business interstate 85 at new cut road · special note: the completion or persistence rate for...
TRANSCRIPT
Business Interstate 85 at New Cut RoadPost Office Box 4386
Spartanburg, South Carolina 29305864•591•3600 Fax: 864•591•3642
Spartanburg Technical College1998-1999 Catalog
Academic Calendar........................................................................................................2
An Introduction to the College ..................................................................................3-14Administration ....................................................................................................................................... 4Career Programs ................................................................................................................................ 5-6College Mission ..................................................................................................................................... 6Role and Scope ..................................................................................................................................... 7College Values .................................................................................................................................... 8-9Student Outcomes ................................................................................................................................ 9Historical Overview ........................................................................................................................ 10-11Accreditations ........................................................................................................................................ 7Continuing Education/Industry and Business Training ................................................................... 12Facility Services at STC ....................................................................................................................... 12Map of Spartanburg Technical College ............................................................................................. 13Map of Duncan Center ....................................................................................................................... 14
Admissions ...............................................................................................................15-24Admissions Policies ............................................................................................................................. 16Admissions Procedures ................................................................................................................. 16-18Transfering Credits ........................................................................................................................ 17-18Transfer in Public Two-Year Institutions ...................................................................................... 18-21Special Admissions Procedures ..................................................................................................... 22-24Orientation .......................................................................................................................................... 24
Services for Students ...............................................................................................25-30Bookstore ............................................................................................................................................ 26Cafeteria ............................................................................................................................................... 26Campus Safety and Security ............................................................................................................... 26Career Planning and Placement ......................................................................................................... 26Cooperative Program for the Deaf and Blind .............................................................................. 28-29Counseling and Career Development .......................................................................................... 27-28Early Registration ................................................................................................................................ 27Evening Services ................................................................................................................................. 27Health Services .................................................................................................................................... 27Housing Information .......................................................................................................................... 27Identification Cards ............................................................................................................................ 27Insurance ............................................................................................................................................. 27Library ............................................................................................................................................. 27-28Parking ................................................................................................................................................. 28Release of Student Information ......................................................................................................... 28Services to Students with Disabilities ........................................................................................... 28-29Student Activities ................................................................................................................................ 29Student Due Process .......................................................................................................................... 29Student Council .................................................................................................................................. 29
Table of Contents
i
Success Network ................................................................................................................................. 29Transitional Studies ....................................................................................................................... 29-30 Tutorial Learning Center (TLC): Writing Lab, Math Lab, Accounting Lab, Testing Lab
Financial Matters ...................................................................................................................... 31-42College Costs ....................................................................................................................................... 32How to Pay .......................................................................................................................................... 39Financial Assistance ............................................................................................................................ 34Overpayment ....................................................................................................................................... 40Refund Policy and Procedures ........................................................................................................... 39Support from the STC Foundation .................................................................................................... 41
Academic Procedures .............................................................................................43-50Academic Policies ........................................................................................................................... 44-49
Arts & Sciences Division ..........................................................................................51-58Associate in Arts ............................................................................................................................. 53-54Associate in Science ....................................................................................................................... 53-55Interpreter Training ....................................................................................................................... 55-56Horticulture Technology ............................................................................................................... 56-57Landscape Management ..................................................................................................................... 58
Business Technology Division .................................................................................59-78Accounting ..................................................................................................................................... 61-62Automated Office ........................................................................................................................... 63-64System Support Technician .......................................................................................................... 64-65Computer Technology .................................................................................................................. 66-67Management-Fire Service Elective ................................................................................................ 68-69Management-Hospitality Elective ................................................................................................. 69-71Management -Marketing Elective.................................................................................................. 71-72Management-Information Technology Elective........................................................................... 73-74Management-Textile Management Elective ................................................................................. 75-76Office Systems Technology ........................................................................................................... 76-78
Health Sciences Technology Division ...................................................................79-108Application Procedure for Health Sciences ...................................................................................... 81General Requirements for Health Sciences Programs ..................................................................... 82Advanced Child Care Management ............................................................................................... 82-83Dental Assisting .............................................................................................................................. 83-85Early Childhood Development ..................................................................................................... 85-87Health Sciences .............................................................................................................................. 87-88Health Unit Coordinating .............................................................................................................. 88-89Medical Assisting ............................................................................................................................ 89-90Medical Laboratory Technology .................................................................................................... 90-92Multi-Skilled Health Technology .................................................................................................. 92-93
Table of Contents
ii
Office Systems Technology with Medical Option ........................................................................ 93-94Practical Nursing ............................................................................................................................ 94-95Pre-Dental Hygiene ....................................................................................................................... 96-97Pre-Health Information Management ........................................................................................... 97-99Pre-Occupational Therapy Assistant ........................................................................................... 99-100Pre-Physical Therapist Assistant ................................................................................................ 100-102Radiologic Technology .............................................................................................................. 102-104Respiratory Care ......................................................................................................................... 104-106Surgical Technology .................................................................................................................. 106-108
Industrial and Engineering Technologies Division ..........................................109-144
Engineering Technology ......................................................................................110-124Architectural Computer Aided Drafting .......................................................................................... 111Civil Engineering Technology ................................................................................................... 112-113Electronics Engineering Technology ........................................................................................ 114-115Engineering Graphics Technology with Architectural Computer Aided Drafting ............................................................................ 116-117Engineering Graphics Technology with . Mechanical Computer Aided Drafting .............................................................................. 118-119General Engineering Technology ............................................................................................. 120-121Mechanical Engineering Technology ....................................................................................... 121-123Mechanical Computer Aided Drafting ............................................................................................. 123
Industrial Technology .........................................................................................125-144Air Conditioning and Refrigeration ................................................................................................. 126Automotive Technology (Ford ASSET) .................................................................................... 127-128Computer Numerical Control Operator ................................................................................... 128-129Basic Electronics ........................................................................................................................ 129-130General Technology .................................................................................................................. 130-132Graphic Preparation Technology .............................................................................................. 132-133Heating, Ventilation, and Air Conditioning Technology ......................................................... 133-134Industrial Electronics Technology ............................................................................................ 134-136Industrial Electronics Technology Automated Manufacturing Technology Option ................................................................ 136-137Industrial Mechanics .................................................................................................................. 138-139Machine Tool Technology ......................................................................................................... 139-140Printing Technology ......................................................................................................................... 141Welding ....................................................................................................................................... 142-143
Course Descriptions ............................................................................................145-188
Faculty and Staff Listing .....................................................................................189-202
Index ....................................................................................................................203-208
Table of Contents
iii
Table of Contents
Special Information
Consumer InformationInformation on costs, refunds, financial assistance, student eligibility, academic pro-grams, etc., may be obtained by writing the Office of the Dean of Students at Spartanburg Technical College. Catalog contents are subject to change.
English Fluency of FacultyIt is the policy of Spartanburg Technical College to employ means to ensure that faculty members, whose first language is other than English, possess adequate proficiency in writing and speaking the English language. Further, provisions will be made to allow for grievance procedures for students regarding the English fluency of an instructor. Contact the dean of students for specific procedures.
Non-Discrimination StatementSpartanburg Technical College does not discriminate on the basis of race, color, religion, age, sex, national origin/ethnic origin or disability in its admissions policies, programs, activities or employment practices.
NoteFailure to read this publication does not excuse students from rules and procedures described herein. Personal factors, illness, or contradictory advice from any source is not acceptable grounds for seeking exemption from these rules and procedures. Spartanburg Technical College reserves the privilege of changing, without notice, any information in this catalog.
Postmaster Information: "1998-1999 College Catalog," published March 1998, Spartan-burg Technical College, Post Office Box 4386, Spartanburg, S.C. 29305.
Special Note: The completion or persistence rate for first-time students who entered Spartanburg Technical College on a full-time basis in the fall of 1993 was 26 percent as measured three years later. This figure includes those students who are still enrolled, those who received a degree, diploma, or certificate at Spartanburg Technical College, but does not include those students who transferred.
If special accommodations or assistance will be needed, contact Sharon Bellwood, direc-tor of student disability services, (864) 591-3811 (voice and TDD).
The ADA/504 coordinator is Regina Eaker, director of human resources, (864) 591-3706 (voice and TDD).
The EEO/Title 9 coordinator is Henry Giles, senior vice-president, (864) 591-3616.
World Wide Web Address:Spartanburg Technical College's homepage address is www.spt.tec.sc.us
iv
v
Welcome to Spartanburg Technical College!
W elcome to Spartanburg Technical College. By enrolling in our College you are making an investment for a lifetime. The hours you spend in the classroom and the energy you exert studying will be a major com-mitment during the months ahead. As president, I am confident of your ability to work hard and become a STC graduate. Our fac-ulty and staff are happy you chose our College and we want to help you reach your goals. The Upstate has enjoyed tremen-dous growth and prosperity during the last decade. This trend is pre-dicted to continue to the Year 2000 and beyond. Our College has played an integral part in this success. The primary mission of Spartanburg Technical College is to educate tomorrow’s work force. Whether you are seeking a one-year certificate, an associate degree or completing the first two years of an undergraduate degree, it is my desire that you accomplish your objective. Over your lifetime the investment you’re making now can be returned to you time and time again through increased earnings, greater job satisfaction, more opportunities for promotion and a heightened aware-ness of ways to improve the quality of life for yourself, your family and your
community. As I see students investing their time and money in preparing for their future, it makes me acutely aware that our College must contin-ue to upgrade its facilities, programs
and services. The administration is seeking ways to update our build-ings, improve training equip-ment, increase computer i zed workstations, ex-pand multimedia instruction and offer courses that will prepare our students to com-pete in a global economy. I invite your feedback as you see ways to make STC a better
educational institution. We began serving students in the mid-1960’s. During the past thirty years the College has earned a repu-tation for providing individuals with a quality education at an affordable price. The task of educating tomor-row’s work force over the next thirty years will be an enormous challenge. The support of our students and their families will play an important role as we move forward. We will be suc-cessful with this endeavor through
Dr. Dan L. TerhunePresident
1998-1999 Academic Calendar
Fall Term 1998August 18 ............................................................................................................................ Curriculum Registration
August 24 .................................................................................................................................................Classes Begin
September 7 ...............................................................................................................Labor Day (College Closed)
November 2 .............................................................................................No Classes, Optional Faculty Workday
November 3 ............................................................................................................. Election Day (College Closed)
November 25 ..........................................................................................No Classes, Optional Faculty Workday
November 26, 27 ...............................................................................Thanksgiving Holidays (College Closed)
December 7 .................................................................................................................................. Last Day of Classes
December 8, 9, 10, 11 .............................................................................................................................. Final Exams December 21 - January 1 ...................................................................Christmas Holidays (College Closed)**
Spring Term 1999
January 6 ........................................................................................................................... Curriculum Registration
January 11 ................................................................................................................................................Classes Begin
March 1, 2 .................................................................................................No Classes, Optional Faculty Workday
April 5-9........................................................................................................................ Spring Break (No Classes)**
April 28 ........................................................................................................................................... Last Day of Classes
April 29, 30, May 3, 4............................................................................................................................... Final Exams
Summer Term 1999 May 12 .................................................................................................................................. Curriculum Registration
May 17 .....................................................................................................................................................Classes Begin
May 21 ...........................................................................................................................................................Graduation
June 15 ......................................................................................................................Summer Mini-Session Begins
July 2 ..........................................................................................................No Classes, Optional Faculty Workday
July 5 ....................................................................................................................................Holiday (College Closed) July 12 ........................................................................................................No Classes, Optional Faculty Workday
July 20 ............................................................................................................................................. Last Day of Classes
July 21, 22 ................................................................................................................................................... Final Exams
Please note: These dates are subject to change in the case of extenuating circumstances, such as inclement weather.
* *Christmas and Spring Holidays will follow the same schedule as the public schools.
