Transcript
Page 1: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

FLORIDA STATE SEMINOLES (6-1, 0-1 ACC)

VS PURDUE BOILERMAKERS (4-2, 0-0 BIG TEN)

CHAMPIONSHIP GAME / EMERALD COAST CLASSIC THE ARENA AT NORTHWEST FLORIDA STATE COLLEGE

NICEVILLE, FLORIDA SATURDAY, NOVEMBER 30, 2019; 7:00 P.M. (ET)

SEMINOLE IMG RADIO NETWORK (ERIC LUALLEN) CBS SPORTS NETWORK (BRAD JOHANSEN, STEVE LAPPAS, JUSTIN WALTERS)

“It’s not an oversight. It’s an insult. Florida State is clearly a top-25 team and has already beaten two SEC teams away from Tallahassee. The Seminoles are primed for another run in the NCAA Tournament.”

Jon Rothstein College Basketball Insider

CBS Sports / New York Times FLORIDA STATE TO PLAY FOR CHAMPIONSHIP OF EMERALD COAST CLASSIC Florida State, which defeated No 16/17 Tennessee, 60-57, in the semifinals of the Emerald Coast Classic on Friday night, will play Purdue in the championship game of the event on Saturday, November 30, 2019 at 7:00 ET at the Arena at Northwest Florida State College. The Seminoles will face Purdue for the second consecutive season after taking a 73-72 victory over the Boilermakers on November 28, 2018 in the 19th annual ACC/Big Ten Challenge in a game played in Tallahassee. Saturday’s game between the two teams marks the fourth meeting between the two teams – and just the second in a game not being played as part of the ACC/Big Ten Challenge. It also marks the first of two consecutive games the Seminoles will play against teams from the state of Indiana as Florida State travels to play at Indiana in the 20th Annual ACC/Big Ten on Tuesday night at Assembly Hall in Bloomington, Indiana. FLORIDA STATE VS. PURDUE – CONNECTIONS Florida State will play Purdue for the second consecutive season in the championship game of the Emerald Coast Classic. The Seminoles defeated the Boilermakers, 73-72, on a last-second lay-in by Trent Forrest in the ACC/Big Ten Challenge on November 28, 2018 at the Donald L. Tucker Center in Tallahassee. Florida State is 3-0 against Purdue in the all-time series between the two teams with wins during the 1974-75, 2005-06 and 2018-19 seasons. Florida State’s 69-66 win over the Boilermakers on Dec. 26, 1974 came in the first round of the Holiday Classic in Louisville, Ky. Matt Painter, the head coach of the Boilermakers since the start of the 2005-06 season, has faced the Seminoles twice – with Florida State defeating his first Purdue team in the ACC / Big Ten Challenge in 2005 and his 2018-19 team also in the ACC / Big Ten Challenge. Micah Shrewsberry, who is in his first season as the associate head coach at Purdue, was an assistant coach at Butler when the Bulldogs defeated the Seminoles on December 23, 2010 at the Wooden Classic in Indianapolis. Elliott Bloom, Purdue’s Director of Basketball Administration and Operations, was the sports information director for the Duke men’s basketball team in the ACC during the 2000-01 season. SEMINOLES WITH TWO VICTORIES OVER NATIONALLY RANKED TEAMS Florida State enters Saturday’s game against Purdue as one of three teams in the nation with two victories over nationally ranked teams in the first three weeks of the 2019-20 season. Only Florida State (No. 6 Florida and No. 16 Tennessee), Oregon (No. 13 Memphis and No. 13 Seton Hall) and Michigan (No. 6 North Carolina and No. 8 Gonzaga) have earned multiple wins over nationally ranked teams since the season began on November 5. Florida State has now defeated two ranked teams in the month of November for the first time in school history. HAMILTON WITH 18 WINS OVER NATIONLLY RANKED TEAM WHILE HIS TEAMS ARE UNRANKED With the Seminoles’ 60-57 victory over No. 16/17 Tennessee on Friday, Florida State’s Leonard Hamilton has now coached his teams (Oklahoma State, Miami and Florida State) to a national record 18 wins over nationally ranked teams when his teams enter the game as an unranked team. Both of Florida State’s wins over No. 6 Florida (63-51, November 6 in Gainesville) and No. 16/17 Tennessee (60-57, Nov. 29 in Niceville) have added to Hamilton’s totals as one of the top coaches in the game of college basketball. IN-SEASON TOURNAMENT CHAMPIONSHIP HISTORY Florida State has won 16 in-season tournament championships with its most recent title coming at the 2017 Jamaica Classic. The Seminoles also won the 2008 Global Sports Classic, the 2009 Old Spice Classic, and the 2012 Coaches vs. Cancer Classic to give 18th-year Head Coach Leonard Hamilton four tournament championships during his tenure at Florida State. LOOK FOR FLORIDA STATE TO… …Defeat Purdue and win the championship an in-season tournament for the 17th time in school history. The Seminoles most recently won the championship of the Jamaica Classic in November of 2017; …Defeat Purdue and win its fourth consecutive game against the Boilermakers. The Seminoles are 3-0 all-time against Purdue; …Defeat Purdue and win its seventh game of the season before the end of the month of November for the first time since finishing the month of November to begin the 2008-09 season with a 7-0 mark.

2019-20 Florida State Schedule/Results O22 1 Barry University W, 95-66 N1 1 Columbus State W, 84-54 N6 * at Pittsburgh L, 61-63 N10 at Florida W, 63-51 N15 Western Carolina W, 79-74 N20 2 Chattanooga W, 89-53 N23 Saint Francis (Pa.) W, 80-65 N25 2 Chicago State W, 113-56 N29 3 vs. Tennessee W, 60-57 N30 3 vs. Purdue 7:00 p.m. D3 at Indiana 9:00 p.m. D8 * Clemson 2:00 p.m. D17 North Florida 8:30 p.m. D21 USF 12 Noon D28 North Alabama 2:00 p.m. D31 * Georgia Tech 12 Noon J4 * at Louisville 2:00 p.m. J8 * at Wake Forest 7:30 p.m. J15 * Virginia 7:00 p.m. J18 * at Miami 12 Noon J25 * Notre Dame 8:00 p.m. J28 * at Virginia 7:00 p.m. F1 * at Virginia Tech 4:00 p.m. F3 * North Carolina 7:00 p.m. F8 * Miami 12 Noon F10 * at Duke 7:00 p.m. F15 * Syracuse 12 Noon F18 * Pittsburgh 8:00 p.m. F22 * at NC State 4::00 p.m. F24 * Louisville 7:00 p.m. F29 * at Clemson 2:00 p.m. M4 * at Notre Dame 9:00 p.m. M7 * Boston College 4:30 p.m. M ACC Tournament TBA Greensboro, N.C. *ACC Game 1 Exhibition Game; 2 Emerald Coast Classic at Tallahassee, Fla.; 3 Emerald Coast Classic at Northwest Florida State College, Niceville, Fla.; 4 ACC/Big Ten Challenge at Bloomington, Ind.; 5 Metro by T-Mobile Orange Bowl Basketball Classic at BB&T Center, Sunrise, Fla.; 6 ACC Tournament at Greensboro Coliseum, Greensboro, N.C.

2018-19 ACC Standings

Team W L Pct. W L Pct. Virginia 16 2 .889 34 3 .919 N. Carolina 16 2 .889 29 7 .806 Duke 14 4 .778 32 6 .842 Florida State 13 5 .722 29 8 .784 Virginia Tech 12 6 .667 27 9 .750 Louisville 10 8 .556 20 14 .588 Syracuse 10 8 .556 20 14 .588 NC State 9 9 .500 24 11 .686 Clemson 9 9 .500 20 14 .588 Georgia Tech 6 12 .333 14 18 .438 Boston College 5 13 .278 14 17 .452 Miami 5 13 .278 14 19 .424 Wake Forest 4 14 .222 11 20 .355 Pittsburgh 3 15 .167 14 19 .424 Notre Dame 3 15 .167 14 19 .424

Leonard Hamilton’s Career Record W L Pct. Years Career 540 427 .558 1987-Pr. at Okla. State 56 63 .471 1987-90 at Miami 144 147 .495 1991-00 at Florida State 340 217 .610 2002-Pr.

Page 2: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

A QUICK REVIEW OF THE 2018-29 SEASON Florida State enjoyed one of the greatest seasons in school history in 2018-19 as it played in its third consecutive NCAA Tournament, advanced to the Sweet 16 of the NCAA Tournament for the school-record tying second consecutive season, finished the season ranked 10th nationally, advanced to the championship game of the ACC Tournament, finished fourth in the ACC standings and defeated six nationally ranked teams. Florida State won a program record 29 games and earned a school-record 13 ACC wins, finishing fourth in the best conference for college basketball in the country. The Seminoles defeated Virginia, who won the National Championship, in the semifinals of the ACC Tournament to reach the championship game of the ACC Tournament for the third time in school history. FLORIDA STATE NATIONALLY IN THE LAST TWO SEASONS The Seminoles are one of seven teams in the nation (Florida State, Duke, Gonzaga, Kentucky, Michigan, Purdue and Texas Tech) who have advanced at least as far as the Sweet 16 of the NCAA Tournament in both of the last two seasons. The Seminoles advanced to the Elite Eight in 2018 and to the Sweet 16 in 2019. HAMILTON MOVES CLOSER TO SIXTH WINNINGEST COACH IN ACC HISTORY With 340 career victories during his tenure at Florida State, 18th-year Head Coach Leonard Hamilton enters the Seminoles’ game against Saint Francis on Saturday as the seventh all-time winningest coach in ACC history. He needs only nine wins to move into sixth place in ACC history (passing Maryland’s Lefty Driesell) and only 10 wins to become just the sixth coach in the illustrious history of the nation’s best basketball conference to win 350 career games. Hamilton In ACC History Rank Coach, School Career Wins 1. Mike Krzyzewski, Duke 1,059 2. Dean Smith, North Carolina 879 3. Gary Williams, Maryland 461 5. Bobby Cremins, Georgia Tech 354 6. Lefty Driesell, Maryland 348 7. Leonard Hamilton, Florida State 340 THE LAST TEAM TO BEAT VIRGINIA Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January 22, 2019, is the last team to beat defending national champion Virginia. The Seminoles topped the Cavaliers, 69-59, in the semifinals of the 2019 ACC Tournament in Charlotte to advance to the ACC Tournament Championship game for the third time in school history. SEMINOLES HOLD TENNESSEE TO SEASON-LOW FIELD GOAL PERCENTAGE Florida State held Tennessee to a season-low .361 field goal shooting percentage and to nearly 17 points scored below its season scoring average in its 60-57 victory over the Vols on Friday in the semifinals of the Emerald Coast Classic. The Seminoles have now held six of its first seven opponents under 40 percent shooting from the field and to an average of 59.9 points per game. The Seminoles’ defense has held four of its seven opponents under 60 points scored and limited its seven opponents to an average of 59.9 points scored per game. Seminoles Hold Opponents Below 40 Percent Shooting Opponent FGM FGA Pct. Points Allowed Score at Pitt 16 51 .314 63 Pitt, 63-61 at No. 6 Florida 14 50 .280 51 FSU, 63-51 Western Carolina 27 60 .450 74 FSU, 79-74 Chattanooga 23 59 .390 53 FSU, 89-53 Saint Francis 20 54 .370 65 FSU, 80-65 Chicago State 19 52 .365 56 FSU, 113-56 No. 16 Tennessee 14 42 .333 57 FSU, 60-57 Totals 133 368 .361 419/59.9 FSU, 6-1 FLORIDA STATE ON A TORRID STEALS PACE Led by three steals each by redshirt sophomore Malik Osborne and sophomore Devin Vassell, the Seminoles totaled 13 steals and earned 23 points off 21 Tennessee turnovers in their win over the Vols on Friday night. It marked the fourth consecutive game the Seminoles had totaled 10 or more steals in a game – they enter Saturday’s game against Purdue with an 8.9 steals per game average in their first seven games of the season. Seminoles Stealing Opponent Steals Pts/TO Notes Chattanooga 10 23 Florida State with 7 second half steals Saint Francis 11 21 Florida State 9 with second half steals Chicago State 13 37 Florida State with 7 second half steals Tennessee 13 23 Florida State with 5 second half steals Totals/Averages 47/11.8 104/26.0 Florida State averages 8.9 spg in first 7 games VASSELL IN DOUBLE FIGURES FOR SIXTH TIME IN FIRST SEVEN GAMES Sophomore Devin Vassell who enters Saturday’s game against Purdue as the Seminoles’ leading scorer with a career-high 12.4 points per game scoring average, has scored in double figures in six of the first seven games of the 2019-20 season. His team-high 13 points marked his single-season career-high sixth time scoring in double figures this season – one more game than he scored in double figures as a freshman (five). FORREST MOVES INTO 10TH PLACE FOR CAREER ASSISTS Senior Trent Forrest totaled four assists in Florida State’s victory over Tennessee and move into sole possession of 10th place in school history with 363 career assists. He is ranked ninth in school history with 176 career steals and is now one of just four players in school history ranked in the top 10 in school history in both assists and steals

Florida State Basketball / National Polls

ASSOCIATED PRESS POLL Rk. Team 19-20 Rec. 1. Duke (53) 6-0 2. Louisville (7) 6-0 3. Michigan State (4) 3-1 4. Kansas 3-1 5. Maryland 5-0 6. North Carolina 4-0 7. Virginia (1) 6-0 8. Gonzaga 6-0 9. Kentucky 5-1 10. Ohio State 5-0 11. Oregon 5-0 12. Texas Tech 5-0 13. Seton Hall 4-1 14. Arizona 6-0 15. Utah State 7-0 16. Memphis 5-1 17. Tennessee 4-0 18. Auburn 5-0 19. Baylor 5-1 20. VCU 5-0 21. Colorado 4-0 22. Villanova 4-2 23. Washington 5-1 24. Florida 5-2 25. Xavier 6-1

ARV – Florida State (26th place)

USA TODAY POLL Rk. Team Points 1. Duke (27) 766 2. Louisville (1) 728 3. Michigan State (1) 689 4. North Carolina 640 5. Kansas 637 6. Virginia 628 7. Gonzaga 576 8. Maryland (1) 572 9. Ohio State (1) 524 10. Oregon 471 11. Kentucky 454 12. Texas Tech 430 13. Seton Hall 378 14. Arizona 365 15. Utah State 296 16. Tennessee 276 17. Auburn 255 18. Baylor 223 19. VCU 213 20. Memphis 163 21. Villanova 147 22. Washington 108 23. Xavier 96 24. Colorado 76 25. Florida 71

ARV – Florida State (29h place)

ACC Operation Basketball (Oct. 8, 2019) 1. Duke (51) 1564 2. North Carolina (19) 1493 3. Louisville (29) 1448 4. Virginia (12) 1405 5. Florida State 1157 6. NC State 1038 7. Notre Dame 915 8. Syracuse 910 9. Miami 768 10. Pitt 577 11. Clemson 564 12. Georgia Tech 437 13. Boston College 382 14. Virginia Tech 334 15. Wake Forest 328

