinCartwrightProfessorofSocialTheoryandSocialActionat Swarthmore College, in an
![Page 1543: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1543.jpg)
interview with the author,January27,2015.
aroundmiddleschool: DouglasK.S.Low,MijungYoon,BrentW.Roberts,andJamesRounds.“The Stability of VocationalInterests from EarlyAdolescence to MiddleAdulthood: A QuantitativeReview of LongitudinalStudies.”PsychologicalBulletin131(2005):713–37.
withtheoutsideworld:Muchofthecontentinthischapteronthedevelopment of interests comes
![Page 1544: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1544.jpg)
from an interview between theauthor and Ann Renninger,Eugene M. Lang Professor ofEducational Studies atSwarthmore College, on July13, 2015. For an in-depthreview, the interested reader isreferred to K. Ann RenningerandSuzanneHidi,ThePowerofInterest for Motivation andEngagement (London:Routledge,2015).
“to force an interest”: RobWalker, “25 Entrepreneurs WeLove: Jeff Bezos,
![Page 1545: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1545.jpg)
Amazon.com,” Inc. magazine,April2004,150.
“one piece of information ledto another”: Mike Hopkins,NASAastronaut andcolonel inthe U.S. Air Force, in aninterviewwith the author,May12,2015.
“I started wanting to makethat”:Vetri,interview.
“I’ll always need you”: MarcVetri, Il Viaggio Di Vetri: ACulinary Journey (New York:TenSpeedPress,2008),ix.
![Page 1546: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1546.jpg)
“at the things they love”: AmyChua,BattleHymnof theTigerMother (New York: Penguin,2011),213.
120 people who achieved:Benjamin Bloom, DevelopingTalent in Young People (NewYork:Ballantine,1985).
“the early years”: Ibid. I wouldliketopointoutherethatwhileinterest typically precedes theeffortful practice we willdiscuss in the next chapter, it’salso been shown that investingeffort into an endeavor can
![Page 1547: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1547.jpg)
reciprocally increase passion.See Michael M. Gielnik et al.,“ ‘I Put in Effort, Therefore IAm Passionate’: InvestigatingthePath fromEffort toPassionin Entrepreneurship,” Academyof Management Journal 58(2015):1012–31.
Encouragement during theearly years: For related work,see Stacey R. Finkelstein andAyelet Fishbach, “Tell MeWhat I Did Wrong: ExpertsSeek and Respond to NegativeFeedback,” Journal of
![Page 1548: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1548.jpg)
Consumer Research 39 (2012):22–38.
“perhaps the major quality”:Bloom,DevelopingTalent,514.
erode intrinsic motivation:Robert Vallerand, NathalieHoulfort, and Jacques Forest,“Passion for Work:Determinants and Outcomes,”in The Oxford Handbook ofWork Engagement, Motivation,and Self-Determination Theory,ed. Marylène Gagné (Oxford,UK: Oxford University Press,2014),85–105.
![Page 1549: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1549.jpg)
injuredphysicallyand toburnout: Jean Côté, Professor ofPsychology at Queen’sUniversity,inaninterviewwiththe author, July 24, 2015. Seealso, Jean Côté, Karl Erickson,andBruceAbernethy,“PlayandPractice During Childhood,” inConditionsofChildren’sTalentDevelopment in Sport, ed. JeanCôté and Ronnie Lidor(Morgantown, WV: FitnessInformationTechnology,2013),9–20. Côté, Baker, andAbernethy, “Practice and Playin the Development of Sport
![Page 1550: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1550.jpg)
Exercise,”inHandbookofSportPsychology, ed. GershonTenenbaum and Robert C.Eklund (Hoboken, NJ: JohnWiley&Sons,2007),184–202.
different motivational needs:Robert J. Vallerand, ThePsychology of Passion: ADualistic Model (Oxford, UK:OxfordUniversityPress,2015).Vallerand has found thatpassion leads to deliberatepractice, and that autonomysupport from teachers andparentsleadstopassion.
![Page 1551: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1551.jpg)
“I just wanted to make myown”: Will Shortz, crosswordpuzzle editor for theNewYorkTimes, in an interviewwith theauthor,February28,2015.
“my first crossword”: ElisabethAndrews, “20 Questions forWillShortz,”BloomMagazine,December 2007/January 2008,58.
“Isoldmyfirstpuzzle”:Shortz,interview.
“what I was supposed to do”:Jackie Bezos, in an interviewwiththeauthor,August6,2015.
![Page 1552: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1552.jpg)
Jackie also told me that Jeff’searly love of space has neverwaned. His high schoolvaledictory speech was aboutcolonizingspace.Decadeslater,he created Blue Origin toestablish a permanent presenceinspace:www.blueorigin.com.
“because they’re so diverse”:Shortz,interview.
“callthemshort-termers”: JaneGolden, founder and executivedirector of the Mural ArtsProgram, in an interview withtheauthor,June5,2015.
![Page 1553: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1553.jpg)
“it’s a basic drive”: Paul Silvia,associate professor ofpsychologyat theUniversityofNorth Carolina at Greensboro,inaninterviewwith theauthor,July22,2015.
enduring interests: Paul J.Silvia, “Interest—the CuriousEmotion,”CurrentDirectionsinPsychological Science 17(2008):57–60.
“how eager to learn”: Seewww.templeton.org.
“they’re not sure what it’s allabout”:Silvia,interview.
![Page 1554: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1554.jpg)
“How to Solve the New YorkTimes Crossword Puzzle”:WillShortz,“HowtoSolve theNew York Times CrosswordPuzzle,” New York TimesMagazine,April8,2001.
“with a slightly new turn”:James,TalkstoTeachers,108.
CHAPTER7:PRACTICEgrittier kids at the National
Spelling Bee: Duckworth etal.,“Grit.”
“bebetterthanthelast”:Lacey,interview.
![Page 1555: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1555.jpg)
worldexpertonworldexperts:Anders Ericsson and RobertPool, Peak: Secrets from theNewScienceofExpertise (NewYork: Houghton MifflinHarcourt, 2016). See also, K.Anders Ericsson, “TheInfluence of Experience andDeliberate Practice on theDevelopment of SuperiorExpert Performance,” in TheCambridge Handbook ofExpertise and ExpertPerformance, ed. K. AndersEricssonetal.(Cambridge,UK:Cambridge University Press,
![Page 1556: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1556.jpg)
2006).K.AndersEricsson,RalfTh. Krampe, and ClemensTesch-Römer, “The Role ofDeliberate Practice in theAcquisition of ExpertPerformance,” PsychologicalReview100(1993):363–406.
their rate of improvementslows: SeeK.AndersEricssonand PaulWard, “Capturing theNaturally Occurring SuperiorPerformance of Experts in theLaboratory,”CurrentDirectionsin Psychological Science 16(2007): 346–50. See alsoAllenNewell and Paul S.
![Page 1557: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1557.jpg)
Rosenbloom, “Mechanisms ofSkill Acquisition and the LawofPractice,” inCognitiveSkillsandTheirAcquisition, ed. JohnR. Anderson (Hillsdale, NJ:Lawrence Erlbaum Associates,1981), 1–56. Grit paragons tellme, in so many words, that ifyou had a magnifying glass,you’d see that learning curvesare not smooth at all. Instead,there are “mini” plateaus—getting stuck on a problem forhours, days, weeks or evenlonger, and then suddenly abreakthrough. Ninety-six-year-
![Page 1558: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1558.jpg)
oldMacArthurFellowandpoetIrvingFeldmanputittomethisway: “Learning isn’t an evenlyrisingslope,butaseriesofleapsfromplateautoplateau.”
ten thousand hours ofpractice: Ericsson et al., “TheRoleofDeliberatePractice.”
“make a mature dancer”:Martha Graham, “I Am aDancer,” on Edward R.Murrow’sThis I Believe, CBS,circa 1953. Republished onNPR, “An Athlete of God,”January 4, 2006,
![Page 1559: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1559.jpg)
http://www.npr.org/templates/story/story.php?storyId=5065006.
“seasoned press dispatcher”:BryanLoweWilliamandNobleHarter, “Studies on theTelegraphic Language: TheAcquisition of a Hierarchy ofHabits,” Psychological Review6 (1899): 358. Also relevant isJohn R. Hayes, “CognitiveProcesses in Creativity,” inHandbook of Creativity, ed.John A. Glover, Royce R.Ronning,andCecilR.Reynolds(New York: Springer, 1989),135–45.
![Page 1560: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1560.jpg)
is just a roughaverage: SeeK.Anders Ericsson, “The Dangerof Delegating Education toJournalists: Why the APSObserver Needs Peer ReviewWhen Summarizing NewScientific Developments”(unpublishedmanuscript,2012),https://psy.fsu.edu/faculty/ericsson/ericsson.hp.html
“not doing deliberate practice”:K. Anders Ericsson, professorof psychology at Florida StateUniversity,inconversationwiththeauthor,December2005.
![Page 1561: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1561.jpg)
intentionally seek outchallenges: Ericsson et al.,“The Role of DeliberatePractice.”
“I’d try tohold1: 14”: Gaines,interview.
“that needs problem solving”:Roberto Díaz, president andCEO of the Curtis Institute ofMusic, inan interviewwith theauthor,October7,2015.
“every single piece of mygame”: An additional 15percent of his time, he says, isfor playing pick-up, either one-
![Page 1562: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1562.jpg)
on-oneorthree-on-three,sothatthe microrefinements he hasworked on can be integratedintoteamplay.And,finally,thelast 15 percent is for organizedgames. “Kevin Durant,” TheFilmRoomProject.
“there we were, stuck”: UlrikJuul Christensen, executivechairman of Area9 and seniorfellow at McGraw-HillEducation, in an interviewwiththeauthor,July15,2015.
first studied in chess players:Herbert A. Simon andWilliamG. Chase, “Skill in Chess:
![Page 1563: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1563.jpg)
Experiments with Chess-Playing Tasks and ComputerSimulation of SkilledPerformance Throw Light onSome Human Perceptual andMemory Processes,” AmericanScientist 61 (1973): 394–403.See also: Ericsson et al., “TheRoleofDeliberatePractice.”
“and corrected them”: TheAutobiography of BenjaminFranklin: With an Introductionand Notes (New York:MacMillan Company, 1921),14.
![Page 1564: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1564.jpg)
“no gains without pains”:Benjamin Franklin, “The Wayto Wealth,” in Memoirs ofBenjaminFranklin (NewYork:Harper&Brothers,1839),7.
“asmallnumberofpractices”:Peter F. Drucker,The EffectiveExecutive:TheDefinitiveGuideto Getting the Right ThingsDone (New York:HarperCollins,2006),ix.
“for years on end”: AtulGawande, “The LearningCurve: Like Everyone Else,SurgeonsNeedPractice. That’s
![Page 1565: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1565.jpg)
Where You Come In,” NewYorker,January28,2002.
“that’s what magic is to me”:DavidBlaine,“HowIHeldMyBreath for 17 Minutes,” TEDvideo, filmed October 2009,http://www.ted.com/talks/david_blaine_how_i_held_my_breath_for_17_minSeealsoRoyF.BaumeisterandJohn Tierney, Willpower:Rediscovering the GreatestHuman Strenth (New York:Penguin,2011).
pored through publishedbooks:BarrieTrinkle,CarolynAndrews, and Paige Kimble,How to Spell Like a Champ:
![Page 1566: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1566.jpg)
Roots, Lists, Rules, Games,Tricks, and Bee-Winning Tipsfrom the Pros (New York:WorkmanPublishingCompany,2006)
“studying as hard as I can”:JamesMaguire,American Bee:The National Spelling Bee andthe Culture of Word Nerds(Emmaus, PA: Rodale, 2006),360.
deliberate practice predicted:Angela Duckworth et al.,“Deliberate Practice SpellsSuccess: Why GrittierCompetitors Triumph at the
![Page 1567: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1567.jpg)
National Spelling Bee,” SocialPsychological and PersonalityScience 2 (2011): 174–81.Getting quizzed also predicteddoing well in competition, butwhen comparing kids who gotquizzed the same amount oftime to eachother, I found thatthose who did more deliberatepractice did better. In contrast,when comparing kids who didthe same amount of deliberatepractice to each other, I foundthatmorequizzingproducednoadvantage.