Academic Calendar
2
3
An In
trodu
ctio
n to
the
Colle
ge
4
5
Introduction
Spartanburg Technical College AdministrationDan L. Terhune ...................................................................................................PresidentHenry C. Giles, Jr. .......................................................................... Senior Vice PresidentSusan A. Graham ................................................... Vice President of Academic AffairsJoEllen Cantrell ...............................................Director of Planning and DevelopmentHarold D. McClain .....................................................................Dean, Student ServicesFred P. Herren ...................................................Dean, Industry and Business Training
Spartanburg County Commission for Technical Education
Geary C. Jolley, Secretary, School District No. 1 .............................................Term expires 2001Debra C. Moore, School District No. 2 .............................................................Term expires 1999Danny T. Phillips, School District No. 3 ...........................................................Term expires 2000Donald B. Hunt, School District No. 4 .............................................................Term expires 2001Cecil L. Hutcherson, School District No. 5 ......................................................Term expires 2000 William G. Sarratt, School District No. 6 .........................................................Term expires 2001Benjamin D. Snoddy, Chairman, School District No. 7 .................................Term expires 2000
At LargeRosemary H. Byerly ............................................................................................Term expires 1997Susan A. Fretwell, Vice Chair ............................................................................Term expires 1999James M. Folk ......................................................................................................Term expires 2001Hubert C. Dobson ...............................................................................................Term expires 1999
Ex-OfficioJames O. Jennings ..............................................................Superintendent, School District No. 2Albert B. Jolly, Jr. ................................. Chairman, Spartanburg County Planning Commission
S.C. State Board for Technical and Comprehensive Education
Col. Eugene D. Foxworth, Jr. ............................................................... 1st Congressional DistrictCathy B. Novinger .............................................................................. 2nd Congressional DistrictP. Henderson Barnette, Chairman ..................................................... 3rd Congressional DistrictRobert H. Chapman, III ........................................................................4th Congressional DistrictClarence H. Hornsby, Jr., Vice Chairman ...........................................5th Congressional DistrictWm. Reynolds Williams .......................................................................6th Congressional DistrictOscar E. Prioleau .................................................................................................. Member at LargeThomas L. Gregory .............................................................................................. Member at LargeMaj. Gen. James A. Grimsley, Jr. ......................................................................... Member at LargeMax Earwood........................................................................................................ Member at Large
Ex-OfficioBarbara Nielsen ......................................................................State Superintendent of EducationRobert V. Royall, Jr. ....................................................................................Secretary of CommerceMichael B. McCall ..............................................................................................Executive Director
5
6
Introduction
Career ProgramsAssociate Degree in Agricultural Technology: Horticulture Technology
Associate Degree in Arts
Associate Degree in Business Technology: Accounting Management-Fire Service Electives Management-Hospitality Electives Management-Information Technology Electives Management-Marketing Electives Management-Textile Management Electives OfficeSystemsTechnology OfficeSystemsTechnology-MedicalOption
Associate Degree in Computer Technology: Computer Technology
Associate Degree in Engineering Technology: Civil Engineering Technology Electronics Engineering Technology Engineering Graphics Technology with Architectural Drafting Engineering Graphics Technology with Mechanical Drafting General Engineering Technology Mechanical Engineering Technology
Associate Degree in Health Sciences: Medical Laboratory Technology Radiologic Technology Respiratory Care
Associate Degree in Industrial Technology: Automotive Technology (Ford ASSET) Heating, Ventilation, and Air Conditioning Technology Industrial Electronics Technology Industrial Electronics Technology with Automated Manufacturing Technology Option Machine Tool Technology
Associate Degree in Occupational Technology: General Technology Associate Degree in Public Service: Interpreter Training
Associate Degree in Science
Career Programs continued on next page ...
6
Introduction
College MissionSpartanburg Technical College is a comprehensive, public, suburban, two-year technical col-lege serving the citizens of the upstate counties of Spartanburg, Union, and Cherokee in South Carolina. The College advances economic development of the region through programs that address emerging and continuing employment needs in a rapidly changing global en-vironment. Programs and services provide accessible, affordable, equitable, state-of-the-art, postsecondary education that effectively (1) prepares students to enter, adapt to, or advance intechnicalorservicecareerfields;(2)providesstudentswithpre-baccalaureateprogramsandcourseswhichtransfertoseniorcollegesanduniversities;and(3)assistsstudentsinachieving their professional and personal goals. Annually, the College serves 2,500 to 4,000 credit-seeking students and 9,000 to 12,000 continuing education students.
Career Programs continued ...Diploma Programs: AutomatedOffice Early Childhood Development Dental Assisting Industrial Mechanics Medical Assisting Practical Nursing Respiratory Care Surgical Technology System Support Technician Welding
Certificate Programs: Advanced Child Care Management Air Conditioning and Refrigeration Architectural Computer Aided Drafting Basic Electronics Computer Numerical Control Operator Early Childhood Development Graphic Preparation Technology Health Sciences Health Unit Coordinating Landscape Management Mechanical Computer Aided Drafting Multi-Skilled Health Care Technology Pre-Dental Hygiene Pre-Health Information Management Pre-Occupational Therapy Assistant Pre-Physical Therapist Assistant Printing Technology Welding
7
Introduction
Role and ScopeSpartanburg Technical College, an institution of the South Carolina Technical Education System, provides a wide range of instructional programs which include associate degree, diploma, certificate,occupational advancement, andcommunity interest courses. Theseprogramsservestudentswhoareseekingcareerpreparation,entry-leveljobskills,thefirsttwo years of a baccalaureate degree, or personal or professional development. The College is an open access college serving the diverse needs of the adult population in its service area. College-level Credit ProgramsIn response to local business and industry needs, the College offers college credit educa-tional programs in Engineering Technology, Industrial Technology, Computer Technology, Business, Horticulture, Health Sciences, and Public Service leading to associate degrees, diplomas,andcertificates.TheCollegeoffersuniversitytransferopportunitiesthroughtheAssociate of Arts and Associate of Science programs to meet the needs of students whose long-range goals are obtaining baccalaureate degrees.
Continuing Education ProgramsThe College advances the economic development of the region through training to meet the unique human resource development needs of both new and existing business and indus-try. Course offerings provide professional and personal growth opportunities to business, industry, and the community at large. Student Development ServicesThe College offers developmental services which enhance students’ opportunities for career success and their potential for personal and educational growth. Recruitment, counseling, and support services are provided to all students. Special programs and services increase access and equity for minority students, students with disabilities, and other students who are not historically served by higher education.
Transitional StudiesThe College assists underprepared students in developing skills necessary to enter college-level programs. Aggressive developmental education programs stress mastery of basic academic skills and provide tools to encourage and enable students to become successful.
AccreditationsSpartanburg Technical College is accredited by the Commission on Colleges of the Southern AssociationofCollegesandSchoolstoawardassociatedegrees,diplomas,andcertificates.
The College offers programs accredited by the following:•TechnologyAccreditationCommissionof theAccreditationBoardforEngineeringand
Technology: -Civil Engineering Technology -Electronics Engineering Technology -Mechanical Engineering Technology•CommissiononAccreditationofAlliedHealthEducationPrograms•CommissiononDentalAccreditation,AmericanDentalAssociation•SouthCarolinaDepartmentofNursingBoard-Labor,LicensingandRegulation•NationalAccreditingAgencyforClinicalLaboratorySciences•JointReviewCommitteeforEducationinRadiologicTechnology•CommitteeonAccreditationforRespiratoryCare• NationalAutomotive Technicians Education Foundation -Automotive Service Excel-
8
College ValuesAt Spartanburg Technical College, we believe in the worth of individuals and their poten-tial for growth and development. Values Pertaining to Students:At Spartanburg Technical College, we believe in 1. Encouraging students to reach their highest potential and to increase their self-esteem. 2. Stressing students’ responsibility in taking an active role in their own learning, growth, and development. 3. Fostering a caring environment appropriate for the personal and educational development of adult students.
4. Helping students acquire a work ethic appropriate to their career choice. 5. Promoting a desire for lifelong learning. 6. Instilling a sense of college pride in the student. Values Pertaining to Faculty and Staff::At Spartanburg Technical College, we believe in 1. Accomplishing the college mission through teamwork, effective communication, and personal accountability. 2. Maintaining a climate of mutual trust and respect. 3. Treating faculty and staff fairly. 4. Giving employees personal responsibility for job performance. 5. Developing professional potential of faculty and staff.
Introduction
9
Values Pertaining to Community:At Spartanburg Technical College, we believe in 1. Providing timely programs and services that meet the needs of students and area business/industry. 2. Participating as a partner in the community’s growth and development. 3. Promoting interactive communication with the community to ascertain needs and distribute information about programs and services. 4. Developing a continuum of educational opportunities by articulating with secondary and postsecondary institutions. 5. Encouraging faculty and staff to serve as leaders/role models in the community. 6. Being accountable to the community for effective use of resources.
Student OutcomesWhen students graduate from Spartanburg Technical College, they must possess the knowledge, skills, and attitudes necessary to successfully secure a job or pursue a career. At a level appropriate to his/her area of study, each graduate of a credit program at the college will 1. Perform mathematical computations 2. Communicate effectively both orally and in writing 3. Comprehend written material 4. Work effectively within a group 5. Demonstrate problem-solving ability 6. Demonstrate knowledge of professional work ethics 7. Demonstrate a knowledge of employer expectations of job seeking, keeping, and advancing skills 8. Demonstrate technical expertise
Introduction
10
Historical OverviewBy an Act of the South Carolina Legislature in May 1961, an extensive statewide program of technical training was initiated through the establishment of regional Technical Education Centers to aid in the economic development of the state. In November 1961 Spartanburg County requested and received approval to provide a tech-nical education center for the citizens in its region. The Spartanburg County Commission for Technical Training was formed to guide the development of the new center. Mr. Tracy J.GaineswasthefirstChairmanoftheCommissionandMr.P.DanHullwasnamedasthefirstDirectoroftheSpartanburgCountyTechnicalEducationCenter. ByMay1963thecenteroccupieditsfirstbuildingatthepresentsiteofSpartanburgTech-nicalCollege.Onehundredandfiftystudentsenrolledinnineindustrialandengineeringtechnology training programs and an extension course in supervisory development in the Fall Term, 1963. From 1963 through 1973 Spartanburg County Technical Education Center experienced rapid growth. Enrollment in academic programs for the 1973 Fall Term reached 1,342, which in-cluded new programs in business, engineering technology, and health sciences. Seven of the programs started in the mid-sixties were discontinued by 1973 in response to changing economic development needs. In 1969 Mr. James P. Ledbetter, Jr., was elected Chairman of the Spartanburg County Com-mission for Technical Training and Mr. Joe D. Gault became the second director of the center in 1970. During this first decade, the center received accreditation by the SouthernAssociationof Colleges and Schools (SACS) in December 1970. Also, a second classroom/laboratory building was constructed during this time. The East and West buildings now represented asignificantcoreforfutureexpansion.
Recognizing the institution’s broadening scope and depth of academic program offerings, in 1974theSpartanburgTechnicalEducationCenterwasofficiallydesignatedasSpartanburgTechnical College.
From 1974 through 1984 the College experienced steady growth in enrollment and a period of dynamic change. By the 1984 fall term, enrollment was 1,653. Many new academic programs were added to the curriculum during this second decade and the names and content of some programswereupdatedtoreflectchangesintechnology.By1984theCollegeofferedover40 associate degree and diploma programs. Custom-designed training provided through the College’s Continuing Education/Industry and Business Training Division received increased emphasis during this period.