Page 3: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

POSSIBLE STARTING LINEUP FOR FLORIDA STATE… F #10 Malik Osborne (6.8 ppg and 5.7 rpg; First career game against Purdue C #15 Dominik Olejniczak (4.4 ppg and 2.6 rpg; First career game against Purdue) G #3 Trent Forrest (12.2 ppg and 4.7 apg; 9 pts and 1 reb vs. Purdue, November 28, 2018) G #23 M.J. Walker (11.3 ppg and 4.0 rpg; 13 pts and 1 ast vs. Purdue November 28, 2018 G #24 Devin Vassell (12.3 ppg and 4.0 rpg; 3 pts and 1 reb vs. Purdue, November 28, 2018) …AND TOP RESERVES G #2 Anthony Polite (6.0 ppg and 3.3 rpg; 0 pts and 0 rebs vs. Purdue, November 28, 2018) G #31 Wyatt Wilkes (4.5 ppg and 1.5 rpg; 0 pts and 0 rebs vs. Purdue, November 28, 2018) F #1 RaiQuan Gray (6.0 ppg and 4.3 rpg; 7 pts and 1 stl vs. Purdue, November 28, 2018) F #4 Patrick Williams (10.8 ppg and 3.8 rpg; First career game against Purdue) G #11 Nathanael Jack (5.8 ppg and 2.0 rpg; First career game against Purdue) F #30 Harrison Prieto (0.5 ppg and 1.0 rpg; First career game against Purdue G #0 RayQuan Evans (4.0 ppg and 2.3 apg; First career game against Purdue) C #5 Balsa Koprivica (6.5 ppg, 3.3 rpg; First career game against Purdue) POSSIBLE STARTING LINEUP FOR PURDUE F #1 Aaron Wheeler (6.8 ppg, 7.0 rpg: 0 pts and 0 rebs vs. Florida State, November 28, 2018) C #32 Matt Haarms (11.0 ppg, 6.2 rpg; 6 pts and 5 rebs vs. Florida State, November 28, 2018) G #2 Eric Hunter, Jr. (10.3 ppg, 3.3 rpg; 0 pts and 0 rebs vs. Florida State, November 28, 2019) G #3 Jahaad Proctor (15.0 ppg, 3.0 apg; First career game against Florida State) G #20 Nojel Eastern (4.3 ppg, 3.0 apg; 4 pts and 5 rebs vs. Florida State, November 28, 2019) FLORIDA STATE VS. PURDUE -- A SERIES HISTORY The Series: Florida State leads, 3-0 First Game: December 26, 1974; Florida State 69, Purdue 66 Last Game: November 28, 2018; at Florida State 73, Purdue 72 Last Florida State Win: November 28, 2018; at Florida State 73, Purdue 72 Last Purdue Win: None Last Florida State Win on a Neutral Court: December 26, 1974; Florida State 92, Purdue 62 Last Purdue Win in a Neutral Court: None Current Streak: Florida State has won 3 Current Streak on a Neutral Court: Florida State has won 1 FLORIDA STATE VS. PURDUE – THE LAST THREE GAMES Nov 28, 2018 Nov, 29, 2005 Dec. 26, 1974 at Florida State 73 at Florida State 97 Florida State 69 Purdue 72 Purdue 57 Purdue 66 FLORIDA STATE VS. PURDUE – THE LAST GAME Trent Forrest didn’t have a point, rebound or assist in the second half. Not until the game was on the line and he made all the plays Florida State needed. Forrest forced a turnover with 16 seconds left and, after a timeout, drove the lane to hit a pull-up jumper with 5.2 seconds remaining as the No. 15 Seminoles stormed back to beat No. 19 Purdue 73-72 on November 28, 2018 at the Donald L. Tucker Center in Tallahassee. The junior point guard also had a steal in the final seconds to wrap up the win. The plays were part of a critical sequence as the Seminoles held on after Purdue led by eight points with 3:43 left. Purdue didn’t score after holding that 72-65 lead. That included a pair of missed free-throw attempts by Carsen Edwards, who led the Boilermakers with 24 points on 7 of 19 shooting. Ryan Cline added 21 points, including four 3-pointers after halftime, for Purdue. Cline made 7 of 11 3-pointers as Purdue rallied from a 16-point deficit late in the first half. Edwards gave Purdue the lead again, 52-51, on a 3-pointer with 13:37 to go. The Boilermakers held the lead up until Forrest’s shot in the final seconds. TONIGHT’S OFFICIALS Tonight’s referees will be assigned by the Emerald Coast Classic officials prior to the game. 2018-19 FLORIDA STATE ROSTER No. Name Pos. Ht. Wt. Yr. Hometown 0 RayQuan Evans G 6-4 210 Jr. Billings, Mont./North Idaho College 1 RaiQuan Gray F 6-8 260 RSo. Ft. Lauderdale, Fla./Dillard 2 Anthony Polite G 6-6 215 RSo. Lugano, Switzerland/St. Andrews Christian School (Fla.) 3 Trent Forrest G 6-5 210 Jr. Chipley, Fla./Chipley 4 Patrick Williams F 6-8 225 Fr. Charlotte, N.C./West Charlotte 5 Balsa Koprivica C 7-1 260 Fr. Belgrade, Serbia/Montverde Academy 10 Malik Osborne F 6-9 215 So. Matteson. Ill./Bosco Institute/Rice 11 Nathanael Jack G 6-5 195 Jr. Mississauga, Ontario, Canada/Eastern Florida State 12 Justin Lindner G 6-1 180 RJr. Memphis, Tenn./Christian Brothers 15 Dominik Olejniczak C 7-0 260 Gr. Tourn, Poland/Ole Miss/Drake 20 Travis Light G 6-5 175 RJr. Vienna, Va./IMG Academy 23 M.J. Walker G/F 6-5 213 Jr. Riverdale, Ga./Jonesboro 24 Devin Vassell G 6-6 180 So. Suwanee, Ga./Peachtree Ridge 30 Harrison Prieto F 6-8 230 RJr. Mandeville, La./St. Paul’s School 31 Wyatt Wilkes F 6-8 220 RSo. Orlando, Fla./Winter Park 33 Will Miles G 6-6 220 RJr. Orlando, Fla./Trinity Prep 42 Cleveland Yates G 6-2 214 Fr. Memphis, Tenn./Briarcrest Christian School 44 Ty Hands G 6-5 180 RFr. West Palm Beach, Fla./Palm Beach Lakes PRONUNCIATION GUIDE: RayQuan Evans (RAY-Qwan); RaiQuan Gray (RAY-Qwan); Balsa Koprivica (Ball-Sha Ko-Pra-Vizza); Dominik Olejniczak (DOM-a-nick Ole’-knee-CHUCK); Devin Vassell (Dev-in Vuh-SELL - like Sam Cassell with a V).

Florida State Men’s Basketball Upcoming Milestones

Leonard Hamilton

Victories as an ACC Coach 340 (Career at Florida State)

+9 (Needs) 349

To Become the 6th Winningest Coach in ACC History (all victories)

Leonard Hamilton

ACC Victories at Florida State (Regular Season + ACC Tourn.)

151 (career at Florida State) +10 (Needs)

161 To Become the 5th Winningest Coach in ACC

history (ACC games) – surpassing Frank McGuire of North Carolina and

South Carolina

Leonard Hamilton Wins vs. AP No. 1 In Career 4 (career at Florida State)

+4 (Needs) To move into a tie for first place college

basketball history with Roy Williams for all-time wins vs. the nation’s No. 1 ranked

team

Trent Forrest Career Steals

176 (career at Florida State) +5 (Needs)

181 To move into 8th place for career steals in

school history passing Chris Singleton (2009-11)

Trent Forrest Career Assists

363 (career at Florida State) +39 (Needs)

391 To move into 9thth place in school history

for career assists passing Luke Loucks (2009-12)

Trent Forrest Career Points

866 (career at Florida State) +134 (needs)

1,000 To become the 49th player in school history

to school 1,000 or more career points

M.J. Walker Career 3-Point Field Goals Made

90 (career at Florida State) +10 (needs)

100 To become the 23rd player at Florida State with 100 or more career 3-point field goals

made

M.J. Walker Career 3-Point Field Goals Made

90 (career at Florida State) +4 (needs)

To move into 23rd place in school in school history with 94 career 3-point field goals

made passing Aubrey Boyd (1988-91), Michael Joiner (2001-04) and Todd

Galloway (2003-06)

Page 4: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

2019-20 Florida St. Men's BasketballCombined Team Statistics

All gamesPage 1/1

as of Nov 30, 2019

Game RecordsRecord Overall Home Away NeutralALL GAMES 6-1 4-0 1-1 1-0CONFERENCE 0-1 0-0 0-1 0-0NON-CONFERENCE 6-0 4-0 1-0 1-0

Score by PeriodsTeam 1st 2nd OT TOTFlorida St. 269 276 0 545Opponents 207 212 0 419

Team Box Score

No. PlayerTotal 3-Point F-Throw Rebounds

GP-GS MIN AVG FG-FGA FG% 3FG-FGA 3FG% FT-FTA FT% OFF DEF TOT AVG PF DQ A TO BLK STL PTS AVG24 VASSELL, Devin 7-7 173:01 24.7 32-61 .525 8-19 .421 15-21 .714 11 18 29 4.1 13 0 6 4 4 10 87 12.403 FORREST, Trent 7-7 206:16 29.5 27-68 .397 5-13 .385 23-28 .821 5 22 27 3.9 11 0 32 27 4 11 82 11.723 WALKER, M.J. 4-4 99:14 24.8 11-35 .314 5-16 .313 17-22 .773 1 14 15 3.8 11 0 5 4 1 1 44 11.0

4 WILLIAMS, Patrick 7-0 146:06 20.9 26-46 .565 4-11 .364 17-18 .944 6 19 25 3.6 7 0 7 12 5 6 73 10.45 KOPRIVICA, Balsa 7-0 92:29 13.2 18-22 .818 0-0 .000 11-16 .688 10 13 23 3.3 16 1 1 7 2 4 47 6.7

10 OSBORNE, Malik 7-7 149:45 21.4 17-33 .515 5-11 .455 6-10 .600 13 27 40 5.7 16 1 4 4 7 4 45 6.411 JACK, Nathanael 4-0 40:19 10.1 7-16 .438 7-16 .438 2-2 1.000 1 7 8 2.0 5 0 5 3 0 1 23 5.813 POLITE, Anthony 7-3 154:02 22.0 12-36 .333 7-22 .318 7-8 .875 3 18 21 3.0 7 0 8 13 3 13 38 5.401 GRAY, RaiQuan 5-3 101:36 20.3 7-21 .333 1-8 .125 11-14 .786 5 12 17 3.4 11 1 6 8 2 2 26 5.215 OLEJNICZAK, Dominik 6-3 62:12 10.4 10-17 .588 0-0 .000 4-4 1.000 10 7 17 2.8 14 0 0 5 3 2 24 4.031 WILKES, Wyatt 7-1 68:50 9.8 9-22 .409 6-19 .316 3-3 1.000 4 5 9 1.3 5 0 4 2 1 3 27 3.9

0 EVANS, RayQuan 5-0 62:23 12.5 5-14 .357 0-3 .000 8-10 .800 1 1 2 0.4 6 0 9 3 0 5 18 3.612 LINDNER, Justin 3-0 09:51 3.3 1-1 1.000 0-0 .000 2-2 1.000 0 3 3 1.0 2 0 2 3 0 0 4 1.320 LIGHT, Travis 3-0 07:37 2.5 1-2 .500 1-2 .500 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 3 1.033 MILES, Will 3-0 07:37 2.5 1-3 .333 0-0 .000 0-0 .000 1 0 1 0.3 2 0 1 1 0 0 2 0.730 PRIETO, Harrison 4-0 15:10 3.8 1-3 .333 0-1 .000 0-2 .000 1 3 4 1.0 2 0 0 0 0 0 2 0.542 YATES, Cleveland 3-0 03:31 1.2 0-0 .000 0-0 .000 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 0 0.0Team 6 10 16Total 7 1400 185-400 .463 49-141 .348 126-160 .788 78 179 257 36.7 128 3 90 96 32 62 545 77.9Opponents 7 1400 133-368 .361 44-153 .288 109-147 .741 72 145 217 31.0 134 - 52 123 21 38 419 59.9

Team StatisticsFSU OPP

Scoring 545 419Points per game 77.9 59.9Scoring margin +18.0 -

Field goals-att 185-400 133-368Field goal pct .463 .361

3 point fg-att 49-141 44-1533-point FG pct .348 .2883-pt FG made per game 7.0 6.3

Free throws-att 126-160 109-147Free throw pct .788 .741F-Throws made per game 18.0 15.6

Rebounds 257 217Rebounds per game 36.7 31.0Rebounding margin +5.7 -

Assists 90 52Assists per game 12.9 7.4

Turnovers 96 123Turnovers per game 13.7 17.6Turnover margin +3.9 -Assist/turnover ratio 0.9 0.4

Steals 62 38Steals per game 8.9 5.4

Blocks 32 21Blocks per game 4.6 3.0

Winning streak 6 -Home win streak 4 -

Attendance 30759 19867Home games-Avg/Game 4-7690 2-9934Neutral site-Avg/Game - 1-2500

Team ResultsDate Opponent Score Att.11/06/2019 at Pittsburgh L 61-63 901611/10/2019 at Florida W 63-51 1085111/15/2019 Western Caro. W 79-74 949011/20/2019 Chattanooga W 89-53 757211/23/2019 Saint Francis (PA) W 80-65 759511/25/2019 Chicago St. W 113-56 610211/29/2019 vs Tennessee W 60-57 2500

Page 5: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

GuardRayQuan Evans#0

RayQuan Evans’ Career High’sPTS ........... 6 vs. Saint Francis (11-23-19)FGM ......... 2 vs. Chicago State (11-25-19)...................2 vs. Saint Francis (11-23-19)FGA .......... 5 vs. Saint Francis (11-23-19)FG% ......... .500 vs. Chicago State (11-25-19)3FGM .......3FGA ........ 2 vs. Chicago State (11-25-19)3FG% .......FTM .......... 4 vs. Chattanooga (11-20-19)FTA ........... 6 vs. Chattanooga (11-20-19)FT% ......... 1.000 vs. Saint Francis (11-23-19)OR.............1 vs. Saint Francis (11-23-19)DR .............1 vs. Saint Francis (11-23-19)REBS ........2 vs. Saint Francis (11-23-19)AST ...........5 vs. Saint Francis (11-23-19)BLK ..........STL ........... 4 vs. Chattanooga (11-20-19)MIN ..........22 vs. Chicago State (11-25-19)underlined denotes career high established or tied during the 2019-20 season

6-4, 210, Junior, Billings, Montana

2019-20 Season* Expected to play a big role in the Seminoles’ rotation at the point guard position.* One of two junior college transfers (also Nathanael Jack) in the expected to contribute to the Seminoles’ success.* Made his Florida State debut 3 minutes played in Florida State’s victory over Western Carolina* Extended playing time against Chattanooga with 4 points and 4 steals in 13 minutes of play* Totaled 6 points, 5 assists and 2 rebounds in Florida State’s victory at home against Saint Francis* Totaled 6 points, 2 assists and 1 steal in Florida State’s victory over Chicago State in Tallahassee

At North Idaho* Graduated from North Idaho College in 2019 with an Associate’s Degree in Graphic Design.* Recognized as the Northwest Athletic Conference Male Basketball Athlete of the Year in 2019.* Named to the All-East Region Defensive Team and as the East Region MVP in 2019.* LedtheCardinalstoatwo-yearcombinedrecordof56-10;theyfinishedwithacombined27-5overallrecord in NWAC play including a perfect 16-0 record during the 2018-19 season.* Averaged18.2points,7.4reboundsand4.9assistsinleadingNorthIdahotoitssecondconsecutive Northwest Athletic Conference championship in 2019.

On Evans* His dad played basketball at the University of Montana. He played two seasons as a forward at Montana. (1993 and 1994). He averaged 9.1 points, 4.2 rebounds, 0.9 steals and 0.3 blocked during his career* Has three brothers – Tray, Tye and Cam.* Originally from (and born in) Georgetown, S.C. Moved to Montana to begin his freshman year of high school.

2019-20 Game-By-Game Statistics -- RaiQuan EvansDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina 1-0 3 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N20 Chattanooga 2-0 13 0-1 .000 0-0 .000 4-6 .667 0-0 0 0 2 1 0 4 4N23 St. Francis (Pa.) 3-0 17 2-5 .400 0-1 .000 2-2 1.000 1-1 2 1 5 0 0 0 6N25 Chicago State 4-0 22 2-4 .500 0-2 .000 2-2 1.000 0-0 0 3 2 2 0 1 6N29 vs.Tennessee 5-0 7 1-4 .250 0-0 .000 0-0 .000 0-0 0 2 0 0 0 0 2N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

2RayQuan Evans averaged 18.2points,7.4reboundsand 4.9 assists in leading North Idaho College to its second consecutive North-west Athletic Conference championship in 2019.