![Page 1568: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1568.jpg)
benefits to being quizzed:Henry L. Roediger and JeffreyD. Karpicke, “The Power ofTesting Memory: BasicResearch and Implications forEducational Practice,”Perspectives on PsychologicalScience1(2006):181–210.
tenhoursperweek:Duckworthetal.,“SpellsSuccess,”177.
come to a differentconclusion: On theeffortfulness of learning, seealso Elizabeth L. Bjork andRobert Bjork, “Making Things
![Page 1569: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1569.jpg)
HardonYourself,butinaGoodWay: Creating DesirableDifficulties to EnhanceLearning,” in Psychology andthe Real World: EssaysIllustrating FundamentalContributions to Society, ed.Morton A. Gernsbacher et al.(New York: Worth Publishers,2011), 56–64. See also SidneyK. D’Mello and Arthur C.Graesser, “Confusion” inInternational Handbook ofEmotions in Education, ed.Reinhard Pekrun and Lisa
![Page 1570: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1570.jpg)
Linnenbrink-Garcia(NewYork:Routledge,2014),289–310.
experienced as supremelyeffortful: Ericsson et al., “TheRoleofDeliberatePractice.”
“dailysmalldeaths”:Graham,“IAmaDancer.”
“you’re concentrating andyou’re exhausted”: JuddApatow,interviewedbyCharlieRose, Charlie Rose, July 31,2009, republished in Apatow,SickintheHead:ConversationsAbout Life and Comedy (New
![Page 1571: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1571.jpg)
York: Random House, 2015),26.
to keep doing it: K. AndersEricsson, “How Experts Attainand Maintain SuperiorPerformance: Implications forthe Enhancement of SkilledPerformance in OlderIndividuals,” Journal of AgingandPhysical Activity 8 (2000):366–72.
“a feeling of spontaneity”:Karen Stansberry Beard,“Theoretically Speaking: AnInterview with MihalyCsikszentmihalyi on Flow
![Page 1572: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1572.jpg)
Theory Development and ItsUsefulness in AddressingContemporary Challenges inEducation,” EducationalPsychology Review 27 (2015):358. Csikszentmihalyi hasemphasizedthatwhatmatterstothe quality of our momentaryexperience is the subjectivelevel of challenge and thesubjectivelevelofskill.
“just flows out by itself”:MihalyCsikszentmihalyi, “PlayandIntrinsicRewards,”Journalof Humanistic Psychology 15(1975):50.
![Page 1573: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1573.jpg)
“automatically withoutthinking”: MihalyCsikszentmihalyi, “Flow: TheJoy of Reading,” inApplicationsofFlow inHumanDevelopment: The CollectedWorks of MihalyCsikszentmihalyi (Dordrecht,Netherlands: Springer, 2014),233.
“incompatible with deliberatepractice”: K. Anders Ericssonand PaulWard, “Capturing theNaturally Occurring SuperiorPerformance of Experts in the
![Page 1574: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1574.jpg)
Laboratory,”CurrentDirectionsin Psychological Science 16(2007):349.
“by no means self-evident”:Csikszentmihalyi, ApplicationsofFlow,xx.
“butitsfruitsaresweet”:Ibid.“achievewhatyoudesire”:Ibid.“passion and world-class
performance”: MihalyCsikszentmihalyiandK.AndersEricsson, “Passion and World-Class Performance”(presentation, University of
![Page 1575: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1575.jpg)
Pennsylvania,Philadelphia,PA,August2006).
flowandgrit: In thisstudy, flowwas measured using apreviously validated six-itemquestionnaire whose possiblescores ranged from aminimumof 1 and a maximum of 5.Example item: “Whether atworkorplay,Iamusually‘inazone’ and not conscious ofmyself.” SeeKatherineR.VonCulin, Eli Tsukayama, andAngela L. Duckworth,“Unpacking Grit: MotivationalCorrelates of Perseverance and
![Page 1576: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1576.jpg)
Passion for Long-term Goals,”Journal of Positive Psychology9(2014):1–7.
“I swam around the world”:Gaines,interview.
![Page 1577: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1577.jpg)
“It’s about hard work”: MadsRasmussen, Danish rower andOlympic gold medalist, in aninterviewwith the author, June28,2015.
“testament to the work”: RodGilmour,“LedeckyBettersOwn1500m Freestyle WorldRecord,” Reuters, August 3,2015,http://in.reuters.com/article/2015/08/03/swimming-world-1500m-idINKCN0Q813Y20150803.
“showsoffinthemeet”:AshleyBranca, “Katie Ledecky: ‘I’ve
![Page 1578: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1578.jpg)
JustAlwaysFeltComfortableinthe Water from Day One,’ ”Guardian,March10,2015.
said they enjoyed it more:Duckworth et al., “SpellsSuccess.”
“she has that attitude”: BruceGemmell, USA National Teamswimming coach, in aninterview with the author,August24,2015.
“and getting it done”: KerryClose, 2006 Scripps NationalSpelling Bee champion, in an
![Page 1579: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1579.jpg)
interview with the author,August10,2015.
basic requirements ofdeliberate practice: K.Anders Ericsson, “TheInfluence of Experience andDeliberate Practice on theDevelopment of SuperiorExpert Performance,” inCambridge Handbook ofExpertise and ExpertPerformance ed. K. AndersEricssonetal.(Cambridge,UK:Cambridge University Press),685–706. For a fascinatingstudy of the importance of
![Page 1580: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1580.jpg)
practicing “strategically,” seeRobert Duke, Amy Simmons,andCarlaDavisCash,“It’sNotHow Much; It’s How:Characteristics of PracticeBehavior and Retention ofPerformanceSkills,”JournalofResearchinMusicEducation56(2009):31021.
it’s not hours of brute-force:Rasmussen,interview.
until he was twenty-two: NoaKageyama, performancepsychologist at The JulliardSchool,inaninterviewwiththeauthor,September21,2015.
![Page 1581: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1581.jpg)
challenging,effortfulpractice:Lauren Eskreis-Winkler et al.,“Using Wise Interventions toMotivate Deliberate Practice,”Journal of Personality andSocialPsychology(inpress).
You just do: Judith A. Ouelletteand Wendy Wood, “Habit andIntentioninEverydayLife:TheMultiple Processes by WhichPast Behavior Predicts FutureBehavior,” PsychologicalBulletin124(1998):54–74.Seealso, Charles Duhigg, ThePower of Habit: Why We DoWhat We Do in Life and
![Page 1582: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1582.jpg)
Business (New York: RandomHouse,2012).
rose at dawn: Mason Currey,DailyRituals:HowArtistsWork(New York: Alfred A. Knopf,2013),217–18.
a“tinymean”hotelroom:Ibid.,122.
“beginning of every bit ofwork”: William James, “TheLaws of Habits,” The PopularScience Monthly 30 (1887):447.
“with your nose”: RobertCompton, “Joyce Carol Oates
![Page 1583: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1583.jpg)
Keeps Punching,” DallasMorning News, November 17,1987.
“feel great while you’re doingit”:TerryLaughlin,headcoachand chief executive optimist(notkidding,that’shisrealtitle)ofTotal ImmersionSwimming,inan interviewwith theauthor,July24,2015.
toddlers don’t mind at all:Elena Bodrova and DeborahLeong, creators of theTools ofthe Mind curriculum for earlychildhood education, in aninterview with the author, July
![Page 1584: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1584.jpg)
15, 2015. See also AdeleDiamond and Kathleen Lee,“Interventions Shown to AidExecutive FunctionDevelopment in Children 4 to12 Years Old,” Science 333(2011): 959–64. Clancy Blairand C. Cybele Raver, “Closingthe Achievement Gap ThroughModificationofNeurocognitiveand Neuroendocrine Function,”PLoSONE9(2014):1–13.
“give their best effort”:Gemmell,interview.
![Page 1585: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1585.jpg)
CHAPTER8:PURPOSE“have a lemonade stand”:
Alex’s Lemonade Stand,http://www.alexslemonade.org.
this three-phase progression:Bloom,DevelopingTalent.
“the larger purpose andmeaning”: Bloom,DevelopingTalent,527.
“new perspective on life”:Golden,interview.
Election Day never comes:Melissa Dribben, “Gracing theCity Jane Golden Has MadeMural Arts the Nation’s Top
![Page 1586: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1586.jpg)
Public Arts Program,”Philadelphia Inquirer, July 27,2008,http://articles.philly.com/2008-07-27/news/25245217_1_jane-seymour-golden-globes-philadelphia-s-mural-arts-program.
“so I find ways to getenergized”:Ibid.
“it’s a moral imperative”:Golden,interview.
“beautiful bottle of wine”:AntonioGalloni,winecriticandfounder of Vinous, in an
![Page 1587: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1587.jpg)
interview with the author, July24,2015
“a million lightbulbs”: “Liv-ExInterviewwithAntonioGalloni,Part One,” Liv-Ex Blog,December 13, 2013,www.blog.liv-ex.com/2013/12/liv-ex-interview-with-antonio-galloni-part-one.html.
“sense of purpose”: Galloni,interview.
purpose, pleasure, and age:These data are originallyreported in Von Culin,
![Page 1588: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1588.jpg)
Tsukayama, and Duckworth,“UnpackingGrit.”
well-being of others: Differentscholars use the word purposeinslightlydifferentways.Oftenit is emphasized that a goal, tobe purposeful, has to bemeaningful to the self and, atthe same time, beneficial toothers. Here I emphasize thebeyond-the-self aspect ofpurpose because we alreadycovered the more self-orientedmotivationofinterestinthelastchapter.
![Page 1589: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1589.jpg)
the eudaimonic life: Aristotle,TheNicomacheanEthics, trans.David Ross (Oxford, UK:OxfordUniversityPress,2009),5.
“pleasure principle”: SigmundFreud,“FormulationsRegardingthe Two Principles in MentalFunctioning,” in The StandardEdition of the CompletePsychological Works ofSigmund Freud, vol. 12, trans.JamesStracheyandAnnaFreud(London:HogarthPress,1958),218–26.
![Page 1590: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1590.jpg)
evolved to seek meaning: SeeJohn T. Cacioppo andWilliamPatrick, Loneliness: HumanNatureand theNeed forSocialConnection (New York: W.W.Norton&Company,2008).Seealso Roy F. Baumeister andMark R. Leary, “The Need toBelong:DesireforInterpersonalAttachments as a FundamentalHuman Motivation,”Psychological Bulletin 117(1995): 497–529. Finally, seeEdward L. Deci with RichardFlaste, Why We Do What WeDo: Understanding Self-
![Page 1591: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1591.jpg)
Motivation (New York:Penguin,1995).Notethatrecentprimate studies show thatlongevity and reproductivesuccessdependontheabilitytoform strong, enduring socialbondswithothers.Thedesiretoconnect is as basic a human—even mammalian—need as theneed for pleasure. See RobertM. Seyfarth and Dorothy L.Cheney, “The EvolutionaryOrigins of Friendship,” AnnualReview of Psychology 63(2012):153–77.
![Page 1592: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1592.jpg)
than we care about pleasure:Richard M. Ryan and EdwardL. Deci, “On Happiness andHuman Potential: A Review ofResearch on Hedonic andEudaimonic Well-Being,”Annual Review of Psychology52(2001):141–66.
whichofthethreebricklayers:Amy Wrzesniewski, ClarkMcCauley, Paul Rozin, andBarrySchwartz,“Jobs,Careers,andCallings:People’sRelationsto Their Work,” Journal ofResearch in Personality 31(1997):25.
![Page 1593: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1593.jpg)
theiroccupationsacalling:Wecollectedthisdatain2015.
than those with a job:Wrzesniewski et al., “Jobs,Careers,andCallings,”25.
survey of 982 zookeepers: J.StuartBundersonandJefferyA.Thompson, “The Call of theWild:Zookeepers,Callings,andthe Double-Edged Sword ofDeeply Meaningful Work,”Administrative ScienceQuarterly54(2009):32–57.
“Monday through Friday sortof dying”: Studs Terkel,
![Page 1594: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1594.jpg)
Working: People Talk AboutWhatTheyDoAllDayandHowTheyFeelAboutWhatTheyDo(New York: Pantheon Books,1974), xi. Note that the namesoftheworkersinTerkel’sbookwerepseudonyms.
“Idon’tthinkIhaveacalling”:Ibid.,521–24.
“find a savor in their dailyjob”:Ibid.,xi.
“It’s meaningful to society”:Ibid.,103–6.
when she studied secretaries:Wrzesniewski et al., “Jobs,Careers,andCallings.”
![Page 1595: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1595.jpg)
“waiting to be discovered”:Amy Wrzesniewski, professorof organizational behavior atYaleSchoolofManagement,inan interview with the author,January27,2015.
all the way to Chicago:Metropolitan Transit Authority,“Facts and Figures,” accessedMarch 10, 2015,http://web.mta.info/nyct/facts/ffsubway.htm
“and I got hired”: Joe Leader,senior vice president at NewYork City Transit, in aninterview with the author,February26,2015.