In the Fall of 1980 construction of two additional buildings were completed. The 32,000 square feet Tracy J. Gaines Learning Resource Center houses the library, media center, bookstore, shipping and receiving, several classrooms, conference rooms, and a 300-seat auditorium. The 20,000 square feet Industrial Training Facility houses the College’s weld-ing and Ford ASSET programs. Additionally, in 1983 the College purchased the James P. Ledbetter, Jr. Administration Building. By the end of the second decade, the College had acquired a total of 104 acres of land off Interstate Highway 85, and grown to a 264,201 total square feet complex.
Introduction
11
In 1983, following the death of Mr. James P. Ledbetter, Jr., Mr. Charles R. Sanders was elected Chairman of the Spartanburg County Commission for Technical Education. In July 1985, upon the retirement of Mr. Joe D. Gault, Dr. Jack A. Powers became president of Spartanburg Technical College. During the period 1985 through 1995, the College has experienced tremendous enrollment growth, with the 1995 fall term realizing over 2,500 students. Academic programs have been consistentlyreviewed,upgraded,andmodernizedtoreflectcurrenttechnologies. Developing improved networks and working relationships have highlighted this third decade. Responding to the South Carolina Governor’s 1988 Initiative for Work Force Excel-lence, Spartanburg Technical College developed the largest basic skills training program for employees in the workplace within the state.
In the fall of 1990 the College launched a new University Transfer Program through the es-tablishment of associate degree programs in arts and sciences. This addition to the traditional technicalcurriculumsignificantlybroadenedtheCollege’seducationalmission. In 1993, upon the retirement of Mr. Charles R. Sanders, Rev. Dr. Benjamin P. Snoddy was elected the fourth chairman of the Spartanburg County Commission for Technical Educa-tion.
Spartanburg Technical College linked with Internet in 1994, the world’s largest and most powerful computer network. The College now has direct access to the worldwide “informa-tion highway."
In1995,theCollegebeganofferingcoursesviadistanceeducationtoprovideflexibleedu-cational opportunities to students who prefer to take courses off-campus either through video-based or interactive two-way video.
In 1996, the College welcomed a new president, Dr. Dan L. Terhune, who replaced Dr. Jack A. Powers, who retired after serving as president for 10 years.
In the fall of 1997, the College opened a new satellite campus, the Duncan Center, located off Highway 290 at Commerce Park in western Spartanburg County. Designed to offer both curriculum and continuing education classes to individuals and business/industry in the
Introduction
12
Continuing Education/Industry and Business TrainingThe Continuing Education/Industry and Business Training Division offers occupational training and personal development opportunities for individuals, groups, and companies. Instructionisprovidedbywell-qualified,experiencedpractitioners.
Community InterestCommunity interest classes are offered to provide a wide variety of vocational, personal-interest courses for the College’s service area.
Contract Training and Occupational Advancement The Continuing Education/Industry and Business Training Division contracts with business and industry to provide customized training to meet special needs. In addition, many of the same training opportunities available to businesses are available as open-enrollment classes through Occupational Advancement courses. Training in technical skills, management and supervision,licensingandcertifications,computertraining,andprofessionaldevelopmentare among the services that the division provides.
Continuing Education Units (CEU’s) are awarded for successful completion of Contract Training and Occupational Advancement courses. The CEU is recognized nationally as an accepted measure of quality training. One CEU is equivalent to ten training hours.
Job Training Partnership Act (JTPA)JTPAisafederallyfundedprogramdesignedtoprovidefinancialassistancetoeligiblestu-dents. The program pays for tuition and textbooks for students who qualify under the JTPA guidelines. Financial assistance received from JTPA does not have to be repaid. In addition to tuitionandbooks,theJTPAofficeprovidesjobplacementandcounselingservices.Eligibilityfor the program is based on income and employment status.
Facility Services at STCSpartanburg Technical College is proud to offer campus facilities as prime meeting space to local businesses, professional organizations and individuals. Whether your group includes a one-time small, informal meeting, or a week-long training session, we have the facilities, catering services and staff to meet your needs.
Accommodations: Our accommodations include numerous classrooms, conference and seminar rooms as well as an auditorium. Maximum accommodations allows for up to 300 individuals.Mostaccommodationsallowtheflexibilitytohavelunches,seminarorboardmeetings and even an awards ceremony or presentation.
Audio-visual services: During your event, audio-visual services are available per request on afirst-come,first-servebasis.Servicesinclude...•Microphones•TVsandVCRs•Overheadprojectors•Slideprojectorsandscreens
Catering: Because we offer full-service catering on campus, we are ready to meet any food needs you may have. We provide breakfast, lunch, snacks and beverages at competitive prices. Settings range from formal (china and silver) to informal. Floral arrangements are available upon request.
To schedule an event at Spartanburg Technical College, contact Christy Hobson, community liaisoninthepresident'soffice,864-591-3622.
Introduction
Introduction
Map of Spartanburg Technical College
13
Introduction
Map of the Duncan Center
SpartanburgTechnical College
Duncan Center
14
15
Adm
issi
ons
16
Admissions PoliciesThe South Carolina Technical Education System operates 16 open admissions colleges as required by Act 654 of the Code of Laws of South Carolina. Consistent with the statutory requirements, the Technical Education System makes every effort to minimize geographic, financialandscholasticbarrierstothekindsofpostsecondaryprogramsandservicesofferedthrough the technical colleges.
The Technical Education System accepts the responsibility to produce technicians who are competent to meet the assessed needs of South Carolina business and industry and, at the same time, to assist individuals in achieving educational and occupational objectives con-sistent with their potential.
Inordertofulfillthesystem’seducationalmissionandtopromotetheachievementofindi-vidualswithvariedpotential,openadmissionisdefinedasapracticewhichadmitstothecollegeallcitizenswhocanbenefit fromavailable learningopportunitiesandplaces intospecificprogramsofstudythosestudentswhosepotentialforsuccessiscommensuratewithexpected standards of performance. Admission tospecificprogramsrequires thatapplicantshaveappropriatepreparationasmeasured by satisfactory skill assessment scores and prerequisite courses. When scores indi-cate that an applicant is not prepared to enter a particular program, he or she will be offered the appropriate course or courses to provide the needed preparation. This preparation may includereferraltootherschoolsoragenciestomeetspecificneeds.Informationonassessmentscore requirements, including those unique to each of the College’s divisions, is available in theadmissionsoffice.Enrollingintransitionalstudiescoursesmayextendthelengthoftimenecessary for program completion.
Applicants who are at least 18 years old but have not earned a high school diploma or the equivalent, may apply for admission to industrial technology programs only. Admission will be determined on the basis of approved skill assessment scores. Applicants less than 18 years old must have earned a high school diploma or the equivalent. The College recognizes the tests of General Educational Development (GED) as an approved equivalent to the high school diploma. A passing score on the South Carolina GED or an average score of 45 on the military GED is required for programs requiring a high school equivalency. Applicants who present a military GED with an average score lower than 45 must meet the requirements for the state GED examination. (An average score of 45 and a minimum score of 35 on each of the fiveGEDtests.)Applicantswhodonotmeettheserequirementsbutwishtotakecurriculumcourses should make request for special admission to the dean of student services. (Refer to Special Admissions Procedure on pages 22-23.)
Admissions ProceduresApplication DeadlineStudents are encouraged to apply for admission as early as possible as the demand for some programs exceeds the number of openings. In order to assure proper processing of applica-tion and registration materials and to allow for student counseling, advising, and orientation, applicants are encouraged to apply at least four weeks prior to the date of registration for the desired term of enrollment. Financial aid applications should be submitted three months prior to enrollment date.
VerificationofHighSchoolGraduation/GEDApplicantsmustsubmitanofficialcopyofahighschooltranscriptorGEDscores.Applicants
Admissions
17
Admissions
for health sciences programs must submit either a high school or college transcript to verify completion of prerequisite courses. (Refer to health sciences technology section, page 23 for prerequisite courses.) Applicants who have earned an associate degree or higher from an accredited institution will not be required to verify high school graduation or the equivalent providedthatanofficialcollegetranscripttoverifythehighestdegreeearnedissubmitted.Alldocuments submitted become the permanent property of Spartanburg Technical College.
Skills AssessmentAll applicants are required to take Spartanburg Technical College’s skills assessment, the American College Testing program’s ASSET, unless determined exempt as indicated below. SAT scores will not be accepted in lieu of ASSET scores. Applicants with previous college credit (including credit from Spartanburg Technical College) may exempt a portion of, or all,ASSETassessmentbasedonthefollowingcriteriauponpresentationofanofficialtran-script:
Exemption from ASSET Writing Skills, Reading Skills, Numerical Skills - Student has earned credits from an accredited postsecondary institution. The credits must include courses in college-level English, reading, and math with grades of “C” or better.
Exemption from ASSET Algebra Skills - Student has taken an algebra course at an accredited postsecondary institution and earned a grade of “C” or better.
Meeting with Admission Counselor Every applicant submitting an application for admission is required to meet with an admis-sioncounselorpriortoofficialacceptancetotheCollege.Thepurposeofthismeetingistoreview with the applicant the results of the academic skills assessment (ASSET) and to discuss campus resources that the applicant may be interested in pursuing. Student Status New Students - Complete an application to the College. Pay a nonrefundable application fee of $10. The application and fee are valid for one year from the date of payment.
Former STC students applying to the same program - Enter under the current catalog and submit a new application if the break in attendance has been two or more consecutive terms. Pay a nonrefundable application fee of $10 if the break in attendance has been one year or more.
Former STC students applying to enroll in a new program - Complete an application to the College. Pay a nonrefundable application fee of $10 if the break in attendance has been one year or more. No additional fee is required.
Currently enrolled students applying to a new program - Complete an application for admission to indicate new program of study.
Transferring Credits to STCStudents who have earned credits from another accredited institution may have their tran-scripts evaluated for transfer credit. Similarly, students who have earned credits at STC and wish to transfer to a new program may have their transcripts evaluated for transfer credit in the new program. The following guidelines apply to awarding of transfer credit: 1.Anofficialtranscriptreflectingcreditsfromthegrantinginstitutionmustbeonfile
at STC.
18
21
15
Admissions
2. Acceptance of transfer credit is determined by the appropriate department head with the approval of the division dean. STC normally accepts transfer credits only from accredited colleges (i.e., those colleges accredited by the Southern Association of Col-leges and Schools or by any of the other parallel regional accrediting agencies).
3. Students may receive transfer credit equivalent to no more than 75 percent of required credits in their program.
4. Students must have earned a grade of “C” or better in courses presented for transfer credit evaluation.
Regulations and Procedures: Transfer in Public Two-Year Institutions in South Carolina as Mandated by Act 137 of 1995
Note: Appendix A, B and C are on file in academic affairs and are available for review on an as needed basis.
Background:Section 10-C of the South Carolina School-to-Work Transition Act (1994) stipulates that the Council of College and University Presidents and the Commission on Higher Education shall develop better articulation of associate and baccalaureate degree programs. To comply with this requirement, the Commission upon the advice of the Council of Presidents established a Transfer Articulation Policy Committee composed of four-year institutions' vice presidents for academic affairs and the associate director for instruction of the State Board for Technical and Comprehensive Education. The principal outcomes derived from the work of that com-mittee and accepted by the Commission on Higher Education on July 6, 1995, were:
* An expanded list of 72 courses which will transfer to four-year public institutionsofSouthCarolinafromthetwo-yearpublicinstitutions;
* A statewide policy document on good practices in transfer to be fol-lowed by all public institutions of higher education in the State of South Carolina, which was accepted in principle by the Advisory Committee onAcademicProgramsandtheCommission;
* Six task forces on statewide transfer agreements, each based in a discipline or broad area of the baccalaureate curriculum.
In 1995 the General Assembly passed Act 137 which stipulated further that the South Carolina Commission on Higher Education "notwithstanding any other provision of law to the contrary, shall have the following additional duties and functions with regard to the various public institutions of higher education." These duties and responsibilities include the Commission's responsibility "to establish procedures for the transferability of courses at schools." This same provision is repeated in the legislation developed from the report of the Joint Legislative Study Committee, which is now moving through the General Assembly during the 1996 session.