Page 6: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- RaiQuan GrayDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 27 3-6 .500 0-2 .000 1-2 .500 2-1 3 5 2 1 0 0 7N10 atFlorida 2-2 24 1-5 .200 1-3 .333 4-6 .667 0-5 5 1 2 1 0 1 7N15 Western Carolina 3-3 17 1-4 .250 0-1 .000 2-2 1.000 1-1 2 1 1 2 1 0 4N20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State 4-3 16 1-3 .333 0-2 .000 4-4 1.000 2-5 7 3 1 2 0 1 6N29 vs. Tennessee 5-3 18 1-3 .333 0-0 .000 0-0 .000 0-0 0 1 0 1 1 0 2N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

RaiQuan Gray’s Career HighsPTS ........... 11 vs. Murray State (3-23-19)FGM ......... 3 vs. 6 teams...................Last at Pitt (11-6-19)FGA .......... 9 vs. Vermont (3-21-19)FG% ......... 1.000 vs. 3 Teams...................Last at Wake Forest (3-9-19)3FGM ....... 3 vs. Murray State (3-23-19)3FGA ........ 4 vs. Murray State (3-23-19)3FG% ....... 1.000 at North Carolina (2-23-19)FTM .......... 4 vs. 5 Teams...................Last vs. Chicago State (11-25-19)FTA ........... 6 at Florida (11-10-19)FT% ......... 1.000 vs. 6 Teams...................Last vs. Chicago State (11-25-19)OR.............2 vs. 6 teams ...................Last vs. Chicago State (11-25-19)DR .............6 vs. Gonzaga (3-28-19)REBS ........7vs.ChicagoState(11-25-19)AST ...........3 vs. Miami (1-9-19)BLK .......... 1 vs. 8 Teams...................Last vs. Tennessee (11-29-19)STL ........... 5 vs. Murray State (3-23-19)MIN ..........27atPitt(11-6-19)underlined denotes career high established or tied during the 2019-20 season

6-8, 260, Redshirt-Sophomore, Ft. Lauderdale, Fla.

#1 RaiQuan Gray Forward

2019-20 Season* One of three Seminoles with experience as a starter who is expected to play a large part in the Seminoles’ fortunes.* Astarterwith7pointsand3reboundsatPittinFloridaState’sseasonopener* Totaled7points,5reboundsand2assistsinFloridaState’svictoryoverNo.6FloridainGanesville* Scored6pointsandpulleddownacareer-high7reboundsinFloridaState’svictoryoverChicagoSt.inTallahassee

2018-19 Season* Averaged3.9points(10thontheteam),2.3rebounds(sixth),0.8steals(third)andshot.721fromthefreethrow. line(seventh)asheplayedin36ofFloridaState’s37gamesinleadingtheSeminolestotheSweet16oftheNCAA Tournament.* AstarterduringtheregularseasoninFloridaState’svictoryoverSoutheastMissouriState(Dec.17)andinthe Seminoles’ NCAA Tournament games against Vermont (March 21), Murray State (March 23) and Gonzaga (March 28) in the Sweet 16.* AnintegralpartofFloridaState’srecord-setting2018-19seasonastheSeminolesfinishedwitha28-9record,a 13-5 record in ACC play, in fourth place in the ACC standings, with their third appearance in school history in the ACC Tournament Championship game and a second consecutive appearance in the Sweet 16 of the NCAA Tournament.* Totaled his career-high of 11 points in Florida State’s second round NCAA Tournament game victory over Murray State at the XL Center in Hartford, Conn…his 11 points came in a starters role during which he played his career- high of 24 minutes.

2017-18 Season* A redshirt season. He did not appear in any games during the regular season.* Averaged 8.5 points and 4.5 rebounds in Florida State’s pair of exhibition games wins to begin the season.

On Gray* GraduatedfromDillardHighSchoolin2017* As a senior he led Dillard to a 28-5 record overall while averaging a double-double of 16 points and 12 rebounds.* HelpedthePanthersfinish28-4andnationallyranked20thbyMaxPreps.* Was recognized by MaxPreps as a part of the Tour of Champions nationally ranked teams.* Selectedasamemberofthe2016and2017All-BrowardCountyFirst-TeambytheMiamiHerald.

4/3RaiQuan Gray started four games as a redshirt fresh-man -- one in the regular season against Southeast Missouri State and three

in the NCAA Tournament against Vermont, Murray

State and Gonzaga

Page 7: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Anthony PoliteDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 23 2-10 .200 2-6 .333 2-2 1.000 1-3 4 3 0 3 0 1 8N10 atFlorida 2-0 18 2-3 .667 1-1 1.000 2-2 1.000 0-2 2 1 0 1 1 1 7N15 Western Carolina 3-0 24 1-4 .250 1-4 .250 0-0 .000 0-2 2 0 1 2 1 2 3N20 Chattanooga 4-1 25 0-4 .000 0-3 .000 1-2 .500 0-2 2 1 0 1 0 0 1N23 St. Francis (Pa.) 5-2 29 3-6 .500 2-4 .500 0-0 .000 1-6 7 0 2 5 1 5 8N25 Chicago State 6-3 15 3-4 .750 1-1 1.000 2-2 1.000 2-2 4 0 5 0 0 3 9N29 vs.Tennessee 7-3 17 1-5 .200 0-3 .000 0-0 .000 0-1 1 2 0 0 0 1 2N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Anthony Polite’s Career HighsPTS ........... 9 vs. Chicago State (11-25-19) ...................9 vs. Murray State (3-23-19)...................9 vs. Canisius (11-19-18)FGM ......... 3 vs. 4 teams...................Last vs. Chicago State (11-25-19)FGA ..........7vs.Winthrop(1-1-19)FG% ......... 1.000 vs. Wake Forest (2-13-19)3FGM ....... 2 vs. 4 teams...................Last vs. Saint Francis (11-23-19)3FGA ........ 6 vs. LSU (11-23-18)3FG% ....... 1.000 vs. Murray State (3-23-19)FTM .......... 4 vs. Canisius (11-19-18)FTA ........... 4 vs. Canisius (11-19-18)................... 4 vs. Florida (11-6-18)FT% ......... 1.000 vs. 8 teams...................Last vs. Chicago State (11-25-19)OR.............4 vs. Troy (12-3-18)DR .............6 vs. Saint Francis (11-23-19)REBS ........7vs.SaintFrancis(11-23-19)AST ...........5 vs. Chicago State (11-25-19)BLK .......... 1 at Florida (11-10-16)...................1 at Pitt (1-14-19)STL ........... 5 vs. Saint Francis (11-23-19)MIN ..........29 vs. Saint Francis (11-23-19)underlined denotes career high established or tied during 2019-20 season

GuardAnthony Polite#26-6, 215, Redshirt Sophomore, Lugano, Switzerland

2019-20 Season* Will play a large role in Florida State’s success as sure-handed point guard* EntershisthirdseasonintheSeminoles’programhavingplayedin31gamesinhisfirsttwoseasons* Totaled7points,2reboundsand1stealinFloridaState’victoryoverNo.6FloridainGainesville* AstarterforthefirsttimeinhiscareerintheSeminoles’victoryoverChattanoogainTallahassee* Totaled8pointsandacareer-high7reboundsinFloridaState’svictoryoverSaintFrancisinTallahassee* Scored a career-high tying 9 points to go along with a career-high 5 assists in Florida State’s win over Chicago State

2018-19 Season* Averaged2.7points(11thontheteam),1.6rebounds(ninth)and0.6steals(seventh)whileplayingin30ofFlorida State’s37gamesduringitsrecord-settingandNCAATournamentseason.* Averaged 11.5 minutes played per game as one of 11 Seminoles who averaged 11 or more minutes played per game* Shot.773fromthefieldashefinishedtheseasonasoneofonlyfiveplayersontheteamtoshoot77percentorbetter from the free throw line* Ahugeliftoffofthebenchwith9points,4reboundsand3stealsinFloridaState’svictoryoverMurrayStatein the NCAA Tournament -- a win that sent the Seminoles to the Sweet 16 of the NCAA Tournament

2017-18 Season * A redshirt season as he did not play in any games for the Seminoles during the regular season* Averaged 6.0 points and 3.5 assists in Florida State’s two exhibition game victories to begin the season* Totaled 1 rebound, 1 assist and 1 steal in his career debut against George Washington on Nov. 14

9/16Anthony Polite tied his

career-high with nine points in Florida State’s victory over Murray State in the

second round of the NCAA Tournament -- a win that sent the Seminoles to the

Sweet 16

Page 8: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

#3 Trent Forrest Guard

Trent Forrest’s Career HighsPTS ..........23vs.SoutheastMissouri(12-17-18)FGM ........8 at Pitt (11-6-19)..................8 vs. Gonzaga (3-28-19)..................8vs.SoutheastMissouri(12-17-18)..................8 vs. Boston College (3-3-18)FGA .........16 at Pitt (11-6-19)FG% .........857vs.NichollsState(12-8-16)...................857vs.DetroitMercy(11-20-16)3FGM ......2 vs. Chicago State (11-25-19)3FGA .......4vs.SoutheastMissouri(12-17-18)3FG % .....1.000 vs. Chicago State (11-25-19)..................1.000 vs. Nicholls State (12-8-16)FTM .........11 at Pitt (1-14-19)FTA ..........12 at Pitt (1-14-19)FT% ........1.000 vs. 13 Teams..................Last vs. Saint Francis (11-23-19)OR............6atDuke(2-28-17)DR ............11 vs. UAB (11-22-18)REBS .......11 vs. UAB (11-22-18)..................11 vs. Syracuse (1-13-18)AST ..........12vs.SouthernMiss(12-21-17)BLK .........2 vs. 4 teams..................Last vs. Chattanooga (11-20-19)STL ..........5 vs. Louisville (2-9-19)..................5 vs. UConn (12-8-18)MIN .........40 vs. Syracuse (1-13-18)underlined denotes career high established or tied during 2019-20 season

6-4, 210, Senior, Chipley, Fla.

2019-20 Season* On the Watch List for the Bob Cousy Award presented to the nation’s top point guard.* A pre-season All-ACC Second-Team selection by the voting media at Operation ACC Basketball.* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* Florida State’s undisputed team leader and starting point guard for the second consecutive season.* Scored a game-high 19 points in Florida State’s season opener at Pitt* Totaled8pointsandagame-high7reboundsinFloridaState’svictoryatNo.6FloridainGainesville* Scored 16 points to go along with 2 rebounds, 2 assists and 1 steal in Florida State’s win over Western Carolina

2018-19 Season* Averagedacareer-high9.3points(thirdontheteam),4.5rebounds(fourth),3.7assists(first)andacareer-high1.9 steals(first)asFloridaState’sstartingpointguard.* Named to the NCAA Tournament All-West Regional Tournament team in leading FSU to the NCAA Sweet 16* Career-high 23 points with 8 rebounds, 4 assists and 3 steals in Florida State’s victory over Southeast Missouri * Totaled 10 points, 6 rebounds and 3 assists in Florida State’s victory over No. 2 Virginia in the ACC Tournament* Totaled 20 points, 5 rebounds, 4 assists and 3 steals in Florida State’s Sweet 16 game against Gonzaga in the NCAA Tournament

2017-18 Season * Averaged7.9points(fifth)and3.9assists(first)asheplayedin34gameswithtwostarts* Named to the 2018 All-ACC Academic Men’s Basketball Team and the 2018 ACC Honor Roll* Career-high21pointsandfirstcareerdouble-doubleof21pointsand10reboundsagainstBostonCol.onMarch3* Totaled 16 points and 4 assists came in Florida State’s overtime win over Clemson on Feb. 14* Totaled16pointstogoalongwith7assistsand3stealsin32minutesagainstNCState* Totaled 14 points, 5 rebounds, 4 steals and 3 assists in Florida State’s victory over Xavier in the NCAA Tournament

2016-17 Season* Averaged4.9points(tiedforseventh),2.7rebounds(seventh)and1.2steals(first)asheplayedinall35games* Namedtothe2017ACCAll-AcademicMen’sBasketballTeam* Totaled his season-high of 13 points and 6 rebounds in Florida State’s victory over Nicholls State on Dec. 8* Doublefiguresforthefirsttimeinhiscareerwith10pointsand3reboundsinFloridaState’swinoverIona

On Forrest* A consensus top 50 prep player who was ranked 45th among all prep players by ESPN.com entering college with the class of 2016* Ranked as the seventh best player in the state of Florida, the 11th best shooting guard in the nation, the 48th best player in the country and was a four-star player by Sports Illustrated* Ranked as the 62nd best high school player in the nation by Scout.com* A strong athlete on the wing who is an outstanding athlete and a stellar defender

2019-20 Game-By-Game Statistics -- Trent ForrestDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 39 8-16 .500 1-3 .333 2-3 .667 0-2 2 2 2 5 1 2 19N10 atFlorida 2-2 31 1-7 .143 1-3 333 5-6 .833 3-5 8 1 7 4 0 1 8N15 Western Carolina 3-3 32 5-14 .357 1-3 .333 5-5 1.000 1-1 2 4 2 1 0 1 16N20 Chattanooga 4-4 30 2-4 .500 0-1 .000 1-2 .500 0-4 4 1 7 4 2 1 5N23 St. Francis (Pa.) 5-5 26 3-7 .429 0-1 .000 7-7 1.000 1-4 5 1 4 3 0 2 13N25 Chicago State 6-6 15 5-8 .625 2-2 1.000 0-0 .000 0-2 2 0 6 2 0 3 12N29 vs.Tennessee 7-7 34 3-11 .273 0-0 .000 3-5 .600 0-4 4 2 4 8 1 1 9N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

3Trent Forrest became just the third player in FSU

history to be named to the NCAA All-Region Team in 2019. Phil Cofer and

Terance Mann were named to the All-West

Regional Team in 2018.

Page 9: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Patrick WilliamsDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-0 27 1-5 .200 1-2 .500 2-2 1.000 0-2 2 1 0 1 1 0 5N10 at Florida 2-0 15 2-4 .500 0-1 .000 0-0 .000 1-4 5 2 0 1 3 1 4N15 Western Carolina 3-0 23 5-8 .625 1-2 .500 7-7 1.000 1-3 4 0 1 2 0 0 18N20 Chattanooga 4-0 20 6-10 .600 3-5 .600 2-2 1.000 1-2 3 0 3 0 0 1 16 N23 St. Francis (Pa.) 5-0 22 2-6 .333 0-2 .000 2-2 1.000 1-4 5 1 1 5 1 1 6N25 Chicago State 6-0 20 6-8 .750 0-1 .000 4-4 1.000 1-2 3 3 1 1 0 1 16N29 vs.Tennessee 7-0 18 4-6 .667 0-0 .000 0-1 .000 0-2 2 0 1 2 0 1 8N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Patrick Williams’ Career HighsPTS ..........18 vs. Western Carolina (11-15-19)FGM ........6 vs. Chicago State (11-25-19)..................6 vs. Chattanooga (11-20-19)FGA .........10 vs. Chattanooga (11-20-19)FG% .........750vs.ChicagoState(11-25-19)3FGM ......2 vs. Chattanooga (11-20-19)3FGA .......3 vs. Chattanooga (11-20-19)3FG % .......667 vs. Chattanooga (11-20-19)FTM .........7vs.WesternCarolina(11-15-19)FTA ..........7vs.WesternCarolina(11-15-19)FT% ........1.000 vs. Chicago State (11-25-19)..................1.000 vs. Saint Francis (11-23-19)..................1.000 vs. Chattanooga (11-20-19)..................1.000 vs. Western Carolina (11-15-19)..................1.000 at Pitt (11-6-19)OR............1 vs. Chicago State (11-25-19)..................1 vs. Chattanooga (11-20-19)..................1 vs. Western Carolina (11-15-19)..................1 at Florida (11-10-19)DR ............4 vs. Saint Francis (11-23-19)..................4 at Florida (11-10-19)REBS .......5 at Florida (11-10-19)AST ..........3 vs. Chattanooga (11-20-19)STL ..........2 vs. Chattanooga (11-20-19)BLK .........3 at Florida (11-10-19)MIN .........27atPitt(11-6-19)underlined denotes career high established or tied during 2018-19 season

6-8, 225, Freshman, Charlotte, N.C.