![Page 1596: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1596.jpg)
“experience I’ve ever had”:Michael Baime, clinicalassociate professor ofmedicineat the University ofPennsylvaniaanddirectorofthePennProgram forMindfulness,inan interviewwith theauthor,January21,2015.
having fun at the same time:The next year, we doubled insize and, to better support ourstudents, developed an after-schoolenrichmentprogram.Thefollowing year, the programwon the Better GovernmentAward for the state of
![Page 1597: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1597.jpg)
Massachusetts. Around thesame time, professors at theHarvard Kennedy School ofGovernmentwrote up the storyofSummerbridgeCambridgeasa case study in socialentrepreneurship.
hundreds of students everyyear: Formore information onBreakthrough Greater Boston,seewww.breakthroughgreaterboston.org
“you can have both”: AdamGrant, Class of 1965 WhartonProfessorofManagement,inan
![Page 1598: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1598.jpg)
interview with the author, July15,2015.
prosocial interests inminddobetter: AdamGrant,Give andTake: Why Helping OthersDrivesOurSuccess(NewYork:Penguin,2014).
interest in the work itself:Adam Grant, “Does IntrinsicMotivation Fuel the ProsocialFire? Motivational Synergy inPredicting Persistence,Performance,andProductivity,”Journal of Applied Psychology93(2008):48–58.
![Page 1599: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1599.jpg)
raisedmoremoney:Ibid.about a hundred adolescents:
DavidS.YeagerandMatthewJ.Bundick, “The Role ofPurposeful Work Goals inPromotingMeaninginLifeandin Schoolwork DuringAdolescence,” Journal ofAdolescentResearch24(2009):423–52. Relatedly, it’s beenshownthataffirmingvaluescanboost performance for otherreasons, particularly bymaintainingasenseofpersonaladequacy. Geoffrey L. Cohenand David K. Sherman, “The
![Page 1600: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1600.jpg)
Psychology of Change: Self-Affirmation and SocialPsychological Intervention,”Annual Review of Psychology65(2014):333–71.
“didn’t give in to obstacles”:Aurora and Franco Fonte, wifeand husband founders anddirectors of Assetlink, in aninterview with the author,March13,2015.
“something you’re interestedin”: Bill Damon, professor ofpsychology at StanfordGraduate School of Education,
![Page 1601: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1601.jpg)
inan interviewwith theauthor,July20,2015.
personal loss or adversity: Forexample, detectives who havethemselvesbeenthevictimofacrime are grittier and, in turn,moreengagedintheirwork.SeeLauren Eskreis-Winkler,Elizabeth P. Shulman, andAngela L. Duckworth,“Survivor Mission: Do ThoseWho Survive Have a Drive toThrive at Work?” Journal ofPositive Psychology 9 (2014):209–18.
![Page 1602: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1602.jpg)
“became family to her”: KatCole,presidentofCinnabon, inan interview with the author,February1,2015.
exceeded one billion dollars:CharlotteAlter,“HowtoRunaBillion Dollar Brand BeforeYou’re35,”Time,December2,2014.
“Mypassionistohelppeople”:Jo Barsh, in an interview withtheauthor,July31,2015.
“liketheyarethatperson”:KatCole,“SeeWhat’sPossible,andHelp Others Do the Same,”
![Page 1603: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1603.jpg)
from Kat Cole’s blog, TheDifference, August 7, 2013,http://www.katcole.net/2013/08/see-whats-possible-and-help-others-do.html.
“be a better place?”: David S.Yeager et al., “Boring butImportant:A Self-TranscendentPurpose for Learning FostersAcademic Self-Regulation,”Attitudes and Social Cognition107(2014):559–80.
calls this idea job crafting:AmyWrzesniewskiandJaneE.Dutton, “Crafting a Job:
![Page 1604: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1604.jpg)
Revisioning Employees asActiveCraftersofTheirWork,”Academy of ManagementReview26(2001):179–201.Seealso www.jobcrafting.org andGrant,Give and Take, 262–63.This section also reflectspersonal correspondencebetween the author and AmyWrzesniewski, professor oforganizational behavior at YaleSchoolofManagement,October20,2015.
“beabetterperson”: Interestedreaders can find a morecomplete list of questions that
![Page 1605: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1605.jpg)
Bill Damon uses in his book,The Path to Purpose: HowYoung People Find TheirCallinginLife(NewYork:FreePress,2008),183–86.
CHAPTER9:HOPEgetting up again: For a more
expansive discussion of howhopecanbeconceptualized,seeKevin L. Rand, Allison D.Martin, and Amanda M. Shea,“Hope, but Not Optimism,PredictsAcademicPerformanceof Law Students Beyond
![Page 1606: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1606.jpg)
Previous AcademicAchievement,” Journal ofResearch in Personality 45(2011):683–86.AlsoseeShaneJ. Lopez, Making HopeHappen:CreatetheFutureYouWant for Yourself and Others(NewYork:AtriaBooks,2013).
major in—neurobiology: AtHarvarduntil2006,youactuallydeclared your “concentration”(which is Harvard’sterminologyfor“major”),inthespring of your freshman yearand at the same time mappedout every class you intended to
![Page 1607: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1607.jpg)
take. My official concentrationwas the neurobiology trackwithin biology, sinceneurobiology as a separateconcentration was not createduntilyearslater.
the punishments to stop:Steven F.Maier andMartin E.Seligman, “LearnedHelplessness: Theory andEvidence,” Journal ofExperimental Psychology 105(1976): 3–46. The seminalstudies on learned helplessnessactually had a triadic design,meaning that there was a third
![Page 1608: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1608.jpg)
condition:dogswhoreceivednoshock at all. In general, thesedogsbehavedsimilarlytothosewho were subjected to stresswith control. Some of thematerial in this chapter is froman interview between Seligmanand the author, July 20, 2015.SeealsoMartinE.P.Seligman,Learned Optimism: How toChange Your Mind and YourLife (NewYork:PocketBooks,1990).
practical antidotes fordepression: For more
![Page 1609: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1609.jpg)
informationonAaronBeck,seewww.beckinstitute.org.
distinguish optimists frompessimists: ChristopherPeterson et al., “TheAttributional StyleQuestionnaire,” CognitiveTherapyandResearch6(1982):287–300. See also Lyn Y.Abramson, Gerald I. Metalsky,and Lauren B. Alloy,“Hopelessness Depression: ATheory-Based Subtype ofDepression,” PsychologicalReview96(1989):358–72.
![Page 1610: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1610.jpg)
suffer from depression andanxiety: Peter Schulman,CamiloCastellon,andMartinE.P. Seligman, “AssessingExplanatoryStyle:TheContentAnalysis of VerbatimExplanations and theAttributional StyleQuestionnaire,” BehaviouralResearch and Therapy 27(1989):505–9.
drop out of school: Leslie P.Kamen and Martin E. P.Seligman, “Explanatory StylePredicts College Grade Point
![Page 1611: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1611.jpg)
Average” (unpublishedmanuscript, 1985). ChristopherPeterson and Lisa C. Barrett,“Explanatory Style andAcademic Performance AmongUniversity Freshman,” Journalof Personality and SocialPsychology53(1987):603–7.
stayhealthier:ToshihikoMaruto,Robert C. Colligan, MichaelMalinchoc, and Kenneth P.Offord, “Optimists vs.Pessimists: Survival RateAmongMedicalPatientsOvera30-Year Period,” Mayo ClinicProceedings75(2000):140–43.
![Page 1612: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1612.jpg)
ChristopherPeterson,MartinE.P. Seligman, “PessimisticExplanatory Style Is a RiskFactor for Physical Illness: AThirty-Five-Year LongitudinalStudy,” Journal of Personalityand Social Psychology 55(1988):23–27.
satisfied with their marriages:KarenJ.HornefferandFrankD.Fincham, “Construct ofAttributional Style inDepression and MaritalDistress,” Journal of FamilyPsychology 9 (1995): 186–95.See also, Horneffer and
![Page 1613: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1613.jpg)
Fincham,“AttributionalModelsof Depression and Distress,”Personality and SocialPsychology Bulletin 22 (1996):678–89.
sell about 25 percent moreinsurance: On optimism andsales,seeMartinE.P.Seligmanand Peter Schulman,“Explanatory Style as aPredictor of Productivity andQuittingAmongLife InsuranceSales Agents,” Journal ofPersonality and SocialPsychology 50 (1986): 832–38.Shulman, “Explanatory Style.”
![Page 1614: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1614.jpg)
See also Peter Schulman,“ApplyingLearnedOptimismtoIncrease Sales Productivity,”Journal of Personal Selling &Sales Management 19 (1999):31–37.
swim inhisorherbestevent:Martin E. P. Seligman,“Explanatory Style as aMechanism of DisappointingAthletic Performance,”PsychologicalScience1(1990):143–46.
“I will just carry on”: Lacey,interview.
![Page 1615: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1615.jpg)
couldbethetargetoftherapy:Aaron T. Beck, A. John Rush,Brian F. Shaw, and GaryEmery, Cognitive Therapy ofDepression (New York:GuilfordPress,1979).Alsonotethat, in the same era, AlbertEllis developed a similarapproach.SoBeckandEllisarejointlyrecognizedaspioneersinwhatisnowcommonlyreferredto as cognitive behavioraltherapy.
longer-lasting in its effects:Robert J. DeRubeis et al.,“Cognitive Therapy vs
![Page 1616: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1616.jpg)
MedicationsintheTreatmentofModerate to SevereDepression,” Archives ofGeneral Psychiatry 62 (2005):409–16.StevenD.Hollonetal.,“Prevention of RelapseFollowingCognitiveTherapyvsMedications in Moderate toSevereDepression,”ArchivesofGeneral Psychiatry 62 (2005):417–22. Some patients strugglewith the aspect of CBT thatinvolves trying to talkthemselvesoutoftheirnegativeself-talk. These patients saythingslike:“Inmyhead,Iknow
![Page 1617: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1617.jpg)
it’s not fair to call myself aloser. I’m labeling myself, I’mengaging in all-or-nothingthinking. But in my heart, partof me still feels like a loser—likeI’llneverbegoodenough.”AnewformofCBT,acceptanceand commitment therapy(ACT), addresses theseconcerns. In ACT, the goal issimply to notice any negativeself-talk and accept that it
![Page 1618: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1618.jpg)
exists, while not letting itcontrolyouractions.
“Relentless pursuit”:Information on Teach ForAmerica’s mission and historycan be found atwww.teachforamerica.org.
optimistic teachers weregrittier:ClaireRobertson-Kraftand Angela L. Duckworth,“True Grit: Perseverance andPassion for Long-term GoalsPredicts Effectiveness andRetention Among NoviceTeachers,” Teachers College
![Page 1619: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1619.jpg)
Record (1970) 116 (2014): 1–24.
one of Carol’s first studies:Carol S. Dweck, “The Role ofExpectationsandAttributionsinthe Alleviation of LearnedHelplessness,” Journal ofPersonality and SocialPsychology31(1975):674–85.
assess a person’s theory ofintelligence: This measurewasdevelopedbyCarolDweck,Sheri Levy, ValanneMacGyvers, C.Y. Chiu, andYing-yi Hong. For interestedreaders, I highly recommend
![Page 1620: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1620.jpg)
Carol Dweck, Mindset: TheNew Psychology of Success(New York: Ballantine Books,2008).
positive social relationships:SeeCarolS.Dweck,“Mindsetsand Human Nature: PromotingChange in theMiddleEast, theSchoolyard, the Racial Divide,and Willpower,” AmericanPsychologist(2012):614–22.
persist through college: BrianGalla et al., “Intellective,Motivational, and Self-Regulatory Determinants ofHigh School Grades, SAT
![Page 1621: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1621.jpg)
Scores, and CollegePersistence” (manuscript underreview,2015).
KIPP Schools: For moreinformation on KIPP, seewww.kipp.org.
PromotesGrowthMindsetandGrit: This thesaurus wasoriginally developed bypsychologist David Yeager,whom I thank for this age-general revision. On genericstatements, see Daeun Park etal., “How Do GenericStatements Impact
![Page 1622: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1622.jpg)
Performance? Evidence forEntity Beliefs,” DevelopmentalScience (in press, 2015). Andfinally, on the importance of a“genuine” growth mindset, seeCarolS.Dweck,“CarolDweckRevisits the‘GrowthMindset’ ”EducationWeek,September22,2015.