Act 137 directs the Commission to adopt procedures for the transfer of courses from all two-year public to all four-year public institutions of higher education in South Carolina. Pro-posed procedures are listed below. Unless otherwise stated, these procedures shall become effective immediately upon approval by the Commission and shall be fully implemented, unless otherwise stated, by September 1, 1997.
Statewide Articulation of 72 Courses:1. The Statewide Articulation Agreement of 72 courses already approved by the South Caro-lina Commission on Higher Education for transfer from two-to four-year public institutions (See Appendix A) shall be applicable to all public institutions, including two-year institu-tions and institutions within the same system. In instances where an institution does not have synonymous courses to ones on this list, it shall identify comparable courses or course categories for acceptance of general education courses on the statewide list.
19
22
Admissions
Admission Criteria, Course Grades, GPAs, Validations:2. All four-year public institutions shall issue annually in August, a transfer guide covering at least the following items:
A. The definition of a transfer student and requirements for admission to boththe institution an, if more selective, requirements for admission to particular programs.
B. Limitations placed by the institution or its programs for acceptance of standard-ized examinations (e.g. SAT, ACT) taken more than a given time ago, for academic coursework taken elsewhere, for coursework repeated due to failure, for course-work taken at another institution while the student is academically suspended at his/her home institution, and so forth.
C. Institutional and, if more selective, programmatic maximums of course credits allowable in transfer.
D. Institutional procedures used to calculate students applicants' GPAs for transfer admission. Such procedures shall describe how nonstandard grades (withdrawal, failing,repeatedallcoursework,etc.)areevaluated;andtheyshallalsodescribewhether all coursework taken prior to transfer or just coursework deemed ap-propriate to the student's intended four-year program of study is calculated for purposes of admission to the institution and/or programmatic major.
E. Lists of all courses accepted from each technical college (including the 72 courses in the Statewide Articulation Agreement) and the course equivalencies (including "free elective" category) found on the home institution for the courses accepted.
F. Lists of all articulation agreements with any public South Carolina two-year or other institutions of higher education, together with information about how interested parties can access these agreements.
G.Listsoftheinstitution'stransferofficer(s)personaltogetherwithtelephoneandfaxnumbersandofficeaddress.
H. Institutional policies related to "academic bankruptcy" (i.e. removing an entire transcript or parts thereof from a failed or underachieving record after a period of years has passed) so that re-entry into the four-year institution with course credit earned in the interim elsewhere is done without regard to the student's earlier record.
I. "Residency requirements" for the minimum number of hours required to be earned at the institution for the degree.
3. Coursework (individual courses, transfer blocks, statewide agreements) covered within these procedures shall be transferable if the student has completed the coursework with a "C" grade (2.0 on a 4.0 scale) or above, but transfer of grades does not relieve the student of the obligation to meet an GPA requirements or other admissions requirements of the institution or program to which application has been made.
A. Any four-year institution which has institutional or programmatic admissions requirements for transfer students with cumulative grade point averages (GPAs) higher than 2.0 on a 4.0 scale shall apply such entrance requirements equally to transfer students from regionally accredited South Carolina public institutions regardless of whether students are transferring from a four-year or two-year institution.
B. Any multi-campus institution or system shall certify by letter to the Commission that all coursework at all of its campuses applicable to a particular degree program of study is fully acceptable in transfer to meet degree requirements in the same degree program at any other of its campuses.
20
25
Admissions
4. Any coursework (individual courses, transfer blocks, statewide agreements) covered within these procedures shall be transferable to any public institution without any additional fee and without any further encumbrance such as a "validation examination," "placement examination/instrument,""verificationinstrument,"oranyotherstructure,notwithstandingany institutional or system policy, procedure, or regulation to the contrary.
Transfer Blocks, Statewide Agreements, Completion of the AA/AS Degree:5. The following Transfer Blocks/Statewide Agreements taken at any two-year public institu-tion in South Carolina shall be accepted in their totality toward meeting baccalaureate degree requirements at all four-year public institutions in relevant four-year degree programs, as follows:
* Arts, Humanities, and Social Sciences: Established curriculum block of 46-48 semester hours
* Business Administration: Established curriculum block of 46-51 semester hours* Engineering: Established curriculum block of 33 semester hours* Science and Mathematics: Established curriculum block of 48-51 semester hours* Teacher Education: Established curriculum block of 38-39 semester hours for early
childhood, elementary and special education students only. Secondary education majorsandstudentsseekingcertificationwhoarenotmajoringinteachereduca-tion should consult the arts, humanities and social science or the math and science transfer blocks, as relevant to assure transferability of coursework.
* Nursing: By statewide agreement, at least 60 semester hours shall be accepted by any public four-year institution toward the baccalaureate completion program (BSN) from graduates of any South Carolina public associate degree program in nursing (ADN), provided that the program is accredited by the National League of Nursing and that the graduate has successfully passed the National Licensure Examination (NCLEX) and is currently licensed registered nurse.
(For complete texts and information about these statewide transfer blocks/agreements, see Appendix B.)
6.Any"unique"academicprogramnotspecificallyorbyextensioncoveredbyoneofthesestatewide transfer blocks/agreements listed in #4 above shall either create its own transfer block of 35 or more credit hours with the approval of CHE staff of shall adopt either the arts/social science/humanities or the science/mathematics block by September 1996. The institution at which such programs is located shall inform the staff of the CHE and every institutional president and vice president for academic affairs about this decision.
7. Any student who has completed either an associate of arts or associate of science degree program at any public two-year South Carolina institution which contains within it the total coursework found in either the arts/social, sciences/humanities transfer block or the math/science transfer block shall automatically be entitled to junior-level status or its equivalent at whatever public senior institution to which the student might have been admitted. (Note: As agreed by the Committee on Academic Affairs, junior status applies only to campus activi-ties such as priority order for registration for courses, residence hall assignments, parking, athletic event tickets, etc., and not in calculating academic degree credits.)
Related Reports and Statewide Documents:8. All applicable recommendations found in the Commission's report to the General As-sembly on the School-to-Work Act (approved by the Commission and transmitted to the General Assembly on July 6, 1995) are hereby incorporated into the procedure for transfer of coursework among two-and four-year institutions. (See Appendix C.)
21
26
Admissions
9. The policy paper entitled State Policy on Transfer and Articulation,asamendedtoreflectchanges in the numbers of transfer blocks and other Commission action since July 6, 1995, is hereby adopted as the statewide policy for institutional good practice in the sending and receiving of all course credits to be transferred. (See Appendix D.)
Assurance of Quality:10. All claims for any public two- or four-year institution challenging the effective prepara-tion of any other public institution's coursework for transfer purposes shall be evaluated and appropriate measures shall be taken to reassure that the quality of the coursework has been reviewed and approved on a timely basis by sending and receiving institutions alike. This process of formal review shall occur every four years through the staff of the Commission on Higher Education, beginning with the approval of these procedures.
Statewide Publication and Distribution of Information on Transfer:11. The staff of the Commission on Higher Education shall print and distribute copies of these procedures upon their acceptance by the Commission. The staff shall also place this document and the appendices of the Commission's home page on the Internet under the title "Transfer Policies."
12. By September 1 of each year, all public four-year institutions shall own their home page on the Internet under the title "Transfer Policies:"
A. Print a copy of this entire document (without appendices).B. Print a copy of their entire transfer guide.C. Provide to the staff of the Commission in satisfactory format a copy of their entire
transfer guide for placing on the Commission's Home Page on the Internet.
13. By September 1 of each year, the staff of the State Board for Technical and Comprehensive Education shall own its home page on the Internet under the title "Transfer Policies:"
A. Print a copy of this document (without appendices).B. Provide the Commission staff in format suitable for placing on the Commission's
home page of the Internet, a list of all articulation agreements that each of the 16 technical colleges has with public and other four-year institutions of higher education, together with information about how interested parties can access those agreements.
13. Each two-year and four-year public institutional catalog shall contain a section entitled "Transfer: State Policies and Procedures." Such section at a minimum shall:
A. Publish these procedures in their entirety (except Appendices)B.Designateachieftransferofficerattheinstitutionwhoshall...
-provide information and other appropriate support for students consid-ering transfer and recent transfers-serve as clearinghouse for information on issues of transfer in the state of South Carolina-providedefinitiveinstitutionalrulingsontransferquestionsforthein-stitution's students under these procedures-work closely with feeder institutions to assure ease in transfer for their students
C.Designateotherprogrammatictransferofficer(s)asthesizeoftheinstitutionandthe variety of its programs might warrant
D. Refer interested parties to the institutional transfer guideE. Refer interested parties to the Institution's and the Commission on Higher Educa-
tions's home pages on the Internet for further information regarding transfer.
Special Admission Procedures
22
Admission of Special Applicants Program (ASAP)Any adult over the age of 18 may enroll as an ASAP student on a space-available basis by submitting an ASAP application. An applicant under the age of 18 must be a high school graduate (or equivalent) unless applying as an early admission student (See Early Admission Section).ASAPstudentsarenoteligibleforVAbenefitsorfinancialaid. ASAP applicants desiring to take a technology course may exempt ASSET assessment. ASAP applicants desiring to take a general education or transitional studies course must complete the appropriate section of ASSET. If the desired course has a prerequisite, the applicant must verify that the prerequisite has been met.
ASAPapplicantsmaycompleteupto15semestercreditspriortofulfillingregularadmissionsrequirements. If an ASAP student decides to enroll in a regular STC program, all admissions requirements must be met: complete a formal application for admission, pay a $10 applica-tion fee, complete ASSET assessment, submit all high school and college transcripts, and be officiallyacceptedbyanadmissionscounselor.
Early AdmissionApplicants attending high school who desire to begin their postsecondary educational experience prior to high school graduation may enroll as early admission students. Comple-tion of courses under early admission status does not constitute acceptance into a technical program or waiver of any admission requirements for later admission to a degree, diploma, orcertificateprogram.Thestudentmaycompleteamaximumof15semesterhourspriortograduation from high school.
The Attend College Early Program (ACE) is a special early admission program designed for high school seniors whose goal is a four-year degree. The courses offered in the ACE Program are college transfer courses that are part of the existing AA/AS two-year transfer program. Students in the ACE Program must meet the same admission requirements as other early admission students.
STC grants high school students early admission status on the following basis:1. The student must be a high school senior.2. The student must submit written permission from the high school principal and
parent or guardian.3. The student must submit an application for admission.4. The student may be required to complete a portion of, or all, of the ASSET assess-
ment depending upon courses to be taken. (Refer to ASAP section for details.) All credits earned through early admissions are applicable to the appropriate STC program following high school graduation (if such credits are parallel to program requirements and approved by the department head). The credits earned by early admission students may be transferred at the discretion of the receiving institution.
Health Sciences TechnologyHealth sciences technology programs, outlined in the program descriptions, require ad-ditional applicationprocedures. Studentsmust complete the followingprogram-specificapplication procedures at the College after completing the regular application:
1. Schedule an interview with the Health Sciences Technology Division counselor and, for some programs, additional interviews at the clinical site.
2. Applicants wishing to enroll in the Practical Nursing Program are mandated by state
Admissions
23
law to submit to a records check by the South Carolina Law Enforcement Division (SLED). Failure to submit to this check results in the applicant's exclusion from enroll-ment in the program.