2019-20 * AtopcandidateforACCRookieoftheYearinhisfirstseasonasaSeminole* A silky smooth player who can play any position on the court* Totaled 5 points, 2 rebounds and 1 blocked shot in his career debut at Pitt* Totaled 4 points, 5 rebounds and a game-high tying 3 blocked shots in Florida State’s victory over No. 6 Florida* Scoredagame-hightying18pointsandwasaperfect7-7fromthefreethrowlineinFSU’swinoverW.Carolina* Totaled 16 points, 3 rebounds, 3 assists and 2 steals in Florida State’s win over Chattanooga in Tallahassee* Totaled 16 points, 3 rebounds and 1 blocked shot in Florida State’s victory over Chicago State in Tallahassee

On Williams* Afive-starplayerandaconsensustop-25recruit* ESPN ranked him as the 34th best player and the sixth best small forward in the country* TheNo.7smallforwardandthetopprospectinthestateofNorthCarolinain2019* Named to the Naismith High School Boy’s Watch List prior to the start of his freshman season* Was a guard growing up as he arrived as a freshman at West Charlotte on only 6-0* His growth spurt has allowed him to be one of the most versatile players in the incoming class.

ForwardPatrick Williams#4

1/7Patrick Williams was named as the No. 1

prospect in the state of North Carolina and the No. 7smallforwardprospectinthe nation by ESPN.com as

a high school senior.

Page 10: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

Balsa Koprivica’s Career HighsPTS ........... 11 vs. Saint Francis (11-23-19)FGM ......... 5 vs. Saint Francis (11-23-19)...................5 vs. Chattanooga (11-20-19)FGA .......... 6 vs. Saint Francis (11-23-19)...................6 vs. Chattanooga (11-20-19)FG% ......... 1.000 vs. Tennessee (11-29-19)...................1.000 vs. Western Carolina (11-15-19)3FGM .......3FGA ........3FG% .......FTM .......... 4 vs. Tennessee (11-29-19)...................4 vs. Chicago State (11-25-19)FTA ........... 6 vs. Saint Francis (11-23-19)FT% ......... 1.000 vs. Tennessee (11-29-19)...................1.000 vs. Western Carolina (11-15-19)...................1.000 at Pitt (11-6-19)OR.............3 vs. Chattanooga (11-20-19)DR .............5 vs. Chicago State (11-25-19)REBS ........7vs.ChicagoState(11-25-19)...................7vs.Chattanooga(11-20-19)AST ...........1 vs. Chattanooga (11-20-19)BLK .......... 1 vs. Chattanooga (11-20-19)...................1 vs. Western Carolina (11-15-19)STL ........... 2 vs. Tennessee (11-29-19)...................2 vs. Saint Francis (11-23-19)MIN ..........20 vs. Saint Francis (11-15-19)underlined denotes career high established or tied during 2019-20 season

#5 Balsa Koprivica Center7-1, 260, Freshman, Belgrade, Serbia

2019-20 Season* Oneoftwo7-footersontheSeminoles’rosterwhowillearnagreatdealofplayingtime.* Totaled 4 points, 2 rebounds and 1 blocked shot in Florida State’s victory over Western Carolina* Doublefiguresscoringforthefirsttimeinhiscareerwith10pointsand7reboundsinFloridaState’swinover Chattanooga* Totaled 11 points, 3 rebounds and 2 steals in Florida Stat’s victory over Saint Francis in Tallahassee* Doublefiguresforthethirdstraightgamewith10pointsand7reboundsinFloridaState’swinoverChicagoState* Totaled 8 points, 3 rebounds and 2 steals in Florida State’s victory over Tennessee in the Emerald Coast Classic

On Koprivica* A consensus top-60 national recruit* Afour-starrecruitbyScout,Rivals,247SportsandESPN* TheNo.12centerandtheNo.56overallplayerinthe2019recruitingclassaccordingto247Sports* Considered to be the third best player in the talent-rich state of Florida* Has good hands, can consistently make jump shots and has strong rebounding abilities.

2019-20 Game-By-Game Statistics -- Balsa KopriviciaDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 6 0-0 .000 0-0 .000 2-2 1.000 1-1 2 5 0 1 0 0 2N10 at Florida 2-0 6 1-2 .500 0-0 .000 0-0 .000 0-0 0 3 0 0 0 0 0N15 Western Carolina 3-0 11 2-2 1.000 0-0 .000 0-0 .000 1-1 2 3 0 3 1 0 4N20 Chattanooga 4-0 12 5-6 .833 0-0 .000 0-2 .000 3-4 7 1 1 0 1 0 10N23 St. Francis (Pa.) 5-0 20 5-6 .833 0-0 .000 1-3 .222 2-1 3 0 0 0 0 1 11N25 Chicago State 6-0 18 3-4 .750 0-0 .000 4-5 .800 2-5 7 1 1 3 0 1 10N29 vs.Tennessee 7-0 19 2-2 1.000 0-0 .000 4-4 1.000 1-2 3 3 0 1 0 2 8N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

57-3Balsa Koprivica helped

lead Montverde Academy toa57-3record

(.950 winning percentage)in his two seasons.

Page 11: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

ForwardMalik Osborne#106-9, 215, Redshirt Sophomore, Matteson, Ill.

2019-20* BeginsplayinhisfirstactiveseasonintheSeminoles’rosteraftersittingoutthe2018-19seasonaftertransferring to Florida State from Rice prior to the season* A starter with 2 points and a game-high 9 rebounds in Florida State’s season-opener at Pitt* Totaled 10 points, 4 rebounds and 1 steal in Florida State’s victory at No. 6 Florida in Gainesville* Totaled 6 points, 9 rebounds and 1 blocked shot in Florida State’s victory over Western Carolina* Totaled 10 points and 3 rebounds as a starter in Florida State’s victory over Chattanooga in Tallahassee* Totaled 4 points, 6 rebounds and 3 steals in Florida State’s victory over Tennessee in the Emerald Coast Classic

2018-19 Season * Satoutthe2018-19seasonaftertransferringfromRicewhereheplayedasafreshmanduringthe2017-18season* TraveledwiththeSeminolestoHartford,Conn.,forthefirsttworoundsofthe2019NCAATournament

2017-18 Season* Averaged9.0points(fourthontheteam),6.5rebounds(second),0.8blockedshots(first)and0.6steals(third), whileshooting.414fromthefield* Ranked third amongst his Owl teammates with 280 points* Rankedfifthontheteamwith223-pointshotsmade* Started27oftheOwls’31games

On Osborne* Graduated from Rich South High School in Illinois in 2016* Averaged10.8points,7.1reboundsand1.6blockedshotsasamemberofthevarsityteamasasenior* Led the Stars to an 18-8 record* EarnedAll-ConferenceFirstTeamandAll-AreaHonorableMentionhonorsin2017* A team leader as Rich South advanced to the second round of the state high school championship tournament* Played in 25 of the Rich South’s 26 games…

Malik Osborne’s Career HighsPTS ........... 22 vs. Marshall (2-15-18)FGM .........7atFIU(2-14-18)...................7vs.Marshall(2-15-18)FGA ..........17vs.Marshall(2-15-18)FG% ......... 1.000 vs. Chicago State (11-25-19)3FGM ....... 3 vs. 5 teams...................Last vs. Saint Francis (11-23-19)3FGA ........ 9 vs. Marshall (2-15-18)3FG% ....... .750vs.WesternKentucky(2-17-18)FTM .......... 9 vs. Charlotte (1-6-18)FTA ........... 11 vs. Charlotte (1-6-18)FT% ......... 1.000 vs. 9 Teams...................Last vs. Western Carolina (11-15-19)OR.............5vs.UNLV(11-20-17)DR ............. 10 vs. Marshall (2-15-18)REBS ........13vs.TexasSanAntonio(12-28-17)................... 13 vs. Marshall (2-15-18)AST ........... 2 vs. 6 teams...................Last at FIU (2-14-18)BLK .......... 4 at Pitt (11-6-19)STL ...........4atStephenF.Austin(12-9-17)MIN ..........36atStephenF.Austin(12-9-17)underlined denotes career high established or tied during 2019-20 season

22Malik Osborne scored his career-high of 22 points against Marshall on Feb.

15, 2018. After transferring to Florida State from Rice he has three years of eligi-

bility remaining

2019-20 Game-By-Game Statistics -- Malik OsborneDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 23 1-4 .250 0-2 .000 0-0 .000 2-7 9 2 0 1 4 0 2N10 atFlorida 2-2 26 4-7 .571 0-0 .000 2-2 1.000 2-2 4 4 0 0 0 1 10N15 Western Carolina 3-3 15 2-2 1.000 0-0 .000 2-3 .667 4-5 9 2 1 1 1 0 6N20 Chattanooga 4-4 20 4-10 .400 1-3 .333 1-1 1.000 0-3 3 1 2 1 0 0 10N23 St. Francis (Pa.) 5-5 24 3-7 .429 3-5 .600 0-0 .000 1-3 4 2 0 1 2 0 9N25 Chicago State 6-6 15 2-2 1.000 0-0 .000 0-0 .000 2-3 5 1 1 0 0 0 4N29 vs.Tennessee 7-7 16 1-1 1.000 1-1 1.000 1-4 .250 2-4 6 1 0 0 0 3 4N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 12: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Nathanael JackDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 3 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 0N10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 2-0 14 2-5 .400 2-5 .400 0-0 .000 1-4 5 1 1 1 0 1 6N23 St. Francis (Pa.) 3-0 9 1-5 .200 1-5 .200 0-0 .000 0-1 1 1 2 2 0 0 3N25 Chicago State 4-0 14 4-6 .667 4-6 .667 2-2 1.000 0-1 1 3 2 0 0 0 14N29 vs. Tennessee DNPN30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Nathanael Jack’s Career HighsPTS ........... 14 vs. Chicago State (11-25-19)FGM ......... 4 vs. Chicago State (11-25-19)FGA .......... 6 vs. Chicago State (11-25-19)FG% ......... .667vs.ChicagoState(11-25-19)3FGM ....... 4 vs. Chicago State (11-25-19)3FGA ........ 6 vs. Chicago State (11-25-19)3FG% ....... .667vs.ChicagoState(11-25-19)FTM .......... 2 vs. Chicago State (11-25-19)FTA ........... 2 vs. Chicago State (11-25-19)FT% ......... 1.000 vs. Chicago State (11-25-19)OR............. 1 vs. Chattanooga (11-20-19)DR ............. 4 vs. Chattanooga (11-20-19)REBS ........ 5 vs. Chattanooga (11-20-19)AST ........... 2 vs. Chicago State (11-25-19)................... 2 vs. Saint Francis (11-23-19)BLK ..........STL ........... 1 vs. Chattanooga (11-20-19) MIN .......... 14 vs. Chicago State (11-25-19)................... 14 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20 season

#11 Nathanael Jack Guard

6-5, 195, Junior, Mississauga, Ontario, Canada

2019-20 Season* WillbeintheSeminoles’rotationattheguardpositioninhisfirstseasonatFloridaState.* A junior college transfer from Eastern Florida State College which is located in Cocoa, Florida* Totaled 6 points and 5 rebounds in 11 minutes of playing time in the Seminoles’ victory over Chattanooga * Career-high 14 points and 2 assists in Florida State’s victory over Chicago State in Tallahassee

At Eastern Florida State College* Graduated from Eastern Florida State College in 2019 with an Associate’s Degree in General Education.* Helped lead Eastern Florida State College to the Junior College National Championship Tournament in Hutchinson, Kan., in both of his seasons.* TheTitansfinishedasthenationalrunners-upin2018andadvancedtothequarterfinalsin2019.* Led Eastern Florida to two consecutive Mid-Florida Conference Championships in both of his years at the school.

On Jack* Was born in Canada and still considers Canada to be his home.* Chose Florida State over Kansas, Oklahoma, Texas Tech Arizona State and Miami.* Major is Social Science - with a specialization of Social Entrepreneurship and Innovation.

8Nathanael Jack made his ju-nior college career-high of eight3-pointfieldgoalsinEastern Florida State Col-lege’s victory over Chipola College during the 2018-19

season

Page 13: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

Justin Lindner’s Career HighsPTS ........... 4 vs. Chicago State (11-25-19)FGM ......... 1 vs. Chicago State (11-25-19)FGA .......... 21vs. Chicago State (11-25-19)...................1 vs. Murray State (3-23-19)...................1vs.SouthernMiss(12-21-17)FG% .........3FGM .......3FGA ........3FG% .......FTM .......... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)FTA ........... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)...................2 vs. Wake Forest (2-13-19)FT% ......... 1.000 vs. Chicago State (11-25-19) ................... 1.000 at Georgia Tech (2-16-19)OR.............1 vs. Wake Forest (2-13-19)DR .............2 vs. Chicago State (11-25-19)REBS ........2 vs. Chicago State (11-25-19)AST ...........2 vs. Chattanooga (11-20-19)...................2vs.SouthernMiss(12-21-17)BLK ..........STL ........... 1 at Georgia Tech (2-16-19)MIN ..........5 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20 season

#12 Justin Lindner Guard

2019-20 Game-By-Game Statistics -- Justin LindnerDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 5 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 2 1 0 0 0N23 St. Francis (Pa.) 2-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 1 0 0 0 0 0N25 Chicago State 3-0 4 1-1 1.000 0-0 .000 2-2 1.000 0-2 2 1 0 2 0 0 4N29 vs. Tennessee DNPN30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

6-1, 180, Redshirt Junior, Memphis, Tennessee

2019-20* One of the Seminoles’ most experienced guards who is in his fourth season as a member of the program* HashelpedtheSeminolesreachtheNCAATournamentinhisfirstthreeseasonsasaSeminole.* Joined the team as a freshman in the fall of 2016.* Career high of 5 minutes of playing time with 2 assists in Florida State’s victory over Chattanooga in Tallahassee* Firstcareerfieldgoalandcareer-high4pointsin4minutesofplayinFloridaState’svictoryoverChicagoState

2018-19 Season* Averaged0.3points,0.7reboundsand0.7assistsasheplayedinacareer-highsevengames.* A member of Florida State’s 2018 NCAA Elite Eight team who is in his third season as a member of the Seminole men’s basketball team.