“neverfailedtoimitatethem”:JamesBaldwin,NobodyKnowsMy Name (New York: VintageBooks,1993),61–62.
inadvertently inculcated afixedmindset: Daeun Park etal., “Young Children’s
![Page 1623: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1623.jpg)
Motivational Frameworks andMathAchievement:Relation toTeacher-Reported InstructionalPractices, but Not TeacherTheoryofIntelligence,”Journalof Educational Psychology (inpress,2015).
parentsreacttomistakes:KylaHaimovitzandCarolS.Dweck,“What Predicts Children’sFixed and Growth Mindsets?Not Their Parent’s Views ofIntelligence But Their Parents’Views of Failure” (manuscriptunderreview,2015).
![Page 1624: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1624.jpg)
apply in a corporate setting:HarvardBusinessReviewStaff,“How Companies Can Profitfrom a ‘Growth Mindset’ ”Harvard Business Review,November2014.
“tracked senior leaders”: BillMcNabb,CEOofVanguard, inan interview with the author,August20,2015.
“makesme stronger”: FriedrichNietzsche, The Anti-Christ,Ecce Homo, Twilight of theIdols: and Other Writings, ed.Aaron Ridley, trans. Judith
![Page 1625: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1625.jpg)
Norman (Cambridge, UK:Cambridge University Press,2005),157.
croon the same words: KanyeWest, “Stronger,” Graduation,2007. Kelly Clarkson sings apopularized version of thephrase, “What doesn’t kill youmakes you stronger,” in“Stronger (What Doesn’t KillYou),”Stronger,2011.
moreconfident: In fact, the ideathatsufferingcanmakeusmorecapableistimeless.Everymajorreligious tradition includes a
![Page 1626: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1626.jpg)
parable where suffering isnecessary for enlightenment.The Latin root of the wordpassionispati,whichmeans“tosuffer.” OED Online, OxfordUniversity Press, September2015.
“tenacity in pursuit”: For moreinformationonOutwardBound,seewww.outwardbound.org.
benefits tend to increase: JohnA. Hattie, Herbert W. Marsh,James T. Neill, and Garry E.Richards,“AdventureEducationand Outward Bound: Out-of-
![Page 1627: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1627.jpg)
ClassExperiencesThatMakeaLasting Difference,” Review ofEducational Psychology 67(1997):43–87.
were much more vulnerable:Maier and Seligman, “LearnedHelplessness.”
SteveMaier and his students:Kenneth H. Kubala et al.,“Short- and Long-TermConsequences of StressorControllability in AdolescentRats,” Behavioural BrainResearch234(2012):278–84.
“respond to stress”: Steven F.Maier, professor of psychology
![Page 1628: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1628.jpg)
and director of the Center forNeuroscience at the Universityof Colorado at Boulder, in aninterviewwiththeauthor,April2,2015.
Milton Hershey School: Notcoincidentally, Milton Hersheyhimselfexemplifiedgrit,havingstarted several unsuccessfulcompanies before developing,through trial and error, aformula formilk chocolate thatwould soonmake his companythe largest confectionary in theworld. He and his wife couldnot have children and therefore
![Page 1629: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1629.jpg)
created the Hershey School,which owns a controllinginterest in Hershey stock. FormoreinformationontheMiltonHersheySchoolanditsfounder,visitwww.mhskids.org.
alwayslearningandgrowing:Ifyou want to hear Kayvon’smusic, visitwww.kayvonmusic.com.
increased their IQ scores: SueRamsden et al., “Verbal andNon-Verbal IntelligenceChangesintheTeenageBrain,”Nature479(2011):113–16.
![Page 1630: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1630.jpg)
abilitytogrowmyelin:CarolS.Dweck, “The Secret to RaisingSmart Kids,” ScientificAmerican 23 (2015). Lisa S.Blackwell, Kali H.Trzesniewski, and Carol S.Dweck, “Implicit Theories ofIntelligence PredictAchievement Across anAdolescent Transition: ALongitudinal Study and inIntervention,” ChildDevelopment 78 (2007): 246–63. Joshua Aronson, Carrie B.Fried and Catherine Good,“Reducing the Effects of
![Page 1631: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1631.jpg)
Stereotype Threat on AfricanAmerican College Students byShaping Theories ofIntelligence,” Journal ofExperimental Psychology 38(2002): 113–25. DavidPaunesku et al., “Mind-SetInterventions Are a ScalableTreatment for AcademicUnderachievement,”Psychological Science (2015):1–10. Allyson P. Mackey,Kirstie J. Whitaker, and SilviaA. Bunge, “Experience-Dependent Plasticity in WhiteMatter Microstructure:
![Page 1632: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1632.jpg)
Reasoning Training AltersStructural Connectivity,”Frontiers in Neuroanatomy 6(2012): 1–9. Robert J. Zatorre,R. Douglas Fields, and HeidiJohansen-Berg, “Plasticity inGrayandWhite:NeuroimagingChanges in Brain StructureDuring Learning,” NatureNeuroscience 15 (2012): 528–36.
“resilience training”: The PennResilience Program wasdeveloped by Jane Gillham,KarenReivich,andLisaJaycox.This school-based program
![Page 1633: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1633.jpg)
teaches cognitive-behavioraland social-emotional skills tostudents using role plays,games, and interactiveactivities.SeeJ.E.Gillham,K.J.Reivich,L.H.Jaycox,andM.E. P. Seligman, “PreventingDepressive Symptoms inSchoolchildren: Two YearFollow-up,” PsychologicalScience 6 (1995): 343–51.Martin E. P. Seligman, PeterSchulman, Robert J. DeRubeis,and Steven D. Hollon, “ThePrevention of Depression andAnxiety,” Prevention and
![Page 1634: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1634.jpg)
Treatment2(1999).Notethatamore recent meta-analyticreviewconfirmedbenefitsoftheprogram over twelve monthspost-intervention in comparisonto no treatment, but not activetreatment, control conditions:StevenM.Brunwasser, Jane E.Gillham, and Eric S. Kim, “AMeta-Analytic Review of thePenn Resiliency Program’sEffect on DepressiveSymptoms,” Journal ofConsulting and ClinicalPsychology77(2009):1042–54.
![Page 1635: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1635.jpg)
cognitive behavioral therapy:For more information oncognitive therapy, seewww.beckinstitute.org.
“Igetbackonmyfeet”:RhondaHughes, Helen HerrmannProfessor of MathematicsEmeritusatBrynMawrCollegeand cofounder of the EDGEProgram, in conversation withtheauthor,May25,2013.
“Don’t give up!”: SylviaBozeman,professoremeritusofmathematics at SpelmanCollege,incorrespondencewith
![Page 1636: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1636.jpg)
the author, October 14, 2015.Sylviahasmadesimilarremarksin Edna Francisco, “Changingthe Culture of Math,” Science,September 16, 2005. I shouldalsonotethatsometimesthere’snobody available to tell you tokeepgoing.PsychologistKristinNeff suggests thinking aboutwhatyouwouldsay toa friendwho was struggling with asimilar situation, and then topractice saying similarcompassionate, understandingthingstoyourself.
![Page 1637: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1637.jpg)
CHAPTER10:PARENTINGFORGRIT“can quite overwhelm him”:
John B.Watson,PsychologicalCare of Infant and Child(London: Unwin Brothers,1928),14.
“givethemapatonthehead”:Ibid.,73.
“my parents were myfoundation”: Don Amore,“Redemption for a PurePasser?” Hartford Courant,January29,1995.
![Page 1638: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1638.jpg)
“I’d like to come home”:Grit:TheTrueStoryofSteveYoung,directed by Kevin Doman(Cedar Fort, KSL Television,andHomeSports,2014),DVD.
“You’renotcomingbackhere”:Ibid.
“I threw over 10,000 spirals”:SteveYoungwithJeffBenedict,“Ten Thousand Spirals,”chapter in forthcoming book,2015,http://www.jeffbenedict.com/index.php/blog/389-ten-thousand-spirals.
![Page 1639: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1639.jpg)
“I couldn’t get a hit”: Doman,Grit:TheTrueStory.
“you cannot quit”: ChristopherW.Hunt, “ForeverYoung,PartII: Resolve in the Face ofFailure,” Greenwich Time,February2,2013.
“and I’d be hitting them”:Doman,Grit:TheTrueStory.
“Endure to the end, Steve”:TheProFootballHallofFame,“Steve Young’s EnshrinementSpeech Transcript,” August 7,2005.
![Page 1640: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1640.jpg)
“The name really fits him”:Doman,Grit:TheTrueStory.
ten thousand sit-ups ina row:Kevin Doman, “Grit: The TrueStoryofSteveYoung,”DeseretNews,April4,2014.
“Our Steve is a great kid!”:SherryandGritYoung,parentsofSteveYoung,inaninterviewwith the author, August 23,2015.
“Everything is contextual”:Steve Young, formerquarterback of the SanFrancisco49ers,inaninterview
![Page 1641: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1641.jpg)
with the author, August 18,2015.
funniest comics in Britain:Observer, “The A-Z ofLaughter (Part Two),”Guardian,December7,2003.
“came from my family”:Francesca Martinez, comedian,inan interviewwith theauthor,August4,2015.
“then you can reassess”:Francesca Martinez, What the**** Is Normal?! (London:VirginBooks,2014),185.
“leave formal education”:Martinez, interview. In her
![Page 1642: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1642.jpg)
book,Francescagives a similaraccount.
“the throwing of objects”:Martinez, What the **** IsNormal?!,48.
“authoritative parenting”:WendyS.GrolnickandRichardM. Ryan, “Parent StylesAssociated with Children’sSelf-Regulation andCompetence in School,”Journal of EducationalPsychology 81 (1989): 143–54.Earl S. Schaefer, “AConfigurational Analysis ofChildren’s Reports of Parent
![Page 1643: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1643.jpg)
Behavior,” Journal ofConsulting Psychology 29(1965): 552–57. DianaBaumrind, “AuthoritativeParenting Revisited: Historyand Current Status,” inAuthoritative Parenting:Synthesizing Nurturance andDiscipline for Optimal ChildDevelopment, ed. Robert E.Larzelere, Amanda SheffieldMorris,andAmandaW.Harrist(Washington, D.C.: AmericanPsychological Association,2013),11–34.
![Page 1644: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1644.jpg)
a moratorium on furtherresearch: Laurence Steinberg,“Presidential Address: WeKnow Some Things: Parent-Adolescent Relationships inRetrospect and Prospect,”Journal of Research onAdolescence11(2001):1–19.
warm, respectful, anddemandingparents:LaurenceSteinberg, Nina S. Mounts,SusieD.Lamborn,andSanfordM. Dornbusch, “AuthoritativeParenting and AdolescentAdjustment Across Varied
![Page 1645: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1645.jpg)
Ecological Niches,” Journal ofResearch on Adolescence 1(1991):19–36.
acrossadecadeormore:KoenLuyckx et al., “Parenting andTrajectories of Children’sMaladaptive Behaviors: A 12-year Prospective CommunityStudy,” Journal of ClinicalChild&AdolescentPsychology40(2011):468–78.
messages their childrenreceive: Earl S. Schaefer,“Children’sReports of ParentalBehavior:AnInventory,”Child
![Page 1646: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1646.jpg)
Development 36 (1965): 413–24. Nancy Darling andLaurence Steinberg, “ParentingStyleasContext:AnIntegrativeModel,”Psychological Bulletin113(1993):487–96.
parenting assessment: Adaptedwith permission from NancyDarling and Teru Toyokawa,“ConstructionandValidationoftheParentingStyleInventoryII(PSI-II),” (unpublishedmanuscript,1997).
as virtual “carbon copies”:AlbertBandura,DorotheaRoss,and Sheila Ross, “Imitation of
![Page 1647: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1647.jpg)
Film-Mediated AggressiveModels,” Journal of Abnormaland Social Psychology 66(1963):3–11.
“work toward distant goals”:Bloom,DevelopingTalent,510.
“parents’ own interests”:Ronald S. Brandt, “On TalentDevelopment: A Conversationwith Benjamin Bloom,”Educational Leadership 43(1985):34.
the next generation: Center forPromise, Don’t Quit on Me:What Young People Who LeftSchool SayAbout thePower of
![Page 1648: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1648.jpg)
Relationships (Washington,D.C.: America’s PromiseAlliance, 2015),www.gradnation.org/report/dont-quit-me.
“fifty-something, grizzledrocker”: Tobi Lütke, “TheApprentice Programmer,” TobiLütke’s blog, March 3, 2013,http://tobi.lutke.com/blogs/news/11280301-the-apprentice-programmer.
emerging research onteaching:KathrynR.Wentzel,“Are Effective Teachers LikeGood Parents? Teaching Styles
![Page 1649: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1649.jpg)
and Student Adjustment inEarly Adolescence,” ChildDevelopment 73 (2002): 287–301. Douglas A. Bernstein,“Parenting and Teaching:What’s the Connection in OurClassrooms?” PsychologyTeacher Network, September2013,http://www.apa.org/ed/precollege/ptn/2013/09/parenting-teaching.aspx.