3. Submit a completed health form as directed by the department head of the program upon acceptance
Accepted health sciences technology applicants may elect to enroll in general education courses, or designated major courses, prior to enrolling in the Health Sciences Technology Program. These health sciences applicants are required to adhere to the academic standards of their chosen curriculum. They must earn a minimum of a 2.0 grade point average and a minimum grade of “C” in required courses, as indicated in the curriculum displays. (Ac-ceptedhealthsciencestechnologyapplicantsshouldrefertospecificacademicrequirementsand standards of the chosenHealth Sciences Technology Program for specific programinformation.) Inadditiontoprogram-specificapplicationprocedures,studentsmustcompletethefollow-ing prerequisite courses (with a grade of "C" or better) prior to enrolling in designated Health Sciences Technology Programs:
•Dental Assisting: one unit high school biology or chemistry, typing or equivalent• Medical Assisting: one unit high school biology or chemistry, algebra or equiva-lent
•Medical Laboratory Technology: one unit high school biology, chemistry, algebra or equivalent
•Practical Nursing: one unit high school biology or chemistry, algebra or equivalent•Radiologic Technology: one unit high school biology or chemistry, algebra or equivalent
•Respiratory Care: one unit high school biology or chemistry, algebra or equivalent•Surgical Technology: one unit high school biology or chemistry, algebra or equiva-lent
•Pre-Dental Hygiene: one unit high school biology, chemistry and algebra or equiva-lent
• Pre-Health Information Management: one unit high school biology, chemistry and algebra or equivalent
• Pre-Occupational Therapy Assistant: one unit high school biology, chemistry and algebra or equivalent
•Pre-Physical Therapist Assistant: one unit high school biology, chemistry and algebra or equivalent. Physics is recommended.
Re-admissionTo the College - Students who do not attend the College for two consecutive terms and who wish to reapply to the same program re-enter under current program guidelines. These guidelines may affect the applicability of completed credits to the program and the total credits needed for program completion.
To Health Sciences Technology Programs - In addition to the procedures listed above for re-admission to the College, the following general guidelines apply to students re-entering Health Sciences Technology Programs. Specific guidelines are outlined in the programhandbook.
1.UpdatefileinadmissionsandmakeanappointmentwiththeHealthSciencesTech-nology Division counselor.
2. Update health form and SLED records check (if applicable to program).
Admissions
24
Transient StudentsStudents who wish to take courses at STC to transfer to their primary college may do so by submitting an application for admission. Students are responsible for determining if the STC courses are transferable to the primary college. (Refer to ASAP section for admission procedures.)
Foreign StudentsAny applicant who requests a student visa, transfers from another college under a student visa, or possesses a student visa other than one that has been approved by the College and theImmigrationandNaturalizationServiceisclassifiedasaforeignstudent.
Foreign students must complete the regular admissions requirements at least three months prior to enrollment. In addition, foreign applicants must submit the following:
1. Medical examination records.2.AnofficialEnglish translationofsecondaryandpostsecondaryrecordsandtran-
scripts.3. A score report from the Test of English as a Foreign Language (TOEFL).4.Anaffidavitofsupportoranotarizedbankstatementindicatingsufficientfundsto
cover foreign student living expenses and educational costs for the academic year.5. A tuition deposit of $4,575 to cover tuition costs for one year.
Acceptance of a foreign applicant and issuance of an I-20 form occur when the applicant has met all requirements previously stated. Foreign students who are allowed by the Im-migration and Naturalization Service to attend STC are issued either a F-1 or M-1 Visa. For restrictionsofthistypeofvisa,contacttheadmissionsoffice.
OrientationPrior to and during each semester, student services plans and coordinates several student orientation sessions for day and evening students. The sessions familiarize new students with the College and its services and personnel. In addition, each of the academic divisions provides divisional orientations that pertain directly to the students’ curricula.
25
Serv
ices
for S
tude
nts
26
33
Services for Students
BookstoreThe Book Inn is located in the Tracy Gaines Building and is open Monday through Thursday from 9:30 a.m.-6:30 p.m., and on Friday from 9:00 a.m.-1:30 p.m. The bookstore stocks all required textbooks and most school supplies, drafting equipment, computer supplies and nursing uniforms. It also provides a selection of greeting cards, Spartanburg Tech sportswear, bookbags and gift items.
CafeteriaThe College cafeteria is located in the East building and is open Monday through Thurs-day from 7:30 a.m.-1:30 p.m., and Friday from 7:30 a.m.-11:00 a.m. The cafeteria provides hot and cold breakfast and lunch. Vending machines provided by the cafeteria are located throughout the campus.
Campus Safety and SecurityThepublicsafetyofficer,skilledinlawenforcementprocedures,firstaid,andCPR,coordi-nates campus safety and security. The College’s security force provided via contract with a local security company conducts foot and vehicular patrols of the campus to ensure the securityofstudents,faculty,andstaff.Thepublicsafetyofficeralsomonitorsthehandlingand disposal of hazardous materials. Alcoholic beverages, illegal drugs, and weapons of any kind are prohibited on the campus. Emergenciesandcriminalactionsshouldbereportedtotheofficeofpublicsafety,extension3774,3777,or0(operator).Onweekendsandafternormaloperationalhours,theofficeronduty can be reached at (803)580-0438.
Career Planning and PlacementThecareerplanningandplacementofficeassistscurrentlyenrolledstudentsandgraduatesin obtaining information about local manpower needs, making realistic vocational choices, andsecuringmeaningfulemployment.TheofficelinkstheCollege’sacademicandcareerprograms to business and industry and facilitates the transition of students into the world of work.Thecareerplanningandplacementofficedisseminatesinformationaboutfull-time,part-time, temporary, and summer employment opportunities; provides a job-readinessprogram covering interview techniques, application procedures, resume preparation, and employment responsibilities, and maintains job listings for businesses, industries, govern-ment and educational institutions. The Co-operative Education Program, a learning ap-proach that combines academic studies with work experience that is related to a student's curriculum,isalsocoordinatedbythisoffice.
Counseling and Career DevelopmentThe admissions office counseling staff offers career planning services to help studentsselect from the many technical programs and the University Transfer Programs offered by the College. Students may schedule a career planning session by calling the admissions office.Thefollowingareamongthetopicsonwhichstudentsmayreceivecounselingandinformation: - Curriculum programs, academic and personal requirements, working conditions, job opportunities, and potential salaries - Application process, skills assessment and assessment requirements, registration,andfinancialaid - Opportunities for refresher courses and basic studies - Special information on programs, such as clinical training, work experienceoptions,books,uniforms,certificationexams,etc.Theadmissionsofficehousesacareer resourcecenterwhichcontainsavarietyofcareer
27
34
Services for Students
exploration materials including DISCOVER, a computerized career information system. Individuals may also enroll tuition-free in “Choices and Challenges,” a career decision-making course offered each term which is designed to help identify their values, abilities, interests, life-style preferences and needs.
Early RegistrationCurrently enrolled students may register for the next term approximately one month prior to the beginning of each term. Students are encouraged to meet with academic advisors during the early registration period to discuss career goals and academic progress and to schedule classes for the following term.
Evening ServicesThe Evening College is the administrative arm of campus operations during evening class hours. The College offers a number of academic programs as well as a variety of occupational, professional and community interest courses during evening hours. Evening classes are gen-erally scheduled between the hours of 6:00 p.m. and 10:15 p.m. Monday through Thursday (hours may vary during the Summer Term). Most of the support services provided by the College are available to evening students. The academic programs available in the evening are indicated in the program descriptions of this catalog. Information on community inter-est and professional development courses is available through the Continuing Education/Industry and Business Training Division of the College.
Health ServicesThe College does not provide comprehensive health services. The campus public safety of-ficeprovidesemergencyfirstaid.
Housing InformationThe College does not provide living accommodations for students. Students enrolled throughtheCooperativeProgramfortheDeafandtheBlindmaycontact thatofficeforinformation about housing at the South Carolina School for the Deaf and Blind.
Identification CardsStudentsarerequiredtohaveastudentidentificationcard.TheCollegeissuesstudentiden-tificationcardsatnocostandrevalidatesthemyearly.
InsuranceThe College carries an accident insurance policy which covers students while on campus, travelingtoandfromscheduledclinics,fieldtrips,off-campusworkprojects,internships,practicums, and during their participation therein. The coverage excludes accidents that oc-cur as a result of participation in organized sports. Coverage includes payment for medical injury expenses and accidental death and dismemberment. Injuries must be reported to the HumanResourcesOfficewithinforty-eight(48)hoursfromthetimeoftheaccidentforbenefitdetermination.Claimformsareavailableinthehumanresourcesoffice.Thepremiumforstudent insurance coverage is included as part of the tuition fee for all registered students.
LibraryThe library, located in the Tracy Gaines Learning Resource Center, holds a collection of over 39,000 volumes including, 2,900 audiovisual materials, 400 periodicals subscriptions to 15 newspapers. These resources support the academic and personal needs of students, staff, and faculty, as well as members of the business and industrial community. Special resources include a growing instructional video collection, CD-ROM, Internet access, FirstSearch Ref-erence Service, PROQUEST magazine index, and Newsbank newspaper database.
28
Services for Students
The library’s resources are further enhanced by on-line computer access to the collections of the South Carolina State Library, Spartanburg County Public Library, and a variety of other public and academic libraries. The STC library is a member of the South Carolina Informa-tion and Library Services Consortium and the South Carolina Library Network. The library holds an interlibrary loan membership in OCLC, the international library database.
Library orientations are available upon request for either individuals or groups. Reference services are provided in person, via e-mail and by telephone. Books and the current issues of periodicals and newspapers are displayed on open shelving. Patrons who register with the library may check out books and some videos from the general collection. The library features ample reading and conference space, as well as computers, a typewriter, video and audio equipment, and a self-service photocopying machine.
The library’s normal hours of operation are:•Monday-Thursday:7:30a.m.-9p.m. • Saturday: 9 a.m. - 1 p.m. (fall-spring terms only)•Friday:7:30a.m.-1:30p.m. •Sunday:Closed
ParkingStudents must register their vehicles, and vehicles must appropriately display a current parking permit. Permits are $5 each and are valid for one academic year. Replacement permits are $2 each.
Release of Student InformationSpartanburgTechnicalCollegemaintains accurate and confidential student records andrecognizes the right of students to gain access to their academic records in accordance with the Family Educational Rights and Privacy Act of 1974 (Buckley Amendment) and Col-lege policy. Further information about access to student records is available in the Student Handbook and Calendar.
The College releases student transcripts upon receipt of a request signed by the student. Students may request that copies of their transcripts be sent to individuals or institutions, or they may secure copies for their own use. Transcripts are $5 each. The College does not forward students’ transcripts received from high schools and other colleges.
Directory InformationThe Omnibus Consolidated Appropriations Act 1997, which includes the Solomon Amend-ment, requires institutions receiving Title IV Campus-Based Funds to report the following directory information on students 17 years of age or older, upon request, to the military:-Name -Academic major-Address -Degrees received-Telephone listing -The educational institution in which the student most-Date and place of birth recently was enrolled-Level of education
Students desiring that this information not be released to a third party should contact the College'sregistrar'sofficeandsignanofficialnon-releaseform.
Services to Students with DisabilitiesStudents Disabilities Services Center - This office acts as an advocate for studentswithdisabilities who self identify and provide supporting documentation, ensuring that they have access to all College programs and services. Students with disabilities who may need
29
38
Services for Students
reasonable accommodations, auxiliary aids and services, or support services are encouraged to inform their admissions counselor or contact the program coordinator as soon after reg-istration as possible so that an accommodation plan can be developed. The center is located intheEastbuilding,officeE-30Eandcanbecontactedat591-3811.
Cooperative Program for the Deaf and the Blind - The Cooperative Program was established in 1986 through an agreement between Spartanburg Technical College and the South Caro-lina School for the Deaf and the Blind (SCSDB). The combined resources of both institutions ensure students of a comprehensive, quality support service system necessary for equal access in all College programs.
Through the program, students may request interpreters, notetakers, Braille and reading services, assistive technology training and specialized advisement.