2017-18 Season* Averaged0.0pointsand0.2reboundsasheplayedinfivegamesinhissecondseasonasaSeminole* Averaged 4.0 points and 1.0 rebound in Florida State’s two-game exhibition season to begin the season* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Totaled 1 rebound in 2 minutes of playing time in Florida State’s victory over The Citadel on Nov. 24* Earned 1 minute of playing time in Florida State’s victory over Missouri in the NCAA Tournament

2016-17* BecameamemberoftheSeminolemen’sbasketballteamtobeginthe2016-17season* Practiced and traveled with the team but did not play in any games

On Lindner* Graduated from Christian Brothers School in Memphis, Tenn., in 2016* A member of the varsity at Christian Brothers High School as a sophomore, junior and as a senior* Helped Christian Brothers to a 57-3 record (.950 winning percentage) and two state championship tournament appearances during his junior and senior seasons* Averaged 11.0 points, 4.8 assists and 0.9 steals while shooting 53 percent from the field in leading Christian Brothers to a 28-2 record and to the semifinals of the state championship tournament as a junior* Earned All-Region First-Team honors and served as the team captain as a senior

57-3Justin Linder helped

Christian Brothers High School in Memphis to a 57-3recordandtwostatechampionship tournament

appearances as a junior and senior

Page 14: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

CenterDominik Olejniczak#157-0, Graduate, Torun, Poland (Pronounced: DOM-A-Nick Ole’-knee-Chuck)

2019-20 Season (at Florida State)* PlayinghisfinalseasonofeligibilityaftertransferringtoFloridaStatefromOleMissasagraduatetransfer.* OnlythethirdgraduatetransferatFloridaStatefollowingthefootstepsofJeffPeterson(2012)andDavidNichols (2019). Both Peterson and Nichols helped lead the Seminoles to the NCAA Tournament.* ComestoFloridaStateafteroneseasonatDrake(2015-16)andtwoseasonsatOleMiss(2017-18and2018-19)* MadehisFloridaStatedebutwith2reboundsin7minutesofplayinFloridaState’swinatFloridainGainesville* Scored his Florida State high of 10 points in the Seminoles’ victory over Chattanooga in Tallahassee

2018-19 Season (At Ole Miss)* Averaged5.3points(seventhontheteam),3.0rebounds(fifth),acareer-highandteam-leading0.9blockedshots (first)andshotateamleading.575fromthefieldasheplayedinall33gamesatOleMiss.* Establishedcareer-highsforgamesplayed(33),gamesstarted(22),assists(23),blockedshots(30),steals(17),minutes played (603) and average minutes played per game (16.3).* Led the Rebels to the NCAA Tournament with a 20-13 overall record and a 10-8 record in SEC play.

2017-18 Season (At Ole Miss)* Averaged 4.3 points (eighth on the team), 2.6 rebounds (sixth) and 0.6 blocked shots (fourth) while playing in all 32 games for the Rebels.* Started11gamesfortheRebelsinhisfirstseasonofeligibilityinOxford.* Shot.531fromthefieldashecontinuedtodisplayhisfieldgoalshootingprowess.

2016-17 (at Ole Miss)* Sat out the season at Ole Miss as a redshirt due to NCAA transfer regulations…practiced but did not travel with the Rebels during the season.

2015-16 Season* Averagedacareer-high6.5points(fourthontheteam),acareer-high4.1rebounds(third)and0.7blockedshots(first) inhelpingDraketoa7-24overallrecord.* Drake is a member of the Missouri Valley Conference.* Played in 30 of the Bulldogs 31 games and averaged 16.4 minutes played per game.* Shotacareer-high.722fromthefieldandwasonly18fieldgoalsmadeshortofestablishingtheDrakeschoolrecord forbestfieldgoalpercentageinasingleseason.

On Olejniczak* OlejniczakisworkingtowardsearninghisMaster’sdegreeinInternationalAffairsatFloridaState.* Named to the National Team of Poland for competition in the FIBA World Cup of Basketball in China on August. 30, 2019.* Polandadvancedtothequarterfinalsandearnedaneighthplacestandingwitha5-3record.* Averaged 1.6 points, 1.4 rebounds and 0.2 assists as he played in six of Poland’s eight games in the tournament.

Dominik Olejniczak’s Career HighsPTS ...........19vs.Loyola(2-17-16)*FGM ......... 9 vs. Missouri State (3-3-16)*FGA ..........13atTexas(1-27-18)**................... 13 vs. Missouri State (3-3-16)*FG% ......... 1.000 vs. 13 Teams...................Last vs. Oklahoma (3-22-19)**3FGM .......3FGA ........3FG% .......FTM .......... 9 vs. Auburn (1-9-19)**FTA ........... 12 vs. Auburn (1-9-19)**FT% ......... 1.000 vs. 16 Teams...................Last vs. Chicago State (11-25-19)***OR.............6 at Auburn (1-9-19)**DR .............11 vs. Simpson College (11-13-15)*REBS ........12 vs. Simpson College (11-13-15)*AST ...........3 vs. Oklahoma (3-22-19)**BLK ..........6vs.Loyola(2-17-16)*STL ........... 3 vs. Chattanooga (12-16-18)**................... 3 at Auburn (1-9-18)**MIN ..........34vs.Loyola(2-27-16)*underlined denotes career high established or tied during 2019-20 season* - Denotes at Drake (2015-16)**-DenotesatOleMiss(2017-18,2018-19)*** - Denotes at Florida State (2019-20)

8Dominik Olejniczak helped lead Poland to an 8th place finishinthe2019FIBA

World Championships. It washisfirsttimeplaying

his national team from Po-land in competition

2019-20 Game-By-Game Statistics -- Dominik OlejniczakDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 atFlorida 1-0 7 0-1 .000 0-1 .000 0-0 .000 1-1 2 2 0 0 0 0 0N15 Western Carolina 2-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 2 0 0 0 0 0N20 Chattanooga 3-0 8 5-6 .833 0-0 .000 0-0 .000 2-1 3 1 0 0 0 0 10N23 St. Francis (Pa.) 4-1 13 1-3 .333 0-0 .000 2-2 1.000 4-0 4 2 0 2 1 0 4N25 Chicago State 5-2 16 3-4 .750 0-0 .000 2-2 1.000 1-3 4 2 0 2 2 0 8N29 vs. Tennessee 6-3 14 1-3 .333 0-0 .000 0-0 .000 2-2 4 4 0 0 0 2 2N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 15: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

#20 Travis Light Guard

Travis Light’s Career HighsPTS ...........6vs.SouthernMiss(12-21-17)FGM .........2vs.SouthernMiss(12-21-17)FGA ..........3vs.SouthernMiss(12-21-17)FG% ......... .667vs.SouthernMiss(12-21-17)3FGM .......2vs.SouthernMiss(12-21-17)3FGA ........3vs.SouthernMiss(12-21-17)3FG% ....... .667vs.SouthernMiss(12-21-17)FTM ..........FTA ...........FT% .........OR.............DR .............1vs.TheCitadel(11-24-17)REBS ........1vs.TheCitadel(11-24-17)AST ...........BLK ..........STL ...........MIN ..........4 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

10.4Travis Light averaged 10.4 points in his only season at IMG Academy during the

2015-16 season

6-5, 175, Redshirt Junior, Vienna, Va.

2019-20 Season* In his fourth season as a member of the Seminole men’s basketball team and at the beginning of the 2019-20 season * Has two years of eligibility remaining* AmemberofthreeNCAATournamentteams–thesecondroundin2017,theEliteEightin2018andtheSweet16 in 2019* Has played in three NCAA Tournament games in his career — two in 2018 (against Missouri and Gonzaga) and one in 2019 (against Murray State)* Made his 2019-20 debut with 3 points in 3 minutes of playing time in Florida State’s victory over Chattanooga

2018-19 Season* Averaged 0.0 points, 0.0 rebounds and 0.2 steals while playing a career-high six games as he helped Florida State reach the NCAA Tournament for the third time in his career.* The Seminoles advanced to the Sweet 16 of the NCAA Tournament for the third time in his career.

2017-18 Season* Averaged1.2pointsand0.2reboundsasheplayedinacareer-highfivegames* Averaged1.5pointsasheearnedplayingtimeinbothofFloridaState’sexhibitiongamesin2017-18* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Career-highsixpoints--thefirstpointsofhiscareer--inFloridaState’svictoryoverSouthernMiss

2016-17 Season * A redshirt season* Practiced and traveled with the team throughout the year* One of the Seminoles’ top practice players who often emulates the opponent’s best shooter in practice* Helped Florida State to a 26-9 overall record and a 12-6 record in ACC play* TheSeminoles’12-6overallrecordallowedthemtofinishinsecondplaceintheACCstandingsandtiedtheschool record for ACC wins in a single season

On Travis Light* Averaged 10.4 points, 3.6 rebounds and 2.3 assists in 18 games played at IMG Academy in 2016* Graduated from Montverde Academy in 2015* Was a member of the Eagles’ prep team coached by former North Carolina shooting guard Dante Calabria…

2019-20 Game-By-Game Statistics -- Travis LightDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 3 1-1 1.000 1-1 1.000 0-0 .000 0-0 0 0 0 0 0 0 3N23 St. Francis (Pa.) 2-0 1 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 0 0 0 0 0N25 Chicago State 3-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 16: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

GuardM.J. Walker#23

M.J. Walker’s Career HighsPTS ........... 24 at Virginia Tech (1-20-18)FGM ......... 8 vs. LSU (11-23-18)...................8 at Virginia Tech (1-20-18)FGA .......... 16 vs. LSU (11-23-18)FG% ......... .800vs.GeorgeWashington(11-14-17)3FGM .......6atMiami(1-27-19)3FGA ........ 9 vs. LSU (11-23-18)...................9vs.SouthernMiss(12-21-17)3FG% ....... .857atMiami(1-27-19)FTM ..........7vs.Pitt(2-18-18)FTA ........... 8 vs. Pitt (2-18-18)FT% .........1.000vs.17Teams...................Last at Pitt (11-6-19)OR.............3 vs. Canisius (11-19-18)DR .............6 at Virginia Tech (1-20-18)REBS ........6 vs. Murray State (3-23-19)...................6 at Virginia Tech (1-20-18)AST ...........5atMiami(1-27-19)...................5 vs. Duke (1-12-19)STL ........... 3 vs. LSU (11-23-18)...................3 vs. Michigan (3-24-18)BLK .......... 2 at Boston College (1-20-19)MIN ..........42 vs. LSU (11-23-18)underlined denotes career high established or tied during 2018-19 season

6-5, 213, Junior, Jonesboro, Ga.

2019-20* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* A starter in the Seminoles’ backcourt for the second consecutive season* A member of two NCAA Tournament teams -- the Elite Eight in 2018 and the Sweet 16 in 2019* Totaled 12 points, 3 rebounds, 1 assist and 1 steal in Florida State’s victory over No. 6 Florida in Gainesville* Totaled18points(17inthesecondhalf)alongwith4reboundsand2assistsinFloridaState’swinoverW.Carolina* Scored10pointswith2assistsinFloridaState’svictoryoverTennesseeintheEmeraldCoastClassicsemifinals

2018-19 Season* Averagedacareer-high7.5points(fourthontheteam),acareer-high2.2rebounds(seventh),acareer-high1.6assists (fourth) and a career-high 0.8 steals (second) while making a career-high 44 3-point shots (second)* Shotacareer-high.759fromthefreethrowlineandmadeacareer-high49freethrows* HelpedleadtheSeminolestoa29-8overallrecord,a13-3markintheACC,toafourthplacefinishintheACCstand ings, Florida State’s appearance in the ACC Tournament Championship for the third time in school history and to the Sweet 16 of the NCAA Tournament for the second consecutive season

2017-18 Season* Averaged7.0points(seventh)and1.7rebounds(ninth)whilemaking413-pointshots(fourth)in35games* Career-high24pointson8madefieldgoalsand4made3-pointfieldgoalsinFloridaState’swinoverVirginiaTech* Totaled14pointsinhisfirstcareerstartinFloridaState’s88-75victoryoverPittinTallahasseeonFeb.18* Totaled 12 points, 3 rebounds and 2 assists in his career debut against George Washington on Nov. 14* Scored 15 points to go along with 2 assists and 1 steal in Florida State’s victory over Southern Miss on Dec. 21* Scoredateam-high22pointson5made3-pointfieldgoalsinFloridaState’svictoryoverColoradoState

On Walker* GraduatedfromJonesboroHighSchoolin2017* Namedthe6APlayeroftheYearintheStateofGeorgiabytheAtlantaJournal-Constitutionasheaveraged27.8 points, 6.5 rebounds and 2.4 assists as a senior* Led Jonesboro to a 23-6 overall record as a senior* Named to the USA Today All-USA Second-Team in 2016

3M.J. Walker received three scholarshipofferstoplay

football at Clemson, Miami (Fla.) and Michigan. He

was a free safety and a wide receiver as a high school

football star

2019-20 Game-By-Game Statistics -- M.J. WalkerDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-1 16 0-4 .000 0-2 .000 4-4 1.000 0-5 5 4 0 0 0 0 4N10 at Florida 2-2 32 3-10 .300 1-5 .200 5-6 .833 0-3 3 1 1 2 1 1 12N15 Western Carolina 3-3 26 5-11 .455 3-6 .500 5-7 .714 0-4 4 3 2 1 1 0 18N20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State DNPN29 vs. Tennessee 4-4 24 3-10 .300 1-3 .333 3-5 .600 1-2 3 3 2 1 0 0 10N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 17: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

#24 Devin Vassell Guard/ Forward

Devin Vassell’s Career HighsPTS ..........17vs.Chattanooga(11-20-19)FGM ........6 vs. 4 teams..................Last vs. Chicago State (11-25-19)FGA .........15 at Florida (11-10-19)FG% .........857vs.ChicagoState(11-25-19)...................857atPitt(11-6-19)3FGM ......4 vs. Virginia Tech (3-14-19)3FGA .......7vs.VirginiaTech(3-14-19)3FG% ......1.000 at Pitt (11-6-19)..................1.000 vs. Notre Dame (2-15-19)..................1.000 vs. UAB (11-22-18)FTM .........8 vs. Tennessee (11-29-19)FTA ..........10 vs. Tennessee (11-29-19)FT% ........1.000 vs. 4 teams..................Last vs. Chattanooga (11-20-19)OR............5 vs. Chattanooga (11-20-19)DR ............6 vs. Duke (3-16-19)..................6 vs. Notre Dame (2-15-19)REBS .......8 vs. Chattanooga (11-20-19)AST ..........3 vs. North Florida (12-19-18)BLK .........2 vs. Chattanooga (11-20-19)..................2 vs. Duke (3-16-19)STL ..........3 vs. Tennessee (11-29-19)..................3 vs. Chicago State (11-25-19)..................3 vs. Canisius (11-19-18)MIN .........34 at Florida (11-101-19)underlined denotes career high established or tied during the 2019-20 season

4Devin Vassell made a

career-high43-pointfieldgoals against Virginia Tech inthequarterfinalsofthe2019 ACC Tournament

-- including one that tied the game with 4 seconds remaing in regulation.