1,892 different classrooms:Ronald F. Ferguson andCharlotte Danielson, “HowFramework for Teaching andTripod 7Cs Evidence
![Page 1650: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1650.jpg)
DistinguishKeyComponentsofEffective Teaching,” inDesigning Teacher EvaluationSystems: New Guidance fromthe Measures of EffectiveTeachingProject,ed.ThomasJ.Kane,KerriA.Kerr,andRobertC. Pianta (San Francisco:Jossey-Bass,2014),98–133.
David Yeager and GeoffCohen: David ScottYeager etal., “Breaking the Cycle ofMistrust: Wise Interventions toProvide Critical FeedbackAcross the Racial Divide,”Journal of Experimental
![Page 1651: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1651.jpg)
Psychology143(2013):804–24.For the research on highlyeffective tutors that originallyinspired this intervention, seeMark R. Lepper and MariaWoolverton, “The Wisdom ofPractice:LessonsLearned fromthe Study of Highly EffectiveTutors,”inImprovingAcademicAchievement: Impact ofPsychological Factors onEducation, ed. Joshua Aronson(New York: Academic Press,2002),135–58.
“have very high expectations”:Yeager et al., “Breaking the
![Page 1652: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1652.jpg)
Cycle”CodyColeman: Cody Coleman,
PhD candidate in computerscience at Stanford University,inconversationwiththeauthor,May24,2013.
Chantel Smith: Chantel Smith,mathematicsteacheratWinslowTownship High School, inconversation with the author,March15,2015.
“Stay positive”: Cody Coleman,interview by Stephanie Renée,900AM-WURD, October 31,2014.
![Page 1653: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1653.jpg)
CHAPTER11:THEPLAYINGFIELDSOFGRITboth challenged and having
fun: Reed W. Larson andDouglas Kleiber, “DailyExperience of Adolescents,” inHandbook ofClinical Researchand Practice with Adolescents,ed. Patrick H. Tolan andBertramJ.Cohler(Oxford,UK:John Wiley & Sons, 1993),125–45. Reed W. Larson,“Positive Development in aDisorderly World,” Journal ofResearch on Adolescence 21
![Page 1654: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1654.jpg)
(2011): 317–34. Data areoriginally from Reed W.Larson, Giovanni Moneta,Maryse H. Richards, andSuzanne Wilson, “Continuity,Stability, and Change in DailyEmotional Experience AcrossAdolescence,” ChildDevelopment 73 (2002): 1151–65.
![Page 1655: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1655.jpg)
AdaptedwithpermissionfromYoungetal.poster
![Page 1656: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1656.jpg)
See also David J.Shernoff, MihalyCsikszentmihalyi, BarbaraSchneider, and Elisa SteeleShernoff, “StudentEngagement inHighSchoolClassrooms from thePerspective of FlowTheory,” School PsychologyQuarterly 18 (2003): 158–76. David J. Shernoff andDeborah Lowe Vandell,“Engagement in After-School Program Activities:Quality of Experience fromthe Perspective of
![Page 1657: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1657.jpg)
Participants,” Journal ofYouth and Adolescence 36(2007): 891–903. KiyoshiAsakawa and MihalyCsikszentmihalyi, “TheQuality of Experience ofAsianAmericanAdolescentsin Academic Activities: AnExploration of EducationalAchievement,” Journal ofResearch on Adolescence 8(1998):241–62.
involved in extracurriculars:Reed W. Larson, “Toward aPsychology of Positive YouthDevelopment,” American
![Page 1658: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1658.jpg)
Psychologist55(2000):170–83.SeealsoRobertD.Putnam,OurKids: The American Dream inCrisis (New York: Simon &Schuster,2015),174–82.
predicts better outcomes: Forexample, see JenniferFredricksand Jacquelynne S. Eccles,“Extracurricular ParticipationAssociated with BeneficialOutcomes? Concurrent andLongitudinal Relations,”Developmental Psychology 42(2006):698–713.
![Page 1659: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1659.jpg)
playing video games: Bureau ofLabor Statistics, “AmericanTime Use Survey,” AverageHoursSpentPerDayinLeisureand Sports Activities, byYoungest and OldestPopulations Graph, 2013,http://www.bls.gov/TUS/CHARTS/LEISURE.HTMSee also Vanessa R. Wight,Joseph Price, Suzanne M.Bianchi, and Bijou R. Hunt,“The Time Use of Teenagers,”Social Science Research 38(2009):792–809.
![Page 1660: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1660.jpg)
success in adulthood: MargoGardner,JodieRoth,andJeanneBrooks-Gunn, “Adolescents’Participation in OrganizedActivities and DevelopmentalSuccess 2 and 8 Years AfterHigh School: Do Sponsorship,Duration,andIntensityMatter?”Developmental Psychology 44(2008):814–30.
Willingham was the director:WarrenH.Willingham,Successin College: The Role ofPersonal Qualities andAcademic Ability (New York:College Entrance Examination
![Page 1661: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1661.jpg)
Board, 1985). Around the timeWarren Willingham wasconducting this study, histeenage son Dan went off tocollege to study psychology.Dan is now a professor ofpsychologyat theUniversityofVirginiaand,inthespiritofhisfather’s legacy, dedicated tohelping kids benefit fromadvances in cognitivepsychology.My favorite of hisbooks is Why Don’t StudentsLike School? (San Francisco:Jossey-Bass,2009).
![Page 1662: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1662.jpg)
beyondstandardized tests:Thepredictive validity ofstandardized achievement testsfor academic and professionaloutcomes is well-documented.See the work of psychologistsPaulSackettandNathanKuncelin particular. My claim here isnot that achievement tests areinvalid, per se, but rather thatthey are an incomplete andimperfect metric for whatstudents know and can do. SeeAngela L. Duckworth, PatrickD. Quinn, and Eli Tsukayama,“What No Child Left Behind
![Page 1663: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1663.jpg)
LeavesBehind:TheRolesofIQand Self-Control in PredictingStandardizedAchievement TestScores and Report CardGrades,”JournalofEducationalPsychology104(2012):439–51.See also James J. Heckman,John Eric Humphries, and TimKautz, ed., The Myth ofAchievement Tests: The GEDand the Role of Character inAmerican Life (Chicago:University of Chicago Press,2014).
“purposeful, continuouscommitment”: Willingham,
![Page 1664: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1664.jpg)
SuccessinCollege,213.“winning an important meet”:
Michael Wines,“Extracurricular Work SpursSuccess in College,” LosAngeles Times, October 17,1985.
“productive follow-through”:Willingham,SuccessinCollege,193. For a review of theadvantages and disadvantagesof various approaches tomeasuringqualitieslikegrit,seeDuckworth and Yeager,“MeasurementMatters.”
![Page 1665: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1665.jpg)
atverydifferentrates:BrianM.Galla et al., “Cognitive andNoncognitive Determinants ofHigh School Grades, SATScores, and CollegePersistence,” Journal ofEducational Psychology (underreview,2015).
the Grit Grid: Alyssa J.Matteucci et al., “QuantifyingGrit from ExtracurricularActivities: A Biodata MeasureofPassionandPerseveranceforLong-Term Goals” (manuscriptinpreparation,2015).
![Page 1666: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1666.jpg)
extracurriculars of noviceteachers: Robertson-Kraft andDuckworth,“TrueGrit”
corresponsive principle: BrentW. Roberts and AvshalomCaspi, “The CumulativeContinuityModelofPersonalityDevelopment: Striking aBalance Between Continuityand Change in PersonalityTraitsAcross theLifeCourse,”in Understanding HumanDevelopment: Dialogues withLifespanPsychology,ed.UrsulaM. Staudinger and Ulman
![Page 1667: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1667.jpg)
Lindenberger (Norwell, MA:Kluwer Academic Publishers,2003),183–214.
“setlikeplaster”:WilliamJamesclaimed in 1890 that by agethirty, personality is “set likeplaster.” Quoted in Brent W.Roberts and Wendy F.DelVecchio, “The Rank-OrderConsistency of PersonalityTraits from Childhood to OldAge:AQuantitativeReviewofLongitudinal Studies,”Psychological Bulletin 126(2000):6.
![Page 1668: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1668.jpg)
change after childhood: Ibid.Avshalom Caspi, Brent W.Roberts,andRebeccaL.Shiner,“Personality Development:Stability and Change,” AnnualReview of Psychology 56(2005): 453–84. Brent W.Roberts, Kate E. Walton, andWolfgang Viechtbauer,“Patterns of Mean-LevelChange in Personality TraitsAcross the Life Course: AMeta-Analysis of LongitudinalStudies,” PsychologicalBulletin132(2006):1–25.
![Page 1669: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1669.jpg)
tendency toward sociability:Brent W. Roberts, AvshalomCaspi, and Terrie E. Moffitt,“Work Experiences andPersonality Development inYoung Adulthood,” Journal ofPersonality and SocialPsychology84(2003):582–93.
“It’s never far from reach”:William R. Fitzsimmons, deanof admissions and financial aidat Harvard College, in aninterview with the author,February17,2015.
“plainoldhardwork”:WilliamR. Fitzsimmons, “Guidance
![Page 1670: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1670.jpg)
Office:AnswersfromHarvard’sDean,Part3,”NewYorkTimes,September 14, 2009,http://thechoice.blogs.nytimes.com/tag/harvarddean
“all that grit”: Fitzsimmons,interview.
dropping precipitously: KaisaSnellman, Jennifer M. Silva,Carl B. Frederick, and RobertD. Putnam, “The EngagementGap: Social Mobility andExtracurricular ParticipationAmong American Youth,” TheAnnals of the American
![Page 1671: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1671.jpg)
AcademyofPoliticalandSocialScience657(2015):194–207.
Harlem Children’s Zone: Formore information on GeoffreyCanada and the HarlemChildren’s Zone, visitwww.hcz.org.
“a decent childhood”:GeoffreyCanada, founder and presidentof theHarlemChildren’sZone,inconversationwiththeauthor,May14,2012.
“I actually like kids”: GeoffreyCanada, “Our Failing Schools.EnoughIsEnough!”TEDTalks
![Page 1672: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1672.jpg)
Education video, filmed May2013,https://www.ted.com/talks/geoffrey_canada_our_failing_schools_enough_is_enough?language=en.
BobEisenberger:Forasummaryof his research, see RobertEisenberger, “LearnedIndustriousness,” PsychologicalReview 99 (1992): 248–67 andEisenberger’s book BlueMonday:TheLoss of theWorkEthic in America (New York:ParagonHouse,1989).
playing fields forgrit: Even forthoseofuswhoarebeyondour
![Page 1673: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1673.jpg)
high school and college years,therearemanyactivitieswecansign up for that offer challengeand support. For example, I’velearnedalotaboutgritfromJoeDeSena,founderoftheSpartanRace. Here’s a story from ourinterview:“WeliveinVermont.It gets very icy. My son is ontheskiteam.Oneday,hecomesinanhourbeforelunch.Hetellsmehecameinearlybecausehewas cold.” It turns out that therest of the team was still outpracticing. “Okay,” Joe said tohis son, “I understand you’re
![Page 1674: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1674.jpg)
cold. But you’re on the team,and the team is skiing, so nowyou’re on my team, and myteamdoesn’t take thechairlift.”Father and son then proceedoutside and hike up themountainonfoot,thesonupsetandcomplainingthewholeway.And then they skied down.Lesson over. “Sounds liketorture,” I said, half-joking.“The point was not to torturehim,” Joe replied. “The pointwas to show him it could be alot worse. We never had thatissueagainbecausenowhehad
![Page 1675: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1675.jpg)
a frame of reference that said,‘Okay, this is uncomfortable,but it could be a lot worse.’ ”Then Joe paused. “You know,I’vequitaracebefore.Ilearnedthere’sa lotworse thandealingwith the pain in front of me.That’s a lesson you need helplearning. You’re not bornknowingthat.”
CHAPTER12:ACULTUREOFGRIT“really have grit”: Pete Carroll,
interviewed by Eric Wayne
![Page 1676: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1676.jpg)
Davis,NFL AM, posted by theSeattleSeahawks,“PeteCarroll:‘We’re Looking for Grit,’ ”February 3, 2014,http://www.seahawks.com/video/2014/02/03/pete-carroll-were-looking-grit.
“be great competitors”: PeteCarroll, head coach of theSeattle Seahawks, in a phonecall with the author, May 13,2013.