Housing on the SCSDB campus is available in Smith Hall, the adult living center. Smith Hall is equipped with assistive technology devices for both deaf and blind students and is accessible to persons with physical disabilities. Transportation to the College is available for students living on the SCSDB campus. TheCooperativeProgramofficeislocatedintheStudentDisabilitiesServicesCenterintheEastbuilding,officeE-30E,andcanbecontactedat591-3746.Asupportservicesspecialistisavailable to assist students with identifying their support services needs.
Student ActivitiesThe student activities coordinator manages campus activities external to the classroom and serves as advisor to the student council and the campus newspaper, The Tech Informer. The coordinator is also the liaison between the College administration and student organizations. Clubs and organizations sponsor various activities throughout the year.
Student Due ProcessStudent grievance procedures, procedures related to student due process, and the student code are printed in the Student Handbook.
Student CouncilThe Student Council gives students an opportunity to develop their leadership potential. Student council-sponsored activities are designed to involve students in a variety of pro-grams and community service projects.
Success NetworkThe Success Network is a federally-funded student-support service which provides counsel-ing, assessment, tutoring in a variety of subject areas, and other special services for eligible students. The Success Network helps students to successfully complete their courses, develop interest and concern for their future, and be more aware of their potential. Student seminars provide information and activities to enhance students’ academic achievement.
Transitional Studies:Tutorial Learning Center (TLC)STC's Tutorial Learning Center combines several support functions in a convenient, central-ized location on the campus. Housed in the A-Wing of the West Building, the TLC supports the College's curriculum offerings via one-on-one and group tutorials, computer assisted instruction, CD-ROM, and video presentations in a variety of subject areas. TLC's constantly expandingservicesincludeassistanceforvirtuallyanykindofacademicdifficulty,eitherthrough the services available in the TLC or through the assistance of other College personnel. As part of TLC's functions, the Center provides the special services described below:
30
41
Services for Students
Writing Lab - The Writing Lab offers assistance to any member of the STC community who hasproblemswithorquestionsaboutanywritingtasks.Walk-insareassistedonafirst-comebasis.
Math Lab - In the Math Lab, students can receive one-on-one or group assistance with most math assignments. Students may receive help on a walk-in basis.
Accounting Lab - The Accounting Lab provides assistance to students enrolled in any ac-counting course on campus. Accounting Lab assistance is available at scheduled hours each week.
Testing Lab - Located next to the TLC, the Testing Lab provides curriculum make-up and exemption credit test proctoring for the convenience of students and faculty. The lab also administers a practice GED test which is available to the community at-large.
31
Fina
ncia
l Mat
ters
32
Financial Matters
College CostsTuition Full-time Students Spartanburg County Residents $ 550.00 per term Out-of-County Residents $ 685.00 per term Out-of-State Residents $1,525.00 per term* Foreign Students $1,525.00 per term*
Part-time Students (fewer than 12 credit hours) Spartanburg County Residents $ 46.00 per credit hour Out-of-County Residents $ 58.00 per credit hour Out-of-State Residents $ 128.00 per credit hour* Foreign Students $ 128.00 per credit hour**Note: Tuition for full-time and part-time out-of-state residents and foreign students will change and be printed in an addendum to the 1997-1998 Catalog. Textbooks and SuppliesStudents are responsible for all book and supply costs in addition to tuition fees. Program specificfeesmayberequired.ContacttheAdmissionsOfficefordetails.
Fees and ExpensesApplication Fee-$10(Nonrefundable;payablewhenapplyingforadmissiontoSpartanburgTechnical College.)
Classes Ineligible for Financial Aid Assistance - Audit classes, Continuing Education/Industry and Business Training classes and classes taken with an ASAP admission status willnotbepaidforbyfederalfinancialassistance.
Tuition Waiver for Senior Citizens - South Carolina residents age 60 or over who are not employed full time may enroll at no charge in any course on a space-available basis. The student must meet applicable prerequisites and is responsible for the purchase of books and supplies. Other fees - • Creditbyexaminationand/orexperientiallearning:One-half(50percent) of the rate charged in-county students x the number of credit hours for the course • Graduation:$20(nonrefundable;payablewithgraduationapplication) • Parking:$5pervehicle($2perreplacementpermit)• Returnedchecks:$15perincident • Transcripts:$5pertranscript(firsttranscriptisfree)• IdentificationCards:Nochargeforthefirstidentificationcard;$5perreplacement Tuition and fees are subject to change without notice by the Spartanburg County Com-mission for Technical Education.
ResidencyAresidentstudentfortuitionandfeepurposesisdefinedasonewhohasabandonedallpriorresidences and has been residing in South Carolina for at least twelve months immediately precedingthefirstdayofclassesofthetermforwhichresidentstatusissought.
Students who have not resided in South Carolina for at least twelve months prior to enrolling in classes will be required to pay out-of-state (or out-of country, if applicable) tuition. The initial determination of residency status is made at the time of admission. The determina-
33
Financial Matters
tion made at that time, and any determination made thereafter, prevails for each subsequent term until the determination is successfully challenged. The burden of proof resides with the student to show evidence as deemed necessary to establish residency status. Inquiries regarding residency requirements and determinations should be directed to the director of admissions and counseling.
How to PayPayment DueAll tuition and fees are payable when due. The College makes no provisions for partial fee payments or extending credit.
Astudentmaynotattendclassuntilfinancialobligationsareresolved.Allequipment,librarybooks, and other college-owned property must be returned when due. A student’s academic award(degree,diploma,orcertificate)andtranscriptwillnotbereleaseduntilallfeesarepaid and college-owned property has been returned.
Payment MethodsTheCollegeacceptscash,personal(first-party)checks,moneyorders,andcashier’schecksfor payment of all fees. Students may also charge fees to VISA, Mastercharge and Discover. Fee payment by an employer must be supported by a letter on company letterhead and is subjecttoverificationbytheCollege. Returned ChecksThe College assesses a $15 service fee per occurrence on all checks returned by the bank for any reason. The service fee is in addition to any fee charged by the bank.
Financial AssistanceOperating PrinciplesThepurposeoffinancialassistanceprogramsistoassiststudentswhowouldbeunabletoattend college due to a lack of money. In addition to grants and loans, our programs reward students for academic achievements and provide wages for students performing essential college services.
Nearly90percentof thefinancialaidavailable forSTCstudents isderivedfromfederaland state government sources such as Federal Pell Grants, Federal Supplemental Educa-tional Opportunity Grants, Federal Work Study, Federal Stafford Loans (subsidized and unsubsidized), South Carolina Need Based Grants and Veterans Administration Educa-tionalBenefits.Thefinancialaidofficeisthesourceofinformationabouttheseprograms.The remaining 10 percent of the funds available are derived from sources which support academic performance.
Todeterminewhetherornotastudentiseligibleforfederalstudentfinancialaidprograms,the student and his/her family must complete the Free Application for Federal Student Aid (FAFSA) by May 1 each year for priority consideration. The College expects students and their families to share primary responsibility to met the costs of college. The FAFSA is avail-ablefromthefinancialaidofficeorfromareahighschoolguidanceoffices.Astudentshouldallow six to eight weeks for processing.
Toparticipateinfederalstudentfinancialaidprograms,STCisrequiredbyfederalregulationtomaintainafinancialaidofficethatcoordinatesthedeliveryofallfundsfromallsourcestostudents.Allstudentswhoreceiveaidinadditiontofederalstudentfinancialaidarere-quiredtoreporttheamountandsourcetothefinancialaidoffice.Studentsmustcompleteanapplicationforfinancialaideveryyear.
34
Asapplicants'financialaidfilesarecompleted,fundsareauthorizedandthestudentisnoti-fied.Acompleteapplicationforfinancialaidconsistsofaprocessedneedsanalysisdocument,loanapplication,otherdocumentsrequestedforverification,andfinancialaidtranscripts(ifa student has attended other post-secondary institutions and transfers in mid-year).
Determination of Financial NeedSTC'sfinancial aidprogramsassist studentswhohavefinancialneedasdeterminedbythefederalprocessor.Afinancialneedexistsiftheresourcesofthefamily(expectedfamilycontribution or EFC) do not meet the total cost of attending the College. The total cost of attendance includes tuition, fees, books, supplies, personal and transportation expenses.
Student Eligibility RequirementsA student must meet the following eligibility requirements to receive Title IV assistance:•Beenrolledoracceptedforenrollmentinaneligibleprogram•Bearegularstudent•HaveahighschooldiplomaorGED(STCdoesnotdisburseaidtostudentsundertheability-to-benefitregulations)
•BeaU.S.citizenoreligiblenon-citizen•Notbeamemberofareligiouscommunitythatdirectstheprogramofstudyorprovides
maintenance (except for unsubsidized stafford loans)•BeregisteredwiththeSelectiveService(malesonly)•NotbeindefaultonaTitleIVstudentloanborrowedforattendanceatanyinstitution•NothaveborrowedinexcessofTitleIVloanlimits•NotowearepaymentonaTitleIVgrantorscholarshipreceivedforattendanceatany
institution•Maintainsatisfactoryacademicprogress•Notbeenrolledconcurrentlyinanelementaryorsecondaryschool•Provideavalidsocialsecuritynumber
Eligible Programs and Enrollment StatusA student must enroll in an eligible program to receive any type of federal aid administered bythefinancialaidoffice.GeneralEducationDevelopment(GED),ContinuingEducation/Industry and Business Training (CE/IBT) courses and courses taken as an ASAP student are not eligible programs. Audit classes will not be considered in determining a student's status each semester. Financial aid will not pay for audit classes. A student is paid for only those courses required for graduation or as a prerequisite for courses required in your program. The original award letter is based on full-time enrollment for the entire year. A student who is not full-time will have his/her award prorated based on the actual hours enrolled. Any changesinenrollmentstatusmustbereportedtothefinancialaidoffice.
How You Receive Your AssistanceA student who applies in time and is eligible will have his/her direct educational expenses of tuition, books and supplies deducted from the assistance that has been awarded (exclud-ing FWS awards). Funds available after these expenses have been paid will be mailed to the student.Allcheckswillbemailedtothelocaladdress;therefore,the records office should be kept current of local address information.
Students who receive a federal work study award and obtain employment through this pro-gram are paid once a month. FWS checks are available on the last working day of the month. StudentsmustpresentavalidpictureIDtoreceivethecheckinthebusinessoffice.
Transferring
Financial Matters
35
Financial aid awards cannot be transferred from one college to another. Students must have theresultsoftheFAFSAreleasedtothenewcollege.Alldocumentsinthefilearethepropertyof Spartanburg Technical College and cannot be returned to you or forwarded to another college.CallthefinancialaidofficeatSTCifyouplantotransfertoanothercollege.
Students transferring to Spartanburg Technical College must request a duplicate student aid report (SAR) if the results of the FAFSA have not been released to STC. To request a duplicate SAR you may call the federal processor at (319) 337-5665. It is the student's responsibility to notifythefinancialaidofficethatyouhaveattendedapost-secondaryschoolandtohaveafinancialaidtranscript(FAT)requestedregardlessofwhetheryoureceivedfinancialas-sistance at the school.
Satisfactory Academic ProgressStudentsreceivingfinancialassistancethroughafederalprogrammustbemakingsatisfac-toryprogresstowardadegree,diplomaorcertificate.Thefinancialaidofficemustmonitorthe progress of all students to ensure that they are making satisfactory progress toward completion of their program in a reasonable period of time. This policy is in addition to the academic standards required by the College and is a cumulative review of the academic history.Previousreceiptoffinancialassistanceisnotrelevant.
Academic StandardsThe minimum credit hour completion rate requires students to earn at least 67 percent of the cumulative hours attempted. Courses with the grades I, U, W, WF and F are not considered completed courses.