6-6, 180, Sophomore, Suwanee, Ga. (Pronounced Dev-In Va-Sell)

2019-20 Season* One of the Seminoles’ toughest defenders who utilizes his athleticism and incredible wingspan to lockdown some of the top players in the nation.* Takes advantage of his incredible wing-span (measured at 6-9 1/4), his height (6-5) and his leaping ability on bothoffenseanddefense.* Totaled 14 points, 2 rebounds and 1 assist in Florida State’s season opener at Pitt* Scored 13 points, pulled down 6 rebounds and added 2 steals in Florida State’s victory over No. 6 Florida* Totaled 10 points, 5 rebounds and 2 assists in Florida State’s victory over Western Carolina* Totaled a team-high 13 points on a career-high 8 free throws with 5 rebounds in Florida State’s win over Tennessee

2018-19 Season* Averaged4.5points(ninthontheteam)and1.5rebounds(10th)whileplayingin33ofFloridaState’s37games.* Averaged10.7minutesplayedpergameinleadingtheSeminolestotheSweet16oftheNCAATournamentinhis firstseasonasaSeminole* Shotateam-leading.419fromthe3-pointline–hefinishedastheonlySeminoletoshoot40percentorbetterfrom the 3-point line -- led the ACC’s freshmen with his .419 3-point shooting percentage – he was one of only two fresh men in the ACC (also Isaiah Wilkins of Virginia Tech) to shoot 40 percent or better from the 3-point line with 50 or more attempts during the 2018-19 season. * Career-high 16 points, 4 rebounds, 1 assist and 1 steal in Florida State’s 85-68 win over Southeast Missouri

On Vassell * Florida State’s lone scholarship freshman in the 2018 recruiting class* AneffectiverebounderanddefenderwhofitsintoFloridaState’steamdefensivephilosophywell* A talented scorer who can shoot well from long range and who has the athleticism to drive to the basket* Saidtohaveafeatherytouchfromtheoutsideandtheabilitytooperatewellintraffic* Has explosive athleticism, a high basketball IQ and relentless energy on the court

2019-20 Game-By-Game Statistics -- Devin VassellDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 21 6-7 .857 2-2 1.000 0-0 .000 2-0 2 2 1 1 0 0 14N10 at Florida 2-2 34 6-15 .400 1-3 .333 0-1 .000 2-4 6 1 0 0 1 2 13N15 Western Carolina 3-3 32 4-9 .444 0-3 .000 2-4 .500 1-4 5 2 2 1 1 0 10N20 Chattanooga 4-4 26 6-10 .600 3-5 .600 2-2 1.000 3-5 8 1 1 1 2 1 17N23 St. Francis (Pa.) 5-5 17 2-4 .500 0-0 .000 0-0 .000 0-1 1 4 1 0 0 1 4N25 Chicago State 6-6 13 6-7 .857 1-2 .500 3-4 .750 2-0 2 0 1 1 0 3 16N29 vs.Tennessee 7-7 30 2-9 .222 1-4 .250 8-10 .800 1-4 5 3 0 0 0 3 13N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 18: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

#30 Harrison Prieto Forward

Harrison Prieto’s Career HighsPTS ..........2 vs. Chattanooga (11-20-19)..................2 vs. Murray State (3-23-19)..................2 at Georgia Tech (2-16-19)..................2 vs. Wake Forest (2-13-19)..................2 at Syracuse (2-5-19)..................2vs.SouthernMiss(12-21-17)FGM ........1 vs. Chattanooga (11-20-19)..................1 vs. Murray State (3-23-19)..................1 at Georgia Tech (2-16-19)..................1 vs. Wake Forest (2-13-19)..................1 at Syracuse (2-5-19)..................1vs.SouthernMiss(12-21-17)FGA .........2 vs. Saint Francis (11-23-19)..................2 vs. Murray State (3-23-19)..................2 at Georgia Tech (2-16-19)..................2vs.SouthernMiss(12-21-17)FG% .........500vs.SouthernMiss(12-21-17)FTM .........FTA ..........2 vs. Chicago State (11-25-19)FT% ........OR............2 vs. Murray State (3-23-19)DR ............2 vs. Murray State (3-23-19)..................2 vs. Wake Forest (2-13-19)REBS .......4 vs. Murray State (3-23-19)AST ..........1vs.SouthernMiss(12-21-17)BLK .........STL ..........MIN .........6 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

206Harrison Prieto blocked 206

shots during his four-year varsity career at St. Paul’s High School in Covington,

La.

2019-20 Game-By-Game Statistics -- Harrison PrietoDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 5 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 0N10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 2-0 3 1-1 1.000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 2N23 St. Francis (Pa.) 3-0 2 0-2 .000 0-1 .000 0-0 .000 0-0 0 1 0 0 0 0 0N25 Chicago State 4-0 6 0-0 .000 0-0 .000 0-2 .000 1-1 2 1 0 0 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

6-8, 230, Redshirt-Junior, Mandeville, La.

2019-20 Season* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* Continues to earn an expanded role as a member of the Seminoles’ frontcourt rotation as he has developed into a valuable reserve for the Seminoles.* His growing importance to the Seminoles was evident during the 2018-19 season as he played in a career-high nine games,acareer-highfiveACCgamesandinFloridaState’svictoryoverMurrayStateintheNCAATournament.

2018-19 Season* Averaged0.9pointsand0.9reboundsandshot.667fromthefieldwhileplayinginacareer-highninegames.* Tiedhiscareer-highwithtwopointsinfourdifferentgamesasaredshirtsophomore–atSyracuse,againstWakeForest at home, at Georgia Tech and against Murray State in the NCAA Tournament.* A happy homecoming with 1 rebound in 4 minutes of play in Florida State’s victory over Tulane in New Orleans* First career ACC basket in Florida State’s victory over Syracuse in the Carrier Dome.* Totaled 2 points and a career-high 4 rebounds in Florida State’s 90-62 win over Murray State in the ACC Tournament.

2017-18* Averaged1.0pointand0.0reboundsintwogamesplayedduringthe2017-18season.* EarnedplayingtimeforthefirsttimeinhiscareerinFloridaState’svictoryoverTheCitadelonNov.24.* Totaled 2 points in 3 minutes of playing time in Florida State’s victory over Southern Miss on Dec. 21.

2016-17 Season* Practiced and traveled with the team throughout the year.* One of the Seminoles’ top practice players who often emulates the opponent’s best shooter in practice.* Helped Florida State to a 26-9 overall record and a 12-6 record in ACC play.

On Prieto* Graduated from St. Paul’s School in Covington, La., in 2016.* Totaled1,178careerpoints,736careerreboundsand206careerblockedshotsasafour-yearmemberofthe St. Paul’s varsity.* Team captain and St. Paul’s Player of the Year as a senior.* Earned the Jimmy Dunn award in 2016 as Most Outstanding Athlete.

Page 19: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

#31 Wyatt Wilkes

Wyatt Wilkes’ Career HighsPTS ........... 14 vs. Saint Francis (11-23-19)FGM ......... 5 vs. Saint Francis (11-23-19)FGA ..........7vs.ChicagoState(11-25-19)...................7vs.SaintFrancis(11-23-19)FG% ......... 1.000 vs. Canisius (11-19-18)...................1.000vs.GeorgeWashington(11-14-17)3FGM ....... 3 vs. Saint Francis (11-23-19)3FGA ........7vs.ChicagoState(11-25-19)3FG% ....... 1.000 vs. Canisius (11-19-18)FTM .......... 2 vs. Chicago State (11-25-19)...................2 at Virginia (1-5-19)FTA ........... 3 at Virginia (1-5-19)FT% ......... 1.000 vs. Chicago State (11-25-19)OR.............1 vs. 10 Teams ...................Last vs. Chicago State (11-25-19)DR .............3vs.TheCitadel(11-24-17)REBS ........4vs.TheCitadel(11-24-17)AST ...........2 vs. Chicago State (11-25-19)...................2vs.Loyola(Md.)(12-6-17)BLK .......... 1 vs. Murray State (3-23-19)...................1vs.SouthernMiss(12-21-17)...................1vs.TheCitadel(11-24-17)STL ........... 1 vs. 6 teams...................Last vs. Chicago State (11-25-19)MIN ..........18 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

6-8, 220, Redshirt Sophomore, Orlando, Fla.

2019-20 Season* One of the Seminoles’ hardest workers who has been a member of two NCAA Tournament teams.* Helped the Seminoles to the Elite Eight of the 2018 NCAA Tournament and to the Sweet 16 of the 2019 NCAA Tournament.* HashelpedFloridaStatetoanaverageof26winsinthefirsttwoseasonsofhiscareer.* Astarterforthefirsttimewith5pointsand2reboundsinFloridaState’svictoryoverChattanooga* A career-high 14 points and 2 rebounds in a career-high 16 minutes of play in Florida State’s win over Saint Francis* Totaled 8 points, 3 rebounds and 2 assists in Florida State’s victory over Chicago State in Tallahassee

2018-19 Season* Averaged1.5pointsand0.7reboundsasheplayedinacareer-high15gamesasaredshirtfreshman.* Earned increased throughout the season as compared to his freshman season when he played in only six game.* FloridaStatefinishedhissecondseasonwitha29-8overallrecord,a13-5ACCrecord,afourthplacefinishinthe ACC standings and an appearance in the Sweet 16 of the NCAA Tournament.

2017-18 Season* A redshirt season after an ankle injury limited him to just six games during his true freshman season.* Averaged0.7pointsand1.5reboundswhileappearinginsixgamesduringhisfirstseasonasaSeminole.* Totaled 2 points in his career debut against George Washington on Nov. 14.* Totaled 4 rebounds and 1 blocked shot in 8 minutes of play in Florida State’s victory over The Citadel on Nov. 24.

On Wilkes* GraduatedfromWinterParkHighSchoolin2017.* Earned All-State Class 8A Second Team honors as a senior.* All-Area First Team selection in 2015 and 2016 by the Orlando Sentinel.* Averaged17.4points,9.5reboundsand4.5assistspergameinhisseniorseason. 1,474

WyattWilkesscored1,474career points, was a

member of the Winter Park varsity for four seasons and averagedindoublefigurescoring in three of his four

seasons on the varsity

Forward

2019-20 Game-By-Game Statistics -- Wyatt WilkesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 8 0-1 .000 0-1 .000 0-0 .000 1-1 2 0 1 0 0 1 0N10 at Florida 2-0 6 0-1 000 0-1 .000 0-0 .000 0-0 0 1 1 0 0 0 0N15 Western Carolina 3-0 2 0-1 .000 0-1 .000 0-0 .000 0-0 0 1 0 0 0 0 0N20 Chattanooga 4-1 15 2-5 .400 1-4 .250 0-0 .000 1-1 2 0 0 1 0 1 5N23 St. Francis (Pa.) 5-1 16 5-7 .714 3-5 .600 1-1 1.000 1-1 2 1 0 1 0 0 14N25 Chicago State 6-1 18 2-7 .286 2-7 .286 2-2 1.000 1-2 3 2 2 0 1 1 8N29 vs.Tennessee 7-1 3 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 20: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

Will Miles’ Career HighsPTS ..........2 vs. Saint Francis (11-23-19)FGM ........1 vs. Saint Francis (11-23-19)FGA .........2 vs. Chattanooga (11-20-19)..................2 vs. Murray State (3-23-19)FG% ........1.000 vs. Saint Francis (11-23-19)3FGM ......3FGA .......1 vs. Murray State (3-23-19)..................1vs.SouthernMiss(12-21-17)..................1vs.TheCitadel(11-24-17)3FG% ......FTM .........1 vs. Wake Forest (2-13-19)FTA ..........2 vs. Wake Forest (2-13-19)FT% .........500 vs. Wake Forest (2-13-19)OR............1 vs. Saint Francis (11-23-19)DR ............1 at Georgia Tech (2-16-19)..................1vs.SouthernMiss(12-21-17)REBS .......1 vs. Saint Francis (11-23-19)..................1 at Georgia Tech (2-16-19)..................1vs.SouthernMiss(12-21-17)ASTS........1 vs. Chattanooga (11-20-19)STL ..........1 vs. Wake Forest (2-13-19)MIN .........4 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

13.7WillMilesaveraged13.7points in 30 games as a

senior at Trinity Prep as a senior in 2016. He led the Saints to a 24-6 record and

to the Class 4A regional finals

6-6, 220, Redshirt Junior, Orlando, Fla.

2019-20* AmemberofthreeNCAATournamentteamsinhisfirstthreeseasonsasamemberofthemen’sbasketballteamat Florida State.* Helped the Seminoles to the Elite Eight of the 2018 NCAA Tournament, the Sweet 16 of the 2019 NCAA Tournament andtotheSecondRoundofthe2017NCAATournament.* In his third season as a member of the basketball team at Florida State.* Missedhisentirefirstseason(2017-18)withabackinjury.* Made his 2019-20 debut with 1 assist in 3 minutes played in Florida State’s victory over Chattanooga

2018-19 Season* Averaged 0.2 points and 0.2 rebounds as he played in a career-high six games in his third season as a member of the Florida State Men’s Basketball team.* Playedinacareer-highsixgamesandscoredthefirstpointofhiscareerasaredshirtsophomore.* Played in a career-high three ACC games.* Earned 2 minutes of playing time in Florida State’s 90-62 win over Murray State in the NCAA Tournament.

2017-18 Season* Averaged0.0pointsand0.3reboundsinthreegamesduringthe2017-18season.* Averaged2.0pointsasheearnedplayingtimeinbothoftheSeminoles’exhibitiongamestobeginthe2017-18season.* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic.

2016-17 Season* JoinedtheSeminolemen’sbasketballteamforthe2016-17season.* Aredshirtseasonin2016-17.

On Will Miles* A third generation family member who is the fourth member of his family to play basketball at Florida State.* His father, an uncle and his grandfather all played basketball at Florida State.

Guard#33 Will Miles

2019-20 Game-By-Game Statistics -- Will MilesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 3 0-2 .000 0-0 .000 0-0 .000 0-0 0 0 1 0 0 0 0N23 St. Francis (Pa.) 2-0 1 1-1 1.000 0-0 .000 0-0 .000 1-0 1 0 0 0 0 0 2N25 Chicago State 3-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 2 0 1 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 21: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

Cleveland Yates

2019-20 Game-By-Game Statistics -- Cleveland YatesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N23 St. Francis (Pa.) 2-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N25 Chicago State 3-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Cleveland Yates’ Career HighsPTS ...........FGM .........FGA ..........FG% .........3FGM .......3FGA ........3FG% .......FTM ..........FTA ...........FT% .........OR.............DR .............REBS ........AST ...........BLK ..........STL ...........MIN ..........1 vs. Chicago State (11-25-19)................... 1 vs. Saint Francis (11-23-19)...................1 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20

#42 Guard6-2, 214, Freshman, Memphis, Tenn.

2019-20* Joined the team in the fall of 2019* Made his collegiate debut in Florida State’s victory over Chattanooga on Nov. 20

On Cleveland Yates* Began playing basketball in the second grade…played for M33M and Mike Miller in AAU Basketball* Has been nationally recognized for his leadership and community service* Was chosen by the National Civil Rights Museum to Co-Host the Freedom Award Student Forum honoring former Vice President Joe Biden, Rev. Jesse Jackson and Philanthropist Pitt Hyde in 2018* Cleveland and his parents launched the Kidz Do Pozitive Thingz TV Show when he was only nine years old. He served as host, musician and producer

2019Cleveland Yates led BriarcliffAcademyto

the Tennessee State High School Championship in

2019

Page 22: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

F L O R I D A S T A T E U N I V E R S I T Y

Ty Hands’ Career HighsPTS ...........FGM .........FGA ..........FG% .........3FGM .......3FGA ........3FG% .......FTM ..........FTA ...........FT% .........OR.............DR .............REBS ........AST ...........BLK ..........STL ...........MIN ..........underlined denotes career high established or tied during 2019-20 season

6-5, 180, Redshirt-Freshman, Palm Beach Lakes, Fla.

2019-20 Season* In his second season as a member of the Seminole men’s basketball team.* Hasfouryearsofeligibilityremainingbeginningwiththe2019-20seasonaftersufferingakneeinjurypriortothestart of the 2019-20 season.* Because of the injury, he took a redshirt season and has worked to get himself back into the Seminoles’ rotation for his second season at Florida State.* A member of the Seminoles’ NCAA Tournament Sweet 16 Team in 2019.

2018-19 Season* A redshirt season after undergoing surgery for a torn ACL in his right knee.* Underwent successful surgery on August 22, 2018.* Traveled to many of Florida State’s games and practiced with the team while rehabilitating his knee.

On Hands* Ty and his younger brother, Tre, are the sons of two FSU alum, Tera and Lorenzo Hands, a former Seminole star and four-year letterman at Florida State from 1988 to 1993.* Lorenzo was a member of four NCAA Tournament teams including Florida State’s 1993 Elite Eight team.* Afour-yearlettermanofthevarsitybasketballandtrackandfieldteamsatPalmBeachLakes.* Served as the team captain during his junior and senior seasons.* A member of the Palm Beach County Fab Five Team as a senior.