“join a great team”: Chambliss,interview.
thinking a different way: LeeRoss and Richard E. Nisbett,
![Page 1677: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1677.jpg)
The Person and the Situation:Perspectives of SocialPsychology (London:McGraw-Hill, 1991).Thisbook sumsupallthisresearchbeautifully.
JamesMarch: James G. March,“How Decisions Happen inOrganizations,” Human-Computer Interaction 6 (1991):95–117.
“I am a West Pointer”: TomDeierlein, cofounder and CEOof ThunderCat Technology, inan email with the author,October29,2011.
![Page 1678: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1678.jpg)
“theygotused to it”:Deierlein,in an email to the author,September17,2015.
“the Finnish spirit”: Time,“Northern Theatre: Sisu,”January8,1940.
“he can stand worse”: HudsonStrode, “Sisu: A Word ThatExplains Finland,” New YorkTimes,January14,1940.
askedathousandFinns:EmiliaLahti, “Above and BeyondPerseverance: An Explorationof Sisu” (Masters Capstone,
![Page 1679: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1679.jpg)
University of Pennsylvania,2013).
“I wear this jersey”: Betty Liu,Work Smarts: What CEOs SayYouNeedtoKnowtoGetAhead(Hoboken, NJ: John Wiley &Sons,2014),7.
“Noonehereisinsignificant”:Thomas II, Amazon review of“Last Man Standing: TheAscent of JamieDimon and JPMorgan Chase,” October 8,2009,http://www.amazon.com/Last-Man-Standing-Ascent-JPMorgan/dp/B003STCKN0.
![Page 1680: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1680.jpg)
“grytte”: Ben Smith, “MasterHoward Dean,” Observer,December 8, 2003,http://observer.com/2003/12/master-howard-dean.
senior year at Browning: DuffMcDonald,LastManStanding:The Ascent of Jamie Dimon(New York: Simon andSchuster,2009),5.
“I call it fortitude”: JamieDimon, chairman, president,and CEO of JPMorgan Chase,inconversationwiththeauthor,April14,2015.
![Page 1681: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1681.jpg)
“the ultimate thing”: Dimon,interview.
“how they treat people”: NickSummers and Max Abelson,“Why JPMorgan’s JamieDimon is Wall Street’sIndispensableMan,”BloombergBusinessweek,May16,2013.
“let my kids work for them?”:Dimon,interview.
“actually in the arena”:TheodoreRoosevelt, “TheManin the Arena. Citizenship in aRepublic,” address delivered attheSorbonne,Paris,1910.
![Page 1682: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1682.jpg)
“notreasonstoquit”:JPMorganChase & Co., How We DoBusiness, 2014,http://www.jpmorganchase.com/corporate/About-JPMC/document/20140711_Website_PDF_FINAL.pdf
“that as a compliment”: TimCrothers, The Man Watching:Anson Dorrance and theUniversity of North CarolinaWomen’sSoccerDynasty (NewYork: Thomas Dunne, 2006),37.
“final measure of greatness”:Ibid.,106.
![Page 1683: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1683.jpg)
“It’s our culture”: AnsonDorrance, head coach of theUniversity of North Carolina’swomen’s soccer team, in aninterview with the author,August21,2015.
theBeepTest:LucA.Léger,D.Mercier, C. Gadoury, and J.Lambert, “The Multistage 20Metre Shuttle Run Test forAerobic Fitness,” Journal ofSports Sciences 6 (1988): 93–101.
“this is a test of yourmentality”: Dorrance, in an
![Page 1684: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1684.jpg)
interview with the author,September30,2015.
“language is everything”:Dimon,interview.
“making you happy”: GeorgeBernard Shaw, Man andSuperman: A Comedy and aPhilosophy (New York:Penguin,1903),32.Theoriginalpassage reads: “This is the truejoy in life, thebeingused forapurpose recognized by yourselfasamightyone...thebeingaforce of Nature instead of afeverish selfish little clod ofailments and grievances
![Page 1685: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1685.jpg)
complaining that theworldwillnotdevote itself tomakingyouhappy.”
theBugleNotes:West-Point.org,“Bugle Notes,” accessedFebruary 10, 2015,http://www.west-point.org/academy/malo-wa/inspirations/buglenotes.html.
“thantomakeanarmy”:MajorGeneral John M. Schofield,former superintendent of theUnited States MilitaryAcademy, address to cadets,August11,1879.
![Page 1686: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1686.jpg)
“the yelling and screaming”:Lieutenant General Robert L.Caslen, superintendent of theUnited States MilitaryAcademy, in an interview withtheauthor,September4,2015.
less than 2 percent: Dataprovided by the United StatesMilitaryAcademy.
“allows you to get there”:Carroll,WinForever,183.
“they can demonstratepassion”:“PeteCarrollReturnsto USC, Full Interview, 2014,”YouTubevideo,1:57:42,posted
![Page 1687: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1687.jpg)
March 20, 2014,https://youtube/jSizvISegnE.
“they’re helping me to getbetter”: Earl Thomas, “TakeNothing for Granted,” EarlThomas’s blog, January 25,2014,http://www.earlthomas.com/2014/01/25/take-nothing-granted.
“the worst call in NFLhistory”: Don Banks, “TheWorstPlayCallinNFLHistoryWill Continue to HauntSeahawks in 2015,” SportsIllustrated,July21,2015.
![Page 1688: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1688.jpg)
“failure is never fatal”: “TheWizard’s Wisdom:‘Woodenism,’ ” ESPN, June 5,2010.
“And use it. Use it!”: GregBishop, “Pete Carroll, NFL’sEternal Optimist, Is Ready toTurnHeartbreakintoTriumph,”Sports Illustrated, August 3,2015,http://www.si.com/nfl/2015/07/28/pete-carroll-seattle-seahawks-2015-season-super-bowl-xlix.
CHAPTER13:CONCLUSION
![Page 1689: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1689.jpg)
hand inhandwithwell-being:Victoria Young, Yuchen Lin,and Angela L. Duckworth,“AssociationsBetweenGritandSubjective Well-Being in aLarge Sample of US Adults,”poster presented at the 16thAnnual Convention of theSociety for Personality andSocialPsychology,LongBeach,CA,February2015.
betweentheextremes:Aristotle,NicomacheanEthics. AdamM.GrantandBarrySchwartz,“TooMuch of a Good Thing: TheChallenge and Opportunity of
![Page 1690: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1690.jpg)
theInvertedU,”PerspectivesinPsychologicalScience6(2011):61–76.
wanted tobegrittier: This datawascollectedin2015andisnotyetpublished.
honesty trumps all: Geoffrey P.Goodwin, Jared Piazza, andPaul Rozin, “Moral CharacterPredominates in PersonPerception and Evaluation,”Journal of Personality andSocial Psychology 106 (2014):148–68.
![Page 1691: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1691.jpg)
character is plural: I wish Icould take credit for theexpression, “character isplural.” I cannot. Many othershave made the sameobservation, includingChristopher Peterson andMartin Seligman in CharacterStrengths and Virtues (NewYork: OxfordUniversity Press,2004),10.
dimensionsofcharacter:DaeunPark et al., “A TripartiteTaxonomy of Character:Evidence for Interpersonal,
![Page 1692: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1692.jpg)
Intrapersonal, and IntellectualCompetencies in Youth,”(manuscript under review,2015). Note that these samethreevirtueclusterscorrespond,roughly, to the Big Fivepersonality dimensions ofconscientiousness,agreeableness, and openness toexperience.
tendtobeself-controlled:Iseeself-control as related butdistinct from grit. You can beself-controlledaboutagoalthatis not your top-level, ultimateconcern. And self-control isn’t
![Page 1693: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1693.jpg)
directly related to overcomingsetbacksandfailures.However,both grit and self-control areabout achieving valued goals.See Angela L. Duckworth andJames J. Gross, “Self-ControlandGrit:RelatedbutSeparableDeterminants of Success,”Current Directions inPsychological Science 23(2014): 319–25. I personallybelieve that self-control is anextraordinarilyimportantvirtue,and to learn more aboutstrategies that facilitate it andtheir benefits, see Walter
![Page 1694: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1694.jpg)
Mischel, The MarshmallowTest: Mastering Self-Control(New York: Little, Brown,2014), and Roy F. Baumeisterand John Tierney, Willpower:Rediscovering the GreatestHuman Strength (New York:Penguin,2011).
“resume virtues”; “eulogyvirtues”: David Brooks, TheRoad toCharacter (NewYork:RandomHouse,2015),xi.
worldofideas:Ihaven’ttouchedupon creativity in this book. Inmany endeavors, creativity is
![Page 1695: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1695.jpg)
absolutelyessential,andIdirectthe interested reader to ScottBarry Kaufman and CarolynGregoire, Wired to Create:UnravelingtheMysteriesof theCreative Mind (New York:PerigeeBooks,2015).
predict different outcomes:Park et al., “TripartiteTaxonomy.”
“nothing was coming out”:“Advice on Writing from theAtlantic’s Ta-Nehisi Coates,”Atlantic video, September 27,2013,http://www.theatlantic.com/video/archive/2013/09/advice-
![Page 1696: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1696.jpg)
on-writing-from-i-the-atlantic-i-s-ta-nehisi-coates/280025.
“writing is failure”: “JournalistTa-Nehisi Coates, 2015MacArthurFellow,”MacArthurFoundation video, postedSeptember 28, 2015,https://www.macfound.org/fellows/931
![Page 1697: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1697.jpg)
INDEX
A note about the index: Thepagesreferencedinthisindexreferto the page numbers in the printedition.Clickingonapagenumberwilltakeyoutotheebooklocationthat corresponds to the beginningof that page in the print edition.For a comprehensive list oflocations of any word or phrase,use your reading system’s searchfunction.