StudentsarealsorequiredtomaintainaGPAasdefinedby theCollege in theacademicstandards of progress (refer to the academic procedures section of this catalog).
Length of EligibilityAstudentmayreceivefinancialaidfor1.5timesthepublishedlengthoftheprogramofstudyprovided the student meets the academic standards outlined in this policy. For example, a student enrolled in a 60 credit hour program is eligible until 90 credit hours are attempted. Transfer hours are added to the total hours attempted at Spartanburg Technical College to assess the length of eligibility. A student may repeat a course but repetitions will count toward the length of eligibility. Once the maximum number of hours is attempted, the student is placedonfinancialaidsuspension.
Program ChangesA student is allowed two program of study changes before completing a degree, diploma orcertificate.After thesecondprogramofstudychange, thestudent is suspended fromreceivingfinancialaid.
ProbationThe minimum credit hour completion rate and the GPA standard is assessed at the end of each term. If a student does not make the minimum grade point average and/or complete theminimumnumberofcredithoursrequired,thestudentisplacedonfinancialaidproba-tion for the next term attended. Financial aid may be received during the probationary term. Continued eligibility for aid is determined at the end of the probationary term. To remain eligible after the probationary period, the student must take at least six credit hours, complete 100 percent of the attempted hours, and have at least a 2.0 term GPA.
If the student meets the probationary standards, is not on a academic probation, and has a
Financial Matters
36
Financial Matters
completion rate of at least 67 percent of the cumulative hours attempted, the student will be removedfromfinancialaidprobationandmustcontinuetomeettheacademicstandardsof this policy.
If the student meets these requirements and the GPA is such that the student remains on academicprobation,thestudentwillcontinueonfinancialaidprobationandmustcontinueto take at least six credit hours, complete 100 percent of the attempted hours, and have at leasta2.0GPA.ThestudentwillberemovedfromfinancialaidprobationoncetheGPAiswithin the academic standards of progress required by the program and the completion rate is at least 67 percent of the cumulative hours attempted.
If the student meets the probationary standards, is not on academic probation, and has a completion rate that is less than 67 percent of the cumulative hours attempted, the student willcontinueonfinancialaidprobationandmustcontinuetotakeatleastsixcredithours,complete 100 percent of the attempted hours, and have at least a 2.0 term GPA. The student willberemovedfromfinancialaidprobationoncetheGPAiswithintheacademicstandardsof progress required by the program and the completion rate is at least 67 percent of the cumulative hours attempted.
SuspensionAny student on probation who fails to meet the probationary standards during the proba-tionarytermissubjecttofinancialaidsuspension.Tore-establisheligibilityastudentmustcompleteatermatSpartanburgTechnicalCollegewithoutfinancialassistance.Duringthatterm, the student must take at least six credit hours, complete 100 percent of the attempted hours, and have at least a 2.0 term GPA (or with grades of S or SC if in transitional studies), tobeeligibletoreceivefinancialaidinthenexttermofenrollment.
A student who has attempted the maximum number of credit hours allowed for the program ofstudyisplacedonfinancialaidsuspension.
Eachstudentisnotifiedinwritingwhenplacedonprobationorsuspension.Astudentthatisallowedtoreturnonacademicprobationisnotautomaticallyeligibleforfinancialaid.
AppealsAstudentmayappealanysuspensionoffinancialaidtotheFinancialAidCommittee.Formsmaybeobtainedfromthefinancialaidoffice.Ifthecommitteedeterminesthatjustifiableevidenceofextenuatingcircumstancesexists,astudentmayreceiveanextensionoffinancialaid eligibility.
A student who is appealing because the length of eligibility has been exhausted should ob-tain from the advisor a signed statement showing the remaining classes needed to complete, the program of study and an anticipated completion date. This documentation should be submitted with the student's appeal.
AnystudentwhoisacademicallysuspendedmustfirstbereadmittedtotheCollegeandeligible to register before any appeal will be allowed.
Transitional StudiesStudentsenrolledineligibleprogramsmayreceivefinancialaidwhiletakingrequiredtran-sitionalstudiescourses.Afinancialaidrecipientmayreceiveaidforamaximumofoneyear(30 credit hours) when enrolled in transitional studies courses. Transitional studies courses
37
Financial Matters
will count toward the length of eligibility.
Sources of Financial AidFederal Pell GrantThe Federal Pell Grant is a student aid program that provides grants for students attending college who have not previously received a baccalaureate degree. Eligibility is based on your resources and determined by a formula developed by the U.S. Department of Education. Pell Grant awards currently range from $400 to $2,700.
Federal Supplemental Educational Opportunity Grant (FSEOG)The Federal Supplemental Educational Opportunity Grant program is a student aid program fromwhichyoumayobtainupto$4,000eachyeardependingonyourfinancialneed,theavailability of FSEOG funds at STC, and the amount of other aid you receive. The average award for an STC student is $500 per year.
Federal Work Study Program (FWSP)The Federal Work Study Program is a federal student aid program that provides part-time jobs on campus for eligible students. Since positions are limited, students should apply early. You must complete the free application for federal student aid and an application for federal work study.
South Carolina Need Based Grant (SCNBG)TheSouthCarolinaNeedBasedGrantprogramisdesignedtoprovideadditionalfinancialaid assistance to South Carolina's neediest students. The grant assists students who wish to attend public or independent colleges or universities in the state. To be eligible, a student must have been a S.C. resident for the last 12 months. The maximum award is $2,500. The Need Based Grant program was established under the South Carolina Children's Education Act of 1996.
In addition to meeting the satisfactory academic progress policy previously outlined in the catalog, a student must earn a minimum of 24 credit hours during the fall and spring semester if full-time or must earn a minimum of 12 credit hours during the fall and spring semester if part-time. All students must have a cumulative GPA of at least 2.0 for continued eligibility.
Federal Stafford LoansThe Federal Stafford Loan is a low interest college loan made by a lender. This loan is insured by either the federal government or a state guarantee agency. The interest rate is variable. This loan has a six-month grace period before repayment begins. First-time freshman bor-rowersareineligibletoreceivetheirfirstpaymentuntil30daysaftertheirprogramofstudybegins. To determine eligibility, you must complete the free application for federal student aid and an application and promissory note for Federal Stafford Loans.
ScholarshipsAll academic scholarships are accepted and administered through the Spartanburg Technical CollegeFoundationandthefinancialaidoffice.SelectionofrecipientsismadebytheSpar-tanburg Technical College Scholarship Committee (except in the case where an established set of guidelines provide for a special selection committee). Deadlines are mid-May for the fall semester and mid-December for the spring semester. Applications are available in the financialaidoffice.
Other Assistance
38
Single Parent/Homemaker AidThis program provides tuition, books, child care and transportation to eligible single parent/homemakers. Contact the Women's Center for more information.
Technical ScholarsThese company sponsorships cover all college expenses and provide paid part-time jobs for selected students. Students applying for these scholarships must be fully accepted into an appropriate associate degree program, meet Scholars application criteria, agree to comply with all sponsoring requirements, and successfully pass sponsoring company's interviews and other screenings. Sponsoring companiesmake the final decision onwho is offeredscholarship(s)baseduponcompanyneedsandtheapplicant'squalifications.Studentsinter-estedinTechnicalScholarsshouldcontacttheadmissionsofficeformoreinformation.
Jobs Training Partnership Act (JTPA)TheCollege'sJobTrainingPartnershipAct(JTPA)officeprovidesassistancewithtuition,books, and stipends for eligible students.
Disabled StudentsSeveral departments within the College disseminate information concerning accessible facili-ties for disabled students on campus. These departments include but are not limited to the Student Disability Center and the Success Network.
Veterans AssistanceSpartanburg Technical College is approved by the Department of Veterans Affairs for training service persons, veterans, dependents, and reservists under Title 38, U.S. Code of FederalRegulations,forthefollowingVAeducationalbenefits:VEAP(Chapter32),Non-contributory VEAP (Section 903), New GI Bill -Active Duty Educational Assistance Program (Chapter 30), New GI Bill - Selected Reserve Educational Assistance Program (Chapter 1606), Survivors and Dependents (Chapter 35), and Vocational Rehabilitation (Chapter 31).
TheVeteransOfficecoordinatesservicesforVAstudentsandactivedutyservicepersonnel.StudentswhoareeligibleforVAbenefitsshouldconsulttheVeteransAffairsOffice.
Academic Requirements - Information on academic progress, withdrawal reporting proce-dures,refunds,andattendanceisavailablefromtheVAOffice.
Address Changes - VA students must notify the VA of any address changes by completing theaddresschangeformintheVAOffice. Advanced Payment Request - VA students should be prepared to pay all expenses and in-structionalfeesatthetimeofregistration;however,theymayrequestadvancedpaymentofthefirstVAbenefitcheck.Inordertoqualifyforadvancedpayment,theVAstudentmusthavebeen out of school for at least a full calendar month, completed an admissions application, andcompletedaVAadvancedpaymentapplicationatleast45dayspriortothefirstdayofclass. The Department of Veterans Affairs mails the check to the College for disbursement at registration. VA students must complete the registration process, including fee payment, before receiving the advanced payment check.
Attendance Reporting-VAstudentsenrolledindiplomaorcertificateprogramsarerequiredto submit a veterans attendance report on the last day of each month. Students who discon-tinueenrollmentarerequiredtowithdrawofficially.
Benefit Eligibility -VAstudentsmayreceivebenefitsonlyforthosecoursesthatareincluded
Financial Matters
39
in the program of study as outlined in this catalog. VA students who fail a course that counts towardsprogramcompletionmayrepeatthecourseoncewithVAbenefits.
Class Attendance - VA students must adhere to the attendance policy established by the College. VA students who accrue more than the allowable number of absences will have VAbenefitsterminated.
Program Changes - VA students who change programs must complete a change of program formintheVAOffice.Creditstakenthatfulfillrequirementsinthenewprogrammustbetransferred as required by the Department of Veteran Affairs.
Tutorial Assistance for Veterans - VA students may receive monetary assistance from the VA to pay for a tutor, if one is required.
Withdrawal Notification-VAstudentsmustreportcoursewithdrawalstotheVAOffice.
Work Study - Applications are accepted for a limited number of VA work study student posi-tions. This program can provide part-time employment for veterans and eligible dependents. The maximum allowance is 250 hours per enrollment period at minimum wage.
Refund Policy and ProceduresIt is the policy of Spartanburg Technical College that students or appropriate sponsoring agencies receive a fair and equitable refund of tuition and other institutional charges upon the student's withdrawal from the College or net reduction of credit hours below 12 credit hours.Institutionalchargesaredefinedastuition;equipmentand/orbooks,andsupplies,ifcostsareseparatelyidentifiedortheCollegerequiresstudentstopurchaseitemsfromaCollegeaffiliatedvendor;andfees,requiredofallstudents,orcategoriesofstudents,andarerelated to the student's program of study, excluding items of a pass through nature.
I.TitleIVsponsoredstudentsmeetingthefederalcriteriaforfirsttimeattendeeswillreceiveapro rata refund consistent with applicable federal rules and regulations or will have a refund consistent with Section II if that will produce a larger refund.
II. Except as provided in Section I, institutional charges for a semester term will be refunded at the following rates:
Refund Percent Withdrawal or Net Reduction of Credit Hours100% ...................................Beforethefirstdateintermthatclassesareoffered(startofterm)75% ............................................................................................. 1st - 7th calendar day of the term50% ...........................................................................................8th - 14th calendar day of the term25% ......................................................................................... 15th - 21st calendar day of the term0% .......................................................................................after the 21st calendar day of the term
Students who never attend any class for which they are enrolled will be considered to have constructively withdrawn before the start of the term.
Astudent'sofficialwithdrawaldatewillbebasedonthestudent'slastdateofattendance.