2019-20 Game-By-Game Statistics -- Ty HandsDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State DNPN29 vs. Tennessee DNPN30 vs. Purdue D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Ty Hands#44 Guard

14.7/5.4TyHandsaveraged4.7

points and 5.4 rbounds as a senior captain at Palm

Beach Lakes High School duringthe2017-18season

Page 23: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

Exhibition 1 -- Florida State 95,Barry 66

TALLAHASSEE, Fla. – Florida State’s exhibition opener provided a glimpse of what lies ahead for the Seminoles – both in the upcoming season and beyond. It also showed coach Leonard Hamilton a few things he’d like for his team to tighten up between now and the Seminoles’ season opener on November 6. So, in that sense, it was a near-perfect evening for FSU, which got 19 points and five assists from senior Trent Forrest in a 95-66 victory over Barry University at the Donald L. Tucker Center. Forrest, the central figure for an FSU team that lost its top two scorers from a year ago, was one of six Seminoles to finish in double-figures. Anthony Polite added 18 – including 16 in the second half – while RaiQuan Gray (10 points) and newcomers Patrick Williams (12, nine rebounds), Nathanael Jack (10), Dominik Olejniczak (10 points, seven rebounds) and Malik Osborne (seven points, seven boards) all enjoyed productive outings.

Florida State 95, Barry University 66Donald L. Tucker Center

Oct. 22, 2019Barry Min FG 3FG FT O-D Reb F A T B S Pts.Walshe 21 0-3 0-2 6-8 0-1 1 2 0 1 0 0 6Moya 17 2-7 1-5 0-1 0-3 3 1 2 3 0 1 5Birts 20 1-4 1-1 4-4 3-2 5 2 0 4 1 1 7Allende 17 0-5 0-3 0-0 0-2 2 1 1 0 0 0 0Dolven 24 1-4 0-0 1-3 2-3 5 4 1 2 0 0 3Perez 21 4-8 0-1 0-0 0-0 0 4 1 2 0 2 8Sheffield 7 2-3 2-2 0-0 1-2 3 0 2 0 0 0 6Marcinekvisius 3 0-0 0-0 01 0-1 0 0 0 0 0 0 0Kakar 18 4-8 2-4 2-2 2-1 3 1 0 4 0 0 12Scerbinskis 26 4-7 4-5 2-3 1-1 2 2 0 1 1 1 14Mikyska 9 0-0 0-0 0-0 1-0 1 2 0 2 0 0 0Dean 9 0-6 0-0 0-0 0-1 1 1 1 3 0 1 0Mejia 8 1-5 1-4 2-2 0-0 0 1 0 0 0 0 5Team 0-4 4 Totals 200 19-60 11-27 17-24 10-20 30 21 8 22 2 6 66

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 26 4-6 2-3 0-1 0-4 4 2 4 4 0 4 10Polite 22 7-9 3-4 1-1 0-2 2 3 0 0 1 3 18Forrest 21 7-10 0-1 5-6 1-2 3 1 5 3 1 1 19Williams 18 5-10 0-3 2-2 1-8 9 2 0 3 1 0 12Olejniczak 16 5-5 0-0 0-0 2-3 5 1 0 2 0 0 10Osborne 26 2-8 0-3 3-4 4-3 7 3 0 2 2 1 7Jack 24 3-12 3-13 1-2 4-3 7 4 0 1 0 0 10Lindner 16 0-0 0-0 0-2 0-1 1 2 3 2 0 0 0Prieto 5 0-1 0-0 1-2 1-0 1 1 0 2 0 0 1Wilkes 18 3-9 2-7 0-0 2-4 6 2 0 1 0 0 8Light 3 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Miles 5 0-0 0-0 0-0 1-2 3 2 0 0 0 0 0Team 0-3 3 Totals 200 36-70 10-31 13-20 16-35 51 23 12 22 5 9 95 FG% - Barry, .317, Florida State, .514. 3FG% - Barry, .407, Florida State, .323. FT% - Barry, .708. Florida State, .650. Technical Fouls: Barry -- None. Florida State -- None. Referees - Ray Styons, Les Jones, Anthony Burris

Barry 21 45 - 66Florida State 27 58 - 95

Exhibition 2 -- Florida State 84, Columbus State 54

TALLAHASSEE, Fla. – - In its final exhibition game before regular season play begins at Pittsburgh, Florida State earned an 84-54 victory over Columbus State at the Donald L. Tucker Civic Center. Sophomore Devin Vassell led three Seminoles in double figures with 18 points. Also in double figures were Anthony Polite with 16 points and freshman Patrick Williams with 10. The game saw some familiar faces returning to the court after missing Florida State’s exhibition victory over Barry. Both M.J. Walker and Devin Vassell made their highly anticipated season debuts and came back with a vengeance. Walker, who started and played nine first half minutes, totaled six points on two made 3-point shots. Vassell totaled 18 points (three-of-three three-pointers) and finished with six rebounds.

Florida State 84, Columbus StateDonald L. Tucker Center

Nov. 1, 2019Columbus Min FG 3FG FT O-D Reb F A T B S Pts.Thomas 19 0-5 0-3 0-0 0-1 1 1 1 2 0 2 0Givens 21 6-12 2-7 2-3 0-1 1 0 1 7 0 1 16Taylor 21 2-7 0-4 0-0 0-1 1 1 2 1 0 0 4Paulding 23 0-1 0-0 0-2 0-3 3 0 0 0 3 0 0Moore 24 2-3 0-0 2-4 0-2 2 0 1 1 0 3 6Horton, L 26 5-13 1-6 4-2 1-2 3 2 2 3 0 0 15Preston 16 2-3 0-0 1-0 1-4 5 1 1 0 0 0 5Porter-Wilson 14 1-3 0-0 0-0 1-1 2 2 2 0 0 0 2Horton, C. 8 1-3 1-3 0-0 0-0 0 2 0 0 0 0 3David, Jr. 6 0-3 0-2 0-0 0-1 1 0 0 2 0 0 0Ivey 4 1-2 1-2 0-0 0-0 0 1 0 0 0 0 3Jedenski 4 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Jones 2 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Kemp 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Gaines 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-0 2 Totals 200 20-56 5-28 9-13 3-18 21 10 10 17 3 6 54

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 20 1-4 0-0 2-2 2-6 7 0 3 3 0 3 4Forrest 28 1-5 0-2 0-0 0-3 3 2 7 2 0 2 2Osborne 20 3-11 0-0 1-1 2-6 10 0 0 1 0 0 7Walker 10 2-6 2-6 0-0 1-0 1 2 0 2 0 0 6Vassell 23 7-9 3-3 1-1 1-5 6 2 0 2 2 0 18Williams 23 5-11 0-2 0-0 3-1 4 1 1 3 0 1 10Koprivica 19 4-5 0-0 0-0 5-6 11 3 1 2 0 0 8Polite 25 5-9 2-4 4-4 0-1 1 2 2 2 0 3 16Jack 15 2-8 1-6 0-0 1-0 1 0 3 2 0 1 5Wilkes 14 2-5 1-3 1-2 4-2 6 0 1 0 0 1 6Lindner 2 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Light 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Prieto 2 0-0 0-0 0-0 0-1 1 0 0 1 0 0 0Team 2-3 5 Totals 200 33-74 9-26 9-10 22-34 56 12 18 20 2 11 84

FG% - Columbis Sate, .357, Florida State, .446. 3FG% - Columbus State, .179, Florida State, .346. FT% - Collumbus State, .692. Florida State, .900. Technical Fouls: Columbus State -- None. Florida State -- None. Referees - Leee Cassell, Jemel Spearman, Kellen Milner

Columbus State 29 55 - 54Florida State 41 43 - 84

Game 1 -- Pitt 63, Florida State 61

PITTSBURGH, Pa. – Reserves Ryan Murphy and TerrellBrown scored 13 points to lead Pitt to a 63-61 win over FloridaState in the season opener for both tems. The Panthers wondespite shooting just 31 percent (16 of 51) from the fi eld.Pitt survived by getting into the lane relentlessly against thebigger Seminoles, an approach that helped them outscoreFlorida State 22-13 at the free throw line. Senior guard TrentForrest led Florida State with 19 points. Devin Vassell added14 but the Seminoles couldn’t survive 14 turnovers and 27fouls. RaiQuan Gray, Malik Osborne and Balsa Koprivica allfouled out for Florida State. Florida State went up 40-31 on alayup by Osborne with 13:37 to play. The Panthers, however,responded. The Seminoles had a chance to tie it at the endof regulation but Patrick Williams missed a jumper with twoseconds to go. Anthony Polite grabbed the off ensive reboundbut couldn’t get a shot off before the buzzer. Florida Stateshot 40 percent (21 of 53) from the fl oor.

Pitt 63, Florida State 61Petersen Events Center

Nov. 6, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 27 3-6 0-2 1-2 2-1 3 5 2 1 0 0 7Osborne 23 1-4 0-2 0-0 2-7 9 5 0 1 4 0 2Forrest 39 8-16 1-3 2-3 0-2 2 2 2 5 1 2 19Walker 16 0-4 0-2 4-4 0-5 5 4 0 0 0 0 4Vassell 21 6-7 2-2 0-0 2-0 2 2 1 1 0 0 14Polite 25 2-10 2-6 2-2 1-3 4 3 0 3 0 1 8Williams 27 1-5 1-2 2-2 0-2 2 1 0 1 1 0 5Koprivica 6 0-0 0-2 2-2 1-0 1 5 0 1 0 0 2Wilkes 8 0-1 0-0 0-0 1-1 2 0 1 0 0 1 0Jack 3 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Prieto 5 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Team 1-2 3 Totals 200 21-53 6-20 13-15 10-25 35 27 6 14 6 4 61

Pitt Min FG 3FG FT O-D Reb F A T B S Pts.Hamilton 18 2-2 0-0 2-3 3-0 3 1 0 0 0 0 6Drumgoole, Jr. 20 0-4 0-3 0-0 0-1 1 1 1 2 0 1 0Johnson 38 3-11 2-4 5-8 0-6 6 3 1 2 0 2 13McGowens 34 2-6 2-5 4-6 1-6 7 4 5 6 0 1 10Toney 13 0-7 0-3 0-0 2-0 2 1 1 0 0 1 0Browne 22 4-5 0-0 5-6 2-1 3 2 0 0 0 0 13Murphey 31 3-7 3-6 4-4 1-3 4 1 3 2 0 0 13Champagnie 23 2-9 2-5 2-4 2-4 6 3 0 0 0 0 8Team 2-3 5 1 Totals 200 16-51 9-26 22-31 13-24 37 16 11 13 0 5 63 FG% - Florida State, .396, Pitt, .314. 3FG% - Florida State, .300, Pitt, .346. FT% - Florida State, .867. Pitt, .710. Technical Fouls: Florida State -- Walker. Pitt -- Champagnie. Referees - Ted Valentine, Mike Stephens, Tony Henderson

Florida State 25 36 - 61Pitt 25 38 - 63

Game 2 -- Florida State 63, Florida 51

GAINESVILLE, Fla. – Devin Vassell scored 13 points, M.J. Walker added 12 and Florida State upset No. 6 Florida 63-51 on Sunday, extending its series winning streak to six. The Seminoles (1-1) avoided their first 0-2 start since 2000 thanks to suffocating defense that forced the rival Gators (1-1) into 16 turnovers and a woeful shooting performance. Florida was 14 of 50 from the field, including 4 of 22 from 3-point range. A sellout crowd witnessed FSU take over late in the first half and really seize control after the break. The Gators went 10 minutes with just one field goal -- a dunk on an inbound play -- as Florida State pulled ahead 38-25 in the opening minutes of the second half. The ‘Noles went up by 14 on Anthony Polite’s 3-pointer with 9:31 to play. The Seminoles made 11 of their first 20 shots in the second half. They also finished with five blocked shots and eight steals.

Florida State 63, Florida 61Exactech Arena at Stephen C. O’Connell Center

Nov. 10, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 24 1-5 1-3 4-6 0-5 5 1 2 1 0 1 7Osborne 26 4-7 0-0 2-2 2-2 4 4 0 0 0 1 10Forrest 31 1-7 1-3 5-6 3-5 8 1 7 4 0 1 8Walker 32 3-10 1-5 5-6 0-3 3 1 1 2 0 1 12Vassell 34 6-15 1-3 0-1 2-4 6 1 0 0 1 2 14Polite 18 2-3 1-1 2-2 0-2 2 1 0 1 1 1 7Williams 16 2-4 0-1 0-0 1-4 5 2 0 1 3 1 4Kaprovica 6 1-2 0-0 0-0 0-0 0 3 0 0 0 0 2Olejniczak 7 0-1 0-0 0-0 1-1 2 2 0 0 0 0 0Wilkes 6 0-1 0-1 0-0 0-1 0 1 1 0 0 0 0Team 2-1 3 Totals 200 20-55 5-17 18-23 11-26 37 17 11 9 5 8 63

Florida Min FG 3FG FT O-D Reb F A T B S Pts.Johnson 30 8-12 1-2 2-2 1-3 4 2 0 4 0 0 19Blacksher 35 0-5 0-2 10-14 4-9 13 4 2 1 1 2 10Mann 23 1-6 1-4 2-2 0-2 2 4 0 1 0 0 5Nembhard 38 2-7 2-5 0-0 0-5 5 1 3 4 0 0 6Locke 30 1-11 0-7 0-0 0-3 3 1 1 2 0 0 2Lewis 22 0-4 0-2 4-4 1-0 1 3 0 1 3 1 4Payne 4 2-4 0-0 1-2 2-2 4 2 0 0 0 0 5Glover 6 0-1 0-0 0-0 0-0 0 1 0 0 0 0 0Jitoboh 2 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Team 5-2 7 3 Totals 200 14-50 4-22 19-26 13-26 39 19 6 16 4 3 51 FG% - Florida State, .364, Florida, .280. 3FG% - Florida State, .294, Florida, .182. FT% - Florida State, .783. Florida, .791. Technical Fouls: Florida State -- None. Florida -- None. Referees - Doug Shows, Tony Greene, Mike Eades

Florida State 25 38 - 63Florida 21 30 - 51

Game 3 -- Florida State 79, Western Carolina 74

TALLAHASSEE, Fla. – Freshman Patrick Williams and junior M.J. Walker each scored 18 points and Florida State rallied to top Western Carolina 79-74 in the Seminoles’ home opener. Forrest had 16 points for the Seminoles who trailed 41-24 with 3:41 left before halftime. Florida State gradually chipped away at the lead, going ahead for good with 45 seconds left in the second half as Williams made a layup. Mason Faulkner scored 21 points, including 12 in the first half, as WCU took a commanding early lead. The Catamounts made 7 of 14 3-pointers in the first half but cooled off and was just 2 of 9 in the second half. After Williams made a pair of free throws to give Florida State a 77-74 lead, Faulkner missed a long jumper with three seconds left as he hoped to make the shot and draw the foul in an attempt to tie it up and send the game to overtime. Florida State won its home opener, securing a 33rd straight nonconference victory at the Donald L. Tucker Center.