![Page 1698: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1698.jpg)
AcademyAwards,44Acceptanceandcommitmenttherapy(ACT),310n
Ageandgrit,84–89AirborneRangers,248,260Alex’sLemonadeStandFoundation,143
Allen,Woody,49Amazon.com,95,111America’sGotTalent(televisionprogram),31
Anderson,Chris,134Angelou,Maya,140Animalexperiments.SeeDogs,experimentson;Rats,experimentson
![Page 1699: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1699.jpg)
Anxiety,174Apatow,Judd,127–28Aristotle,146,271–72ArmySpecialOperationsForces.SeeGreenBerets
ArmyTen-Miler,249–50Asemani,Kayvon,190–91Attributionretrainingprogram,179Attritionmodel,259Authoritarianparenting,200,203,211,212,213
Authoritativeparenting.SeeWise(authoritative)parenting
Autonomouslymotivatedgoals,297n
![Page 1700: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1700.jpg)
Bacon,Francis,76Baime,Michael,155–57Baldwin,James,183Basketball,84BeastBarracks,4–7,9–10,12
characteristicsofsuccessfulcadets,5–7
diminishedattritionratein,259typicaldayat,4
Beck,Aaron,173,175–76BeepTest,255–56Berg,Justin,166BetweentheWorldandMe(Coates),275
Bezos,Jeff,95,96,99,104,110–11,263
![Page 1701: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1701.jpg)
BillandMelindaGatesFoundation,218,230–31
Blaine,David,124Blake,Juliet,133–34Bloom,Benjamin,107,108,144,211,215–16
Bodrova,Elena,141–42Bonaparte,Napoleon,76Boredom,104,111–12Bozeman,Sylvia,194BreakthroughGreaterBoston,158Bricklayers,parableofthe,149–50,152,153
BrighamYoungUniversity(BYU),202,206,215
Brodsky,Joseph,257
![Page 1702: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1702.jpg)
Brooks,David,274BrowningSchool,253Buffett,Warren,66–68BugleNotes,258Bugnard,Chef,101Bundick,Matt,160Bunsen,ChristianK.J.von,76Burke,Edmund,76Bush,GeorgeH.W.,49
Calling,149–57developingvs.finding,153takingtimetoidentify,155–57unconventionalpathsto,161–62
CambridgeUniversity,31
![Page 1703: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1703.jpg)
Canada,Geoffrey,237–38CarnegieMellonUniversity,31,33Carroll,Pete,74
lifephilosophyof,61–62,64Seahawkcultureand,243–44,251,261–68
Caslen,Robert,258–61Cervantes,Miguelde,75Chalmers,Thomas,76Chambliss,Dan,36–38,39,81,245–47
Character,273–74Chast,Roz,69Chatman,Jennifer,183Chatterton,Thomas,76ChicagoPublicSchools,11
![Page 1704: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1704.jpg)
Child,Julia,57,99–101Child-centeredapproachtoparenting,201,211
ChildGenius(televisionprogram),31
Christensen,Ulrik,122–23Chua,Amy,106CiderHouseRules,The(film),44Cinnabonbakerychain,163,164Clarkson,Kelly,187Clinton,Bill,35–36Clinton,Hillary,35–36Close,Kerry,125–26,137Coady,Chantal,96Coates,Ta-Nehisi,275–76Cobden,Richard,76
![Page 1705: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1705.jpg)
Cognitivebehavioraltherapy,176,193,310n
Cohen,Geoff,218–19Cole,Kat,163–65Coleman,Cody,220–22Coleridge,SamuelTaylor,76Collegeeducation,11,230–32ColumbiaUniversity,226,257Communication,253,256Communitycolleges,11Compassmetaphor,60,63,67,90Competition,262–63,265–66CompetitionWednesdays,262Copernicus,Nicolaus,75Corresponsiveprinciple,233–34,246
![Page 1706: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1706.jpg)
Cost-benefitanalysis,248,250Côté,Jean,107–8Cox,Catharine,74–78Crosswordpuzzledesign,95,108–10,111–12,115
Csikszentmihalyi,Mihaly,128–31Culture,243–68
categoricalallegianceto,245defined,244generationaldifferencesand,85–86,89
identityand,247–50organizational,252–58
Cuomo,Mario,49Currey,Mason,139
![Page 1707: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1707.jpg)
DailyRituals(Currey),139Damon,Bill,162–63,167Danton,GeorgesJ.,76Darling,Nancy,213Darwin,Charles,20–22DavyO’Brienaward,203DearAbby,193Deierlein,Tom,248–50,260Deliberatepractice,120–42
applyingprinciplesof,123–24author’sexperienceof,133–35effortfulnessof,127–28feedbackand,122–23,132,134
flowand,128–32,137gettingthemostfrom,137–42
![Page 1708: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1708.jpg)
asahabit,139–40positiveexperienceof,135–37,140–42
scienceof,137–39stretchgoalin,121–23
Demandingstyleofparenting,201–7,211
DenverBroncos,243Depression,173,174,176,193DeSena,Joe,319nDevelopmentalmodel,259–61Díaz,Roberto,121Dimon,Jamie,252–54,256DivineFury:AHistoryofGenius(McMahon),288–89n
![Page 1709: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1709.jpg)
Dogs,experimentson,171–73,187
Dorrance,Anson,254–58,262Dorsin,Neil,286nDropoutrates
college,11,230–32WestPoint,3–4,259
Drucker,Peter,124Duckworth,Angela
daughterAmanda,134,240,241,242,271
daughterLucy,87–88,134,223,240–41,242,271
fatherof,xiii–xv,96–97,98,107,159,167,277
GritScalescoresof,57
![Page 1710: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1710.jpg)
HardThingRuleand,241–42IQtestscoresof,34longitudinalstudyconductedby,230–32
MacArthurFellowshipawardedto,xiii–xiv
atMcKinsey,15,18,27–29motherof,167neurobiologyclassof,169–71neurosciencedegreeof,15psychologyofachievementtheoryof,40–42
purposeexperiencedby,157–59
teachingcareerof,15–20,117,157–59,177–78
![Page 1711: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1711.jpg)
TEDtalkof,133–35,220,244DuPont,86,97,245Durant,Kevin,121–22Dutton,Jane,166Dweck,Carol,178–81,183,184,192
Dyslexia,15,45
“Earlyyears,”107–8,144EDGE(EnhancingDiversityinGraduateEducation)Program,194
Education.SeealsoTeacherscollege,11,230–32dropoutratesin,11,230–32graduate-level,11,194
![Page 1712: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1712.jpg)
KIPPprogramand,181–83,245
talentvs.gritinacademicsuccess,15–20
EducationalTestingService(ETS),227
Effort,34,35–51academicsuccessand,17–18ambivalencetoward,23–25consistencyof,50deliberatepracticeand,127–28KIPPand,181musicalabilityand,23–24Nietzscheon,38–40swimmingand,36–39
![Page 1713: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1713.jpg)
talentandskillinteractionwith,42–44,50–51
TreadmillTestof,46–50,256writingand,44–46
Eisenberger,Robert,238–40Emulation(ofparents),214–16Encouragementandsupport
askingfor,193–95ofinterests,105–6,107,109–11
fromparents,207–10,211“EnergiesofMen,The”(James),22–23
Enigmatology,110Enron,30–31Entrepreneurship,24
![Page 1714: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1714.jpg)
Environmentalinfluences/experience,79–83,296n
Ericsson,Anders,118–21,124–31,135,138
Eskreis-Winkler,Lauren,138Eudaimonichappiness,146–47Eulogyvirtues,274Excessofgrit(lackofevidencefor),271–73
Experience.SeeEnvironmentalinfluences/experience
Extracurricularactivities,223–42benefittransfersfrom,238–40excessive,rarityof,225
![Page 1715: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1715.jpg)
follow-throughimportance,226–36
long-termbenefitsof,225low-incomechildrenand,236–38
Fame(film),71Faraday,Michael,75Farhi,Nicole,96Feedback,122–23,132,134,218–19
Feinberg,Mike,181Ferguson,Ron,218Field,Colin,96FinancialTimes,96
![Page 1716: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1716.jpg)
Finland,250–52,253Fitzsimmons,Bill,234–36Fixedmindset,180,181,183,184,185–86,190,191–92
“FleetingInterestinEverything,NoCareerDirection”(Redditpost),101
Flow,128–32,137Flynn,Jim,83–84,263Flynneffect,83–84,85,296–97nFonte,Aurora,161–62Fonte,Franco,161–62Football.SeeCarroll,Pete;SeattleSeahawks;Young,Steve
Fortunemagazine,27,30Fortune1000companies,183–84
![Page 1717: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1717.jpg)
Fragileperfects,190Franklin,Benjamin,123–24Freud,Sigmund,147
Gaines,Rowdy,38,100,103,107,121,132–33
Galloni,Antonio,145–46Galluppolls,98Galton,Francis,20–21,286–87nGardner,Margo,226Gates,Bill,230Gates,Melinda,230GatesFoundation.SeeBillandMelindaGatesFoundation
Gawande,Atul,124Gemmell,Bruce,136–37,141
![Page 1718: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1718.jpg)
Genetics,79–83,296nGenius,xiii–xiv,277,288–89nGervais,Mike,265–66Gettleman,Jeffrey,58–60,61,70,86
Gladwell,Malcolm,30Goalhierarchies,62–74,294n
abandoninglow-levelgoals,68–74
coherentgoalstructuresin,64–66
commonpurposeofgoalsin,68
conflictofgoalsin,65–66levelsofgoalsin,62–63prioritizinggoalsin,66–68
![Page 1719: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1719.jpg)
Goethe,JohannWolfgangvon,76Golden,Jane,112–13,145Goodness,273Google,166–67Graduate-leveleducation,11,194Graham,Martha,119,127,135GrammyAwards,46Grant,Adam,166,272Greatness,38,39–40,273GreenBerets,11–12,70GritGrid,231–32,235,237GritScale,9–14,54–58,77,78,131,194,272–73ageandscoreson,84–86developmentof,9–10fakeabilityof,229
![Page 1720: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1720.jpg)
happinesscorrelatedwithscoreson,270
oninterestconsistency,113purposecorrelatedwithscoreson,147–48
spellerstestedon,125takingandscoring,55–56TarHeelstestedon,255teacherstestedon,177twinstestedon,82WestPointcadetstestedon,9–10,54,259
Growthmindset,180–86,190,192,251benefitsassociatedwith,181languageimportancein,182
![Page 1721: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1721.jpg)
qualitiesassociatedwith,180rolemodeling,182–84
Habitformation,139–40HallofFame,63,226Happiness
eudaimonicvs.hedonic,146–47
gritcorrelatedwith,177,270–71
HardThingRule,241–42HarlemChildren’sZone,237–38HarvardUniversity,25,46–47,48,49,86,234,237,256
Haydn,Joseph,76
![Page 1722: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1722.jpg)
Hazing,258–59Hedonichappiness,146–47Height,nature-nurtureinteractionin,79–80,82–83
Hershey,Milton,190,312nHitler,Adolf,148Hoff,Syd,71Hootersrestaurant,163–64Hope,91–92,169–95,269
controland,188–90defined,169languageof,182mindsetand(seeFixedmindset;Growthmindset)
neurobiologyof,189optimismand(seeOptimism)
![Page 1723: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1723.jpg)
Hopkins,Mike,104–5“HowtoSolvetheNewYorkTimesCrosswordPuzzle”(Shortz),115
HowtoSpellLikeaChamp(Kimble),125
HowWeDoBusiness(JPMorganChasemanual),254
Hughes,Rhonda,193–95Humangenome,82
Identityandculture,247–50IlViaggioDiVetri(Vetri),106Imitation(ofparents),214–16IndianaUniversity,95,109–10In-groups,245
![Page 1724: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1724.jpg)
Intellectualdimensionofcharacter,273,274
Interest,95–116,269beginnersand,106–8,114benefitsoffollowing,97–98consistencyof,111–14constraintsonchoicesand,96–97,98
deepeningof,103,113–14,116,153
developmentof,103,104–6,107,115–16,153
discoveryof,103–4,107,114–15
expertsand,113–14exploring,100–101
![Page 1725: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1725.jpg)
playand,106–8inthree-phaseprogressionmodel,143
Interpersonaldimensionofcharacter,273,274
Intrapersonaldimensionofcharacter,273–74
IQ/intelligence,32,33author’sscoresontest,34ofhighachievers,75–76increasein,83–84,192,297nmindsetson,180ofspellingbeeparticipants,13,14
updatingbeliefson,192–93Irving,John,44–46,87
![Page 1726: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1726.jpg)
IvyLeagueundergraduates,14
James,William,22–23,98,116,140
JamesBeardAward,100Japan,118Jobcrafting,166–67JPMorganChase,252–54Julia&Julia(film),99JulliardSchoolofMusic,25,138Jürgen(mentor),217
Kagan,Jerry,5Kageyama,Noa,138Kaizen,118Kashyap,Anurag,14
![Page 1727: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1727.jpg)
Kaufman,ScottBarry,31–34Kimble,Paige,13,125King,Philip,157–58KIPP(KnowledgeIsPowerProgram),181–83,245
Kopp,Wendy,176–78
Lacey,Hester,95–96,104,118,175
LaGuardiaHighSchoolofMusicandArt,70–71
Lahti,Emilia,251–52LakesideSchool,88Lamennais,Hughes-Félicité-Robertde,76
LangLang,96
![Page 1728: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1728.jpg)
Language,importanceof,182,256,265
“Lateryears,”108,144Laughlin,Terry,140–41Leach,Bernard,105Leader,Joe,153Learnedhelplessness,171–73,188,193,240,309n
Learnedindustriousness,240Learnedoptimism,173LearningtoCartoon(Hoff),71Ledecky,Katie,133,136–37Leong,Deborah,141–42Levin,Dave,181,183Lifephilosophy,61–62,64Lomax,Michael,289–90n
![Page 1729: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1729.jpg)
Longitudinalstudiesonextracurricularactivities,225,226–29,230–32
oninterests,103–4,107onparentingimpact,213onpersonalitychange,86,233–34
LowellHighSchool,18–20Loyd,Sam,109Luong,David,18–20Luther,Martin,76Lütke,Tobi,217–18Lynch,Marshawn(“BeastMode”),264
![Page 1730: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1730.jpg)
MacArthurFellowship,xiii–xiv,275
MacKenzie,Warren,42–44,105Mackie,Susan,184Maier,Steve,171–73,178,188–90,200n,240
Mankoff,Bob,69,86March,James,248Martinez,Alex,207–10Martinez,Francesca,201,207–10,211,215
Martinez,Raoul,208Martinez,Tina,207–10Mathematics,16–20,117,193–95Matthews,Mike,6–7,9Maturityprinciple,86–89
![Page 1731: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1731.jpg)
Mazzini,Giuseppe,76McDonald,Duff,30McKinsey,58
author’scareerwith,15,18,27–29
talentemphasizedby,26–30McMahon,Darrin,288–89nMcNabb,Bill,185–87Meaney,Michael,296nMegasuccessfulpeople,96,104,118
Mentors,107,116,194,217MetLifeinsuranceagents,174–75Microsoft,230“Middleyears,”108,144Mill,JohnStuart,75
![Page 1732: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1732.jpg)
Milton,John,76MiltonHersheySchool,190,312nMindfulness,155–57Mindsets.SeeFixedmindset;Growthmindset
Mistakes,respondingto,141–42,183
MIT,220,221–22Montana,Joe,203MostValuablePlayeraward,202“MundanityofExcellence,The”(study),36
MuralArtsProgram,112,113Murat,Joachim,76Music,23–24,26,32–33Myelin,193
![Page 1733: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1733.jpg)
NASA,104–5“NastyNick”(obstaclecourse),12NationalBookAward,44Naturals,23–25,31,36,37,51Nature,192Neglectfulparenting,212NewEnglandPatriots,61,264Newton,Isaac,75,76NewYorkercartoons,68,69,71–74
NewYorkTimes,58,60,70,251NewYorkTimescrosswordpuzzle.SeeCrosswordpuzzledesign
NewZealand,233Nietzsche,Friedrich,38–40,187,199–200
![Page 1734: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1734.jpg)
Noe,Bernie,88–89Novelty,112,114,116NYCTransit,153
Oates,JoyceCarol,140Observer,207Oettingen,Gabriele,65Olympicsathletes,38,100,114
optimismand,175practiceand,118,121,132,133,138,140
Optimism,173–75,190,193growthmindsetand,181,192learned,173inteachers,176–78
Oscar,Daniel,286n
![Page 1735: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1735.jpg)
Outliers,20–21OutwardBound,187OxfordUniversity,15,58,59,60
Palin,Michael,96Parenting,199–222
authoritarian,200,203,211,212,213
child-centered,201,211contiuumofviewson,199–201
demandingstyle,201–7,211emulationbychildrenand,214–16
encouraging/supportive,207–10,211
![Page 1736: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1736.jpg)
neglectful,212bynon-parents,216–22patternsofsuccessful,210–13permissive,209,212,213wise(authoritative),211–16
Park,Daeun,183Parker,James,12Passion,8,56–60,61,64,68,261–62ageand,86consistencyofovertime,57–60
fostering,99–101geneticsandexperiencein,82GritScalemeasuresof,9,56–57,82
![Page 1737: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1737.jpg)
highachieverindicatorsof,77identityand,248,250intensitynotcorrelatedwith,57,60
interestand,91,95–101,103,116,143
practicalityvs.,96–97purposeand,91,143
Paunesku,Dave,166PeabodyConservatory,25Peanuts(comicstrip),140Permissiveparenting,209,212,213
Perseverance,56–57,91,261–62ageand,86flexibilityand,69–74
![Page 1738: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1738.jpg)
geneticsandexperiencein,82GritScalemeasuresof,9,57,82
highachieverindicatorsof,77identityand,248,250
Persistenceofmotive,77Personality
corresponsiveprincipleand,233–34,246
maturityprincipleand,86–89PersonalQualitiesProject,226–29,234–35
Pessimism,174–75,177,178,191–92
Phelps,Michael,37,38Pitt,William,76
![Page 1739: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1739.jpg)
Positivefantasizing,65PositivePsychology,40Post-itnoteexperiment,219Potential,14,22–23,51,236Potter’sBook,A(Leach),105Practice,91,117–42
deliberate(seeDeliberatepractice)
quantityoftimeand,118–20spelling,13,117,124–27,135–36,140
swimming,37,132–33inthree-phaseprogressionmodel,144
Prefrontalcortex,189PrincetonUniversity,95
![Page 1740: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1740.jpg)
PsychologicalCareofInfantandChild(Watson),200
PulitzerPrize,58Purpose,91,143–67,269
author’sexperiencewith,157–59
cultivatingasenseof,165–67defined,143happinessand,146–47originsof,162other-oriented,144–49,159–61,164–65
self-oriented,159–61inthree-phaseprogressionmodel,144
unpredictableroadsto,161–62
![Page 1741: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1741.jpg)
Putnam,Robert,236–37
Rasmussen,Mads,133,138Rats,experimentson,188–89,238–39,296n
Reddit,101,103Resiliencetraining,193,313nRésumévirtues,274ReverseFlynneffect,85Roberts,Brent,233Rolemodels
ofgrowthmindset,182–84parentsas,214–16ofpurpose,162–65,167
Roosevelt,Teddy,254Rushdie,Salman,96
![Page 1742: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1742.jpg)
Sales,10–11SanFrancisco49ers,202,203,243SAT,3,6,14,28,33,44,227,229,230,232,235
Schmidt,Roy,151–52Schneider,John,243Schofield,John,258Schofield’sDefinitionofDiscipline,258
Schultz,Charles,140Schwartz,Barry,102,272Science,22Scott,Alex,143,145ScrippsNationalSpellingBee,12–14,91,131,270
![Page 1743: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1743.jpg)
performance-improvingactivitiesfor,125
practicefor,13,117,124–27,135–36,140
verbalIQofparticipants,13,14
SeattleSeahawks,61,243–44,245,251,252,261–68competitionin,262–63,265–66
finishingstrongand,266languageof,265
Seaver,Tom,63–64,65Secretaries,152“SeeWhat’sPossible,andHelpOthersDotheSame”(Cole),165
![Page 1744: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1744.jpg)
Self-control,273,322nSelf-fulfillingprophecies,26,170Self-talk,175–76,193,310nSeligman,Marty,171–75,178,184
asauthor’sadvisor,40–41learnedhelplessnessexperimentsof,171–73,188,240
optimisticteachersstudiedby,176–77
Seurat,Georges,73Shaw,GeorgeBernard,257–58Sheldon,Ken,297nShopify,218Shortz,Will,95,96,99,108–10,111–12,115
![Page 1745: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1745.jpg)
Silvia,Paul,113–14Sisu,250–52,253“Sisu:AWordThatExplainsFinland”(Timesarticle),251
Skilldevelopment,42–44,50–51learningcurvefor,119threestagesof,107
Skilling,Jeff,30–31SmartestGuysintheRoom,The(documentary),30
Smith,Chantel,221,222Smith,Will,46,47,51Socialmultipliereffect,84,263SocietyforResearchonAdolescence,212
SpartanRace,319n
![Page 1746: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1746.jpg)
SpecialForcesSelectionCourse,12
Spectatormagazine,123Spellbound(documentary),12–14Spellingbees.SeeScrippsNationalSpellingBee
Spitz,Mark,38,39SportsIllustrated,268Stalin,Joseph,148StanfordUniversity,162,215,222,248
Steinberg,Larry,212–13Stretchgoal,121–23Strivers,24,26,31,36,50–51Summerbridgeprogram,157–59,167
![Page 1747: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1747.jpg)
SuperBowl,202,243,263–64SwarthmoreCollege,20,102Swimming
cultureof,245–47effortand,36–39geneticsandexperiencein,81optimismand,175practiceand,37,132–33
Talent,15–34,35–44,255academicsuccessand,15–20differencesin,31downsideofoveremphasizing,31,35,269
earlyliteratureon,20–23
![Page 1748: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1748.jpg)
effortinteractionwith,42–44,51
atEnron,30–31geneticsandexperiencein,80–81
inIvyLeagueundergraduates,14
KIPPviewof,181McKinsey’semphasison,26–30
musicalabilityand,23–24mythologizing,39Nietzscheon,39,40skillseparatedfrom,51spellingand,14swimmingand,36–39
![Page 1749: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1749.jpg)
testsfor,imperfectionof,34updatingbeliefson,192–93inWestPointcadets,9–10
TarHeels,UNC,254–58Teachers.SeealsoEducation
author’scareeras,15–20,117,157–59,177–78
impactoffeedbackfrom,218–19
optimismin,176–78TeachForAmerica(TFA),176–78,181
TEDtalks,124,133–35,220,238,244
Television,84,210Templeton,John,114
![Page 1750: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1750.jpg)
Ten-thousand-hour/ten-year-rule,119–20
Terkel,Studs,151TFA.SeeTeachForAmericaThomas,Earl,263Timemagazine,251,276Toughlove,211TreadmillTest,46–50,256Trojans,USC,262Tsay,Chia-Jung,23–26Twinstudies,81–82
UCLA,20Ultimateconcern,63,66,68,272UnitedKingdom,82
![Page 1751: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1751.jpg)
UnitedStatesMilitaryAcademyatWestPoint,3–7,90–91,270.SeealsoBeastBarracksadmissionsprocessfor,3cultureof,245,258–61dropoutratein,3–4,259GritScaleadministeredat,9–10,54,259
hazingat,258–59WholeCandidateScoreand,6,9,10
UniversityCollegeLondon,25UniversityofCalifornia,Berkeley,233
UniversityofHouston,238
![Page 1752: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1752.jpg)
UniversityofNorthCarolinaatChapelHill(UNC),254–58
UniversityofPennsylvania,155,190,191,237
UniversityofSouthernCalifornia(USC),262
Vaillant,George,47–48,49,86Values.SeeCorevaluesVanguard,185Vetri,Marc,100,103,105–6Voltaire,76
WarforTalent,The(Michaels,Hanfield-Jones,andAxelrod),26–27,29–30
![Page 1753: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1753.jpg)
“WarforTalent,The”(report),26Washington,George,76Watson,John,200,211,212Watson,Nora,151–52Watts,Alan,155WechslerAdultIntelligenceScale,83
WechslerIntelligenceScaleforChildren,83
West,Kanye,187WestPoint.SeeUnitedStatesMilitaryAcademyatWestPoint
WhartonSchoolofBusiness,53,86,159,191
Whatthe****IsNormal?!(Martinez),201
![Page 1754: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1754.jpg)
WholeCandidateScore(WestPoint),6,9,10
“Why?”questions,63,89Willingham,Dan,317nWillingham,Warren,226–30,231,234–35,317n
Wilson,Russell,264WinForever(Carroll),261–62WinterWar,250–51Wise(authoritative)parenting,211–16
Wooden,John,61,264Work
asacalling(seeCalling)careerchangesand,112corevaluesin,166–67
![Page 1755: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1755.jpg)
disengagementin,98lackofdirectionin,101–3passionfor,97–99,103
WorldAccordingtoGarp,The(Irving),44
Writing,44–46Wrzesniewski,Amy,149–50,152–53,155,166–67
XFactor,The(televisionprogram),31
YaleUniversity,31,149Yeager,David,160,166,218–19Young,LeGrande(“Grit”),202,203,204–7
![Page 1756: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1756.jpg)
Young,Mike,204Young,Sherry,204–6Young,Steve,201–7,210,211,215,226
Zookeepers,150
![Page 1757: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1757.jpg)
ScribnerAnImprintofSimon&Schuster,Inc.1230AvenueoftheAmericasNewYork,NY10020www.SimonandSchuster.com
Copyright©2016byAngelaDuckworth
Allrightsreserved,includingtherighttoreproducethisbookorportionsthereofinanyform
![Page 1758: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1758.jpg)
whatsoever.ForinformationaddressScribnerSubsidiaryRightsDepartment,1230AvenueoftheAmericas,NewYork,NY10020.
FirstScribnerhardcovereditionMay2016
SCRIBNERanddesignareregisteredtrademarksofTheGaleGroup,Inc.usedunderlicensebySimon&Schuster,Inc.,thepublisherofthiswork.
Forinformationaboutspecialdiscountsforbulkpurchases,
![Page 1759: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1759.jpg)
pleasecontactSimon&SchusterSpecialSalesat1-866-506-1949orbusiness@simonandschuster.com.
TheSimon&SchusterSpeakersBureaucanbringauthorstoyourliveevent.FormoreinformationortobookaneventcontacttheSimon&SchusterSpeakersBureauat1-866-248-3049orvisitourwebsiteatwww.simonspeakers.com.
InteriordesignbyJillPutortiJacketdesignbyPostTypography
![Page 1760: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1760.jpg)
LibraryofCongressCataloging-in-PublicationData
Names:Duckworth,Angela.Title:Grit:thepowerofpassionandperseverance/AngelaDuckworth.Description:NewYork:Scribner,2016.|Includesbibliographicalreferencesandindex.Identifiers:LCCN2015042880(print)|LCCN2015044753(ebook)Subjects:LCSH:Success|Perseverance(Ethics)|Expectation(Psychology)|Diligence.|BISAC:
![Page 1761: Grit: The Power of eons, we’ve been trapped inside the myth of … · 2020-03-17 · The admissions process for West Point is at least as rigorous as for the most selective universities](https://reader034.vdocuments.site/reader034/viewer/2022042414/5f2f0421bef76c47d141529e/html5/thumbnails/1761.jpg)
PSYCHOLOGY/Personality.|EDUCATION/ProfessionalDevelopment.Classification:LCCBF637.S8D6932016(print)|LCCBF637.S8(ebook)|DDC158.1—dc23
ISBN978-1-5011-1110-5ISBN978-1-5011-1112-9(ebook)