Refunds for terms that vary in length from the semester term will be in proportion to the semester term refund schedule delineated in I and II.
Pro-Rata Refunds
Financial Matters
40
IfastudentreceivesfederalfundingtoattendSpartanburgTechnicalCollegetheirfirsttermof attendance, they are eligible for a partial refund through 60 percent of the semester if they completely withdraw from the College. If the student withdraws prior to completing 60 percent of the semester, the portion of the tuition, fees and other charges assessed which are to be refunded will be calculated by the following formula:the number of weeks remaining in the semester as of the last recorded date of attendance ÷ the number of weeks of the enrollment period for which the student was charged = the percent of refund (rounded down to the nearest 10 percent)
OverpaymentAftertherefundhasbeencalculated,thefinancialaidofficewillcalculatewhetherornotthestudenthasreceivedanoverpayment.Ifso,thestudentwillbenotifiedoftheoverpaymentsituation prior to having the account forwarded to the Department of Education for collec-tion purposes. If the overpayment is not corrected, the student will not be eligible to receive furtherfederalfinancialassistance.
Records and TranscriptAllinquiriesaboutgrades,transcripts,records,etc.,shouldbedirectedtotherecordsoffice.ThisofficeisopenMondayandTuesdayfrom8a.m.to6:30p.m.,WednesdayandThursdayfrom 8 a.m. to 5 p.m., and Friday from 8 a.m. to 1:30 p.m.
Release of Student InformationSpartanburg Technical Collegemaintains accurate and confidential student records andrecognizes the right of students to gain access to their academic records in accordance with the Family Educational Rights and Privacy Act of 1974 (Buckley Amendment) and College policy. The following “directory information” may be made available to the public by the College unlessstudentsnotifytherecordsofficeinwritingbythethirdweekofthetermthatsuchinformation is not to be made available. 1. Student’s name 2.Majorfieldofstudyorprogram 3. Dates of attendance (enrollment status - full-time, part-time) 4. Awards earned
Transcriptsandinformationnotspecifiedunder“directoryinformation”are released only with written permission of the student. Students may request that copies of their transcripts be sent to individuals or institutions, or theymaysecurecopiesfortheirownuse.Officialtranscriptsare$5each.Thereisnochargeforunofficialtranscripts.TheCollegedoesnotforwardstudents’transcriptsreceivedfromhigh schools and other colleges. Studentshavetherighttoreviewtheirownofficialrecordandmayquestionanyinaccurateormisleadinginformationandrequestcorrectionordeletionofthatdatafromtheirfiles.If an error cannot be readily substantiated, the student may refer to the Student Grievance Procedure for due process procedures. If the student’s request is denied by the hearing com-mittee, he/she will be permitted to append a statement to the record in question, showing the basis for their disagreement with the denial. Such appendages will become a permanent part of the record. Parents of a dependent student have right of access to that student’s record, provided they
Financial Matters
41
can show proof of dependency (according to Internal Revenue Code of 1954) and sign the appropriateaffidavit,availableintherecordsoffice.
Support from the STC FoundationThe Spartanburg Technical College Foundation's purpose is to provide support for the advancement of the College's mission. The Foundation provides funds for student scholar-ships, faculty and staff development, curriculum upgrades, capital improvements and other institutional advancement requirements. Additional support is provided to the College through equipment loans, gifts of supplies, and other in-kind services. The Foundation may also provide real property in support of campus growth needs.
The Foundation is a 501 (c) (3) organization of volunteers and community leaders and is tax-exempt under the Internal Revenue Code. It seeks and accepts gifts and contributions designated for the preceding purpose. During the accounting period of July 1, 1993-June 30, 1994, the Foundation provided Spartanburg Technical College with more that $110,000 for student scholarships, faculty and staff development and curriculum equipment improve-ments.
Academic PoliciesAcademic Advising
Financial Matters
42
Notes
Financial Matters
43
Acad
emic
Pro
cedu
res
44
Academic Procedures
Students enrolled in academic programs are advised by faculty on matters of career choice, course selection and academic progress. Academic Standards of ProgressAcademic Probation - The College places students on academic probation when their pro-gram grade point average (GPA) falls below the levels indicated in the chart below. Academic probation remains in effect until the minimum cumulative program GPA meets the GPA requirements for the credit hours attempted.
Associate Degree Programs Credit Hours Minimum Attempted GPA 0-18 1.4 19-36 1.6 37-45 1.8 over 45 2.0
Diploma or One-year Certificate Programs Credit Hours Minimum Attempted GPA 0-18 1.6 19-30 1.8 over 30 2.0
Less than One-year Certificates Credit Hours Minimum Attempted GPA 8-20 2.0 Some curriculum programs require that students earn a 2.0 GPA each term and/or achieve a “C” in each required course. Programs with additional academic requirements publish the requirements in the department handbook which are provided to students upon enroll-ment.
Academic Exclusion - If a student fails to earn a 2.0 ("C" average) grade point average (GPA) during the term he/she is on academic probation, the student will be excluded from courses inthefollowingtermandnotifiedinwritingbythedeanofstudentservices.Onlyextenuat-ing circumstances which are documented by student services may justify an extension of the probationary period. Students who have been on academic exclusion and are re-admitted are cautioned that they remain on academic probation and are subject to academic exclusion again if they fail to maintain at least a 2.0 GPA.
Academic Probation/Exclusion from Transitional Studies- Students who receive a "U" or "F*" in a zero-level transitional studies subject (English, reading or mathematics) are placed on academic probation in that subject. A second "U" or "F*" in the subject results in the student's exclusion from that subject for one semester. Extensions of the probationary period may be approved by the division dean if extenuating circumstances are documented.
Re-admission - Students on academic exclusion must meet with an admissions counselor. The counselor will contact the department head and division dean to secure approval for the student to be re-admitted. An admissions status report indicating that the student may be re-admitted will be forwarded to the faculty advisor by the counselor.
45
Academic Procedures
Add/drop PeriodTheadd/dropperiodisthefirstfiveinstructionaldaysoftheterm.Withthepermissionofthe advisor and/or division dean, students may add or drop courses or change audit status during this period without academic penalty. Courses dropped during the add/drop period will not appear on transcripts. Students who withdraw from a course after the add/drop period will receive a grade of “W”, “WF” or "U" based upon academic standing at the last date of attendance. The instructor for the course being dropped must assign the last date of attendance.
Auditing a CourseStudents who desire to attend class but not receive grades or credit may audit the course. Students may not change status (credit to audit or audit to credit) after the add/drop period. Students who previously audited a course must register and pass the course in order to receive credit for the course. Students may not receive credit by examination for previously auditedcourses.Anauditedcoursemaynotbeusedtofulfillprerequisiterequirements.
AwardingMultipleDegrees,Diplomas,andCertificatesStudentsmaycompletemultipledegree,diploma,andcertificateprograms.Studentsearningmorethanoneawardinthesamegeneralfieldofstudyinthesamesemesterwillreceivetheaward for the highest program level only.
Class AttendanceStudentsareresponsibleforpunctualandregularattendanceinallclasses,laboratories,fieldtrips,andotherclassactivities.TheCollegedoesnotgrantexcusedabsences;therefore,stu-dents are urged to reserve their absences for emergencies. When illness or other emergencies occur, the student is responsible for notifying instructors and for completing work missed.
Except in extenuating circumstances with approval by the division dean, instructors drop students from class when 80 percent attendance is not maintained. Some courses have more restrictive attendance policies as indicated in course syllabi. The instructor will award a grade of “W”, “WF" or "U" based upon the student’s academic standing at the last date of attendance.
Students are tardy if not in class at the time the class is scheduled to begin. Tardy students areadmitted toclassat thediscretionof the instructor.Coursesyllabi reflectattendancepolicies related to tardiness. Absences for Religious Holidays - Students who are absent from class in order to observe religious holidays are responsible for the content of any activities missed and for the comple-tion of assignments occurring during the period of absence. Students who anticipate their observance of religious holidays will cause them to be absent from class and do not wish such absences to penalize their status in class should adhere to the following guidelines:(1) Observance of religious holidays resulting in three or fewer consecutive absences: Discuss the situation with the instructor and provide written notice at least one week prior to the absence(s). Develop (in writing) an instructor-approved plan which outlines the make up of activities and assignments.(2) Observance of religious holidays resulting in four or more consecutive absences: Dis-cuss the situation with the instructor and provide the instructor with written notice within thefirsttendaysoftheacademicterm.Developaninstructor-approvedplanwhichoutlinesthe make up of activities and assignments.
46
Course Overload PolicyStudents may not normally enroll for more than 18 semester credit hours. Students who have a 3.0 GPA may enroll for an overload (more than 18 semester credit hours) only with permission of the department head or division dean.
Dean’s ListTo qualify for the dean’s list, students must have declared a major, be enrolled in at least 12 semester program credit hours for fall or spring semester and nine semester program credit hours in the summer (excluding audited courses), and have earned a grade point average of 3.50 with no course grade lower than a "C." A grade of "I" or "WF" automatically excludes students from the dean's list.
Exemption PolicyThe College requires that students must complete at least 25 percent of their program semes-ter hours through instruction offered by the College in order to receive a degree, diploma orcertificatefromSpartanburgTechnicalCollege.Studentsmayearnexemptioncreditforprograms excluding this 25 percent requirement. The College grants exemption credit for program requirements on the following basis:
ACE College Credit Recommentaion Service - The College recognizes the American Coun-cil on Education (ACE) College Credit Recommendation Service. The College will evaluate course work for exemption credit if the course content is comparable to the content of a program course or courses offered by the College. The student must present documentation of course completion through an ACE approved agency before the College will evaluate the course work.
Advanced Placement (AP) - Students may receive exemption credit for AP courses completed at the secondary level. The College awards exemption credit for AP Examination scores of 3 orhigher.TheCollegemusthaveonfileanofficialcopyoftheAPExaminationscorereportin order to award credit.
College Level Examination Program (CLEP) - Credit for subjects in which students are knowledgeable, but have no class standing, can be gained through successful completion of the College Entrance Examination Board (CLEP) tests. Spartanburg Technical College does not administer CLEP exams but will accept CLEP exam scores administered by other institutions if scores meet minimum standards. Articulation - Students may receive exemption credit for program requirements through the validation of competencies gained at secondary and vocational/technical schools. Students seeking exemption credit through articulation should contact the secondary department head or counselor or the College program department head. The department head must validate student competencies designated in articulation agreements between the College and the secondary and vocational/technical schools. Validation of student competencies may include written examinations or other assessment methods.
College Level Examination Program (CLEP)Credit for subjects in which students are knowledgeable, but have no class standing, can be gained through successful completion of the College Entrance Examination Board (CLEP) tests. Spartanburg Technical College does not administer CLEP exams but will accept CLEP exams scores administered by other institutions of scores meet minimum standards. Credit by Examination - Students may receive exemption credit for previous academic work
Academic Procedures
47
Academic Procedures
or relevant work experience through formal written or practical examinations. Students may not attempt credit by examination for courses in which they have been previously enrolled (either for credit or audit) or in which they have previously attempted credit by examination. Students seeking exemption credit by examination should contact their program department head to discuss eligibility. The program department head will provide the proper authori-zation form and refer the student to the subject-area department. The department head of the area in which the student seeks credit will determine eligibility and schedule an exam date. After an exam date has been scheduled, the student should pay the appropriate fee at thebusinessoffice.Thestudentmustpresenttheauthorizationformandthereceipttothesubject-area department head.
Experiential Learning - Students may receive exemption credit for knowledge acquired through work or other experiences external to academics. Students seeking credit for expe-riential learning should contact their program department heads who will determine the students eligibility and provide the authorization form. The teaching faculty in the subject area in which credit is sought will determine the appropriate method of evaluation and the time frame for completion. Methods may include a portfolio