Florida State 79, Western Carolina 74Donald L. Tucker Center

Nov. 15, 2019W. Car. Min FG 3FG FT O-D Reb F A T B S Pts.Dotson 27 5-11 0-0 1-2 2-6 8 3 0 2 0 1 11Steger 31 3-8 1-4 2-3 2-3 5 5 1 3 0 3 9Halvorsen 36 3-8 3-6 0-0 0-2 2 1 2 1 0 0 9Faulkner 37 6-15 2-6 7-7 2-2 4 1 7 3 0 1 21Gibson 33 6-10 3-5 0-0 0-1 1 4 0 3 0 0 15McCray 13 2-4 0-1 0-0 0-1 1 3 0 0 0 0 4Cork 8 1-1 0-0 1-2 0-0 0 4 0 1 1 0 3Myers 5 0-1 0-1 0-0 1-2 3 0 0 0 0 0 0Sledd 5 1-2 0-0 0-0 1-0 1 1 0 0 0 0 2Harris 4 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Team 2-3 5 1 Totals 200 27-60 9-23 11-14 10-21 31 22 10 14 1 5 74

Page 24: FLORIDA STATE SEMINOLES (6-1, 0-1 ACC) VS PURDUE ... · Florida State, which has won 22 of its last 26 games (.846 winning percentage) dating to a 77-68 victory over Clemson on January

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 17 1-4 0-1 2-2 1-1 2 1 1 2 1 0 4Osborne 25 2-2 0-0 2-3 4-5 9 2 1 1 1 0 6Forrest 32 5-14 1-3 5-5 1-1 2 4 2 1 0 1 16Walker 26 5-11 3-6 5-7 0-4 4 3 2 1 1 0 18Vassell 32 4-9 0-3 2-4 1-4 5 2 2 1 1 0 10Evans 3 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Polite 24 1-4 1-4 0-0 0-2 2 0 1 2 1 2 3Williams 22 5-8 1-2 7-7 1-3 4 0 1 2 0 0 18Koprovica 10 2-2 0-0 0-0 1-1 2 3 0 3 1 0 4Wilkes 2 0-1 0-1 0-0 0-0 0 1 0 0 0 0 0Olenniczak 4 0-0 0-0 0-0 0-0 0 2 0 1 0 0 0Team 0-2 2 Totals 200 25-55 6-20 23-28 9-23 32 18 10 14 6 3 79 FG% - Western Carolina, .450, Florida State, .455. 3FG% - Western Carolina, .391, Florida State, .300. FT% - Western Carolina, .786. Floirida State, .821. Technical Fouls: Western Carolina -- None. Florida State -- None. Referees - Mark Schnur, Lamar Simpson, Jermey Mosier

Western Carolina 43 31 - 74Florida State 36 43 - 79

Game 4 -- Florida State 89, Chattanooga 53

TALLAHASSEE, Fla. – Devin Vassell scored a career-high 17 points and pulled down a career-high eight rebounds while Patrick Williams added 16 points as Florida State cruised to an 89-53 rout of Chattanooga. Ole Miss graduate transfer Dominik Olejniczak scored his first points at Florida State, going five for six from the floor for 10 points and grabbed three rebounds. The Seminoles shot 34 of 65 (52.3%) from the floor. David Jean-Baptiste had 15 points for Chattanooga. Rod Johnson had 11 points and six rebounds for the Mocs, who shot 23 of 59 (39%).

Florida State 89, Chattanooga 53Donald L. Tucker Center

Nov. 20, 2019UTC Min FG 3FG FT O-D Reb F A T B S Pts.Johnson 25 5-13 1-6 0-0 1-5 6 0 1 1 1 0 11Vila 26 4-6 0-0 0-0 0-2 2 2 1 0 2 0 8Ryan 25 3-6 3-6 1-2 1-1 2 4 0 2 1 1 10Jean-Baptiste 28 7-13 0-4 1-4 0-4 4 0 1 5 0 0 15Commander 30 1-6 0-2 0-0 0-2 2 2 3 0 0 1 2Scott 14 0-2 0-0 0-0 1-1 2 3 1 2 0 0 0Doomes 12 1-3 0-1 0-0 1-3 4 3 0 3 0 0 2Caldwell 11 0-2 0-2 0-0 0-1 1 0 1 0 0 0 0Brown 11 0-0 0-0 0-0 0-3 3 0 0 0 1 1 0Ledford 10 1-4 0-2 0-0 2-0 2 2 0 3 0 0 2Obidiebube 4 0-3 0-0 0-0 2-0 2 1 0 0 0 1 0Tostado 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Smith 1 1-1 1-1 0-0 0-0 0 0 0 0 0 0 3Team 0-0 0 Totals 200 23-59 5-24 2-6 8-22 30 17 8 16 5 4 53

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 20 4-10 1-3 1-1 0-3 3 1 2 1 0 0 10Wilkes 15 2-5 1-4 0-0 1-1 2 0 0 1 0 1 5Polite 25 0-4 0-3 1-2 0-2 2 1 0 1 0 0 1Forrest 30 2-4 0-1 1-2 0-4 4 1 7 4 2 1 5Vassell 26 6-10 3-5 2-2 3-5 8 1 1 1 2 1 17Evans 14 0-1 0-0 4-6 0-0 0 0 2 1 0 4 4Williams 20 6-10 2-3 2-2 1-2 3 0 3 0 0 2 16Koprivica 12 5-6 0-0 0-2 3-4 7 1 1 0 1 0 10Jack 14 2-5 2-5 0-0 1-4 5 1 1 1 0 1 6Olejniczak 8 5-6 0-0 0-0 2-1 3 1 0 0 0 0 10Lindner 5 0-0 0-0 0-0 0-1 1 0 2 1 0 0 0Light 3 1-1 1-1 0-0 0-0 0 0 0 0 0 0 3Prieto 3 1-1 0-0 0-0 0-1 1 0 0 0 0 0 2Miles 3 0-2 0-0 0-0 0-0 0 0 1 0 0 0 0Yates 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-2 2 Totals 200 34-65 10-25 11-17 11-30 41 7 20 11 5 10 89 FG% - Chattanooga, .390, Florida State, .523. 3FG% - Chattanooga, .208, Florida State, .400. FT% - Chattanooga, .333. Floirida State, .647. Technical Fouls: Chattanooga -- None. Florida State -- None. Referees - Ted Valentine, Brian Dorsey, Joff Pon

Chattanooga 29 24 - 53Florida State 41 48 - 89

Game 5 -- Florida State 80, Saint Francis 65

TALLAHASSEE, Fla. – Wyatt Wilkes scored a career-high 14 points while Trent Forrest added 13 points and five re-bounds as Florida State defeated Saint Francis (Pa.) 80-65. A redshirt sophomore, Wilkes had scored just five points in four games this season before turning in an unexpected five of seven performance from the floor against the Red Flash. Wilkes also knocked down 3-of-5 3-pointers. Myles Thompson scored a career-high 23 points, knocking down 9 of 12 shots for Saint Francis. Thompson came into the game averaging eight points. Forrest was 7 of 7 at the free-throw line as the Seminoles continued to impress by going 15 of 17 at the charity stripe. Florida State came into the game as the only ACC team shooting better than 75 percent from the free-throw line. Freshman center Balsa Koprivica has had back-to-back double-digit scoring games, finishing with 11 points on 5 of 6 shooting versus the Red Flash. Florida State won its 35th straight non-conference home game, a streak that dates nearly five years.

Florida State 80, Saint Francis (Pa.) 65Donald L. Tucker Center

Nov. 23, 2019SFU Min FG 3FG FT O-D Reb F A T B S Pts.Thompson 31 9-12 4-5 1-1 0-4 4 1 0 3 0 1 23Kuzavas 19 0-2 0-0 0-0 1-1 2 4 0 1 1 0 0Meredith 28 1-8 1-6 0-0 0-1 1 2 2 3 0 0 3Gaskins 24 2-3 1-2 2-2 0-2 2 3 1 2 0 2 7Braxton 35 2-9 1-4 8-8 1-4 5 2 3 5 0 1 13Stewart 24 5-15 2-4 2-2 2-2 4 0 1 2 1 2 14Flagg 16 0-1 0-0 0-0 0-0 0 3 0 1 1 1 0Dixon-Conver 13 0-2 0-0 0-0 1-1 2 1 1 4 0 1 0Laskey 4 0-1 0-1 0-0 0-1 1 2 0 0 0 0 0Ikediashi 2 0-0 0-0 3-4 1-1 2 1 0 0 0 0 3Labriola 2 0-0 0-0 0-0 1-0 1 0 1 0 0 0 0Henry 1 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Team 3-0 3 Totals 200 20-54 9-22 16-17 10-17 27 19 9 21 3 8 65

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 24 3-7 3-5 0-0 1-3 4 2 0 1 2 0 9Olejniczak 13 1-3 0-0 2-2 4-0 4 2 0 2 1 0 4Polite 29 3-6 2-4 0-0 1-6 7 0 2 5 1 5 8Forrest 26 3-7 0-1 7-7 1-4 5 1 4 3 0 2 13Vassell 17 2-4 0-0 0-0 0-1 1 4 1 0 0 1 4Williams 22 2-6 0-2 2-2 1-4 5 1 1 5 1 1 6Koprivica 22 5-6 0-0 1-3 2-1 3 0 0 0 0 2 11Evans 17 2-5 0-1 2-2 1-1 2 1 5 0 0 0 6Wilkes 16 5-7 3-5 1-1 1-1 2 1 0 1 0 0 14Jack 9 1-5 1-5 0-0 0-1 1 1 2 2 0 0 3Prieto 2 0-2 0-1 0-0 0-0 0 1 0 0 0 0 0Lindner 1 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Light 1 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Miles 1 1-1 0-0 0-0 1-0 0 0 0 0 0 0 2Yates 1 0-0 0-0 0-0 0-0 1 0 0 0 0 0 0Team 2-1 3 Totals 200 28-60 9-25 15-17 15-23 38 15 15 19 5 11 80 FG% - Saint Francis, .370, Florida State, .467. 3FG% - Saint Francis, .409, Florida State, .360. FT% - Saint Francis, .941. Floirida State, .882. Technical Fouls: Saint Francis -- None. Florida State -- None. Referees - Mike Roberts, Jerry Heater, Warl Walton

Saint Francis 36 29 - 65Florida State 48 32 - 80

Game 6 -- Florida State 113, Chicago State 56

TALLAHASSEE, Fla. – Devin Vassell and Patrick Williams scored 16 points apiece as Florida State had its best shoot-ing night of the year in a 113-56 win over Chicago State. Nathanael Jack added 14 points for the Seminoles, who shot 73.3% in the first half as they took a 65-29 lead at the break. Andrew Lewis scored 18 points for Chicago State (3-4). Trent Forrest scored 12 points for Florida State, which finished 38 of 58 (65.5%) from the floor. Balsa Koprivica and RaiQuan Gray each had seven rebounds for Florida State, which won the rebounding battle 43-20. This was the first time the Seminoles scored 100 points in regulation since a 113-78 win over The Citadel on Nov. 24, 2017. Twelve Semi-noles scored points in one of the more dominating victories in school history. Florida State’s 57-point margin of victory was just outside the top five in school history.

Florida State 113, Chicago State 56Donald L. Tucker Center

Nov. 25, 2019Chi. St. Min FG 3FG FT O-D Reb F A T B S Pts.Jones 17 0-3 0-1 2-2 1-0 1 5 0 2 0 2 2Colley 26 3-8 0-1 0-4 1-1 2 4 0 1 0 1 6Hunt 31 5-6 0-0 0-1 2-2 5 2 0 3 0 1 10lewis 26 5-13 2-3 6-7 0-2 2 2 0 3 0 1 18Johnson 27 3-10 1-5 2-2 1-2 3 2 0 7 0 2 9Gholizadeh 25 2-7 0-2 4-0 2-1 3 2 2 2 0 0 8Bigirumwami 21 0-1 0-0 0-0 1-0 1 3 1 2 0 2 0Johnson 14 0-1 0-1 1-2 0-0 0 0 0 1 0 0 1Whitehead 13 1-3 0-1 0-0 1-0 1 1 0 1 0 0 2Team 1-1 2 Totals 200 19-52 3-14 15-26 11-9 20 21 3 22 0 9 56

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 15 2-2 0-0 0-0 2-3 5 1 1 0 0 0 4Olejinczak 16 3-4 0-0 2-2 1-3 4 2 0 2 2 0 8Polite 15 3-4 1-1 2-2 2-2 4 0 5 0 0 3 9Forrest 15 5-8 2-2 0-0 0-2 2 0 6 2 0 3 12Vassell 13 6-7 1-2 3-4 2-0 2 0 1 1 0 3 16Evans 22 2-4 0-2 2-2 0-0 0 3 2 2 0 1 6Gray 16 1-3 0-2 4-4 2-5 7 3 1 3 0 1 6Williams 20 6-8 0-1 4-4 1-2 3 3 1 1 0 1 16Koprivica 18 3-4 0-0 4-5 2-5 7 1 0 2 0 0 10Wilkes 19 2-7 2-0 2-2 1-2 3 2 2 0 1 1 8Jack 15 4-6 4-7 2-2 0-1 1 3 2 0 0 0 14Prieto 16 0-0 0-6 0-2 1-1 2 1 0 0 0 0 0Lindner 4 1-1 0-0 2-2 0-2 2 1 0 2 0 0 4Light 4 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Miles 4 0-0 0-0 0-0 0-0 0 2 0 1 0 0 0Yates 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-1 1 Totals 200 38-58 10-23 27-31 14-29 43 23 21 16 13 3 113

FG% - Chicago State, .365, Florida State, .655. 3FG% - Chicago State, .214, Florida State, .435. FT% - Chicago State, .577. Florida State, .871. Technical Fouls: Chicago State -- None. Florida State -- None. Referees - Bert Smith, Raymie Styons, Clarence Armstrong

Chicago State 29 27 - 56Florida State 65 48 - 113

Game 7 -- Florida State 60, Tennessee 57

NICEVILLE, Fla. – Florida State held No. 16 ranked Tennes-see to a season-low 33.3 percent shooting en route to a 60-57 victory that advanced the Seminoles into the championship of the sixth annual Emerald Coast Classic held at Northwest Florida State College. Florida State, winning its sixth straight game, moved to 6-1 and will play Purdue for the championship. Guard Lamonte Turner scored a game-high 20 points for Ten-nessee which its suffered its first loss of the season falling to 5-1. Tennessee committed a season-high 21 turnovers with Florida State scoring 23 points off those miscues. Sophomore guard Devin Vassell led Florida State with 13 points, while MJ Walker collected 10 points. The Seminoles came out firing to open the game, making six of their first eight shots to race to a 10-2 lead.

Florida State 60, Tennessee 57The Arena at Northwest Florida State College

Nov. 29, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Forrest 34 3-11 0-0 3-5 0-4 4 2 4 8 1 1 9Osborne 16 1-1 1-1 1-4 2-4 6 1 0 0 0 3 4Olejniczak 14 1-3 0-0 0-0 2-2 4 4 0 0 0 2 2Walker 24 3-10 1-3 3-5 1-2 3 3 2 1 0 0 10Vassell 30 2-9 1-4 8-10 1-4 5 3 0 0 0 3 13Evans 7 1-4 0-0 0-0 0-0 0 2 0 0 0 0 2Gray 18 1-3 0-0 0-0 0-0 0 1 0 1 1 0 2Polite 17 1-5 0-3 0-0 0-1 1 2 0 0 0 1 2Williams 18 4-6 0-0 0-1 0-2 2 0 1 2 0 1 8Koprivica 19 2-2 0-0 4-4 1-2 3 3 0 1 0 2 8Wilkes 3 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 1-2 3 Totals 200 19-54 3-11 19-29 8-23 31 21 7 13 2 13 60

Tenn. Min FG 3FG FT O-D Reb F A T B S Pts.Turner 36 4-14 1-4 11-14 0-3 3 2 2 8 0 1 20James 29 2-6 0-3 5-5 2-5 7 4 1 5 2 0 9Fulkerson 29 1-2 0-0 0-0 1-1 2 5 2 1 1 1 2Bowden 37 3-10 2-7 3-3 1-4 5 3 0 2 0 1 11Pons 38 4-8 2-6 3-4 1-9 10 2 0 1 3 0 13Gaines 15 0-1 0-1 2-3 0-1 1 0 0 0 0 1 2Pember 6 0-1 0-1 0-0 0-1 1 2 0 0 0 0 0Johnson 2 0-0 0-0 0-0 0-0 0 0 0 2 1 0 0Nkamhoua 8 0-0 0-0 0-0 1-2 3 2 0 2 0 0 0Team 1-0 1 Totals 200 14-42 5-22 24-29 7-26 33 20 5 21 7 4 57

FG% - Florida State, .352, Tennessee, .333. 3FG% - Florida State, .273, Tennessee, .227. FT% - Florida State, .655. Tennessee, .828. Technical Fouls: Florida State -- Team, 2. Tennessee -- None. Referees - Doug Shows, Jeff Anderson, Ron Groover

Florida State 29 31 - 60Tennessee 24 33 - 57


Top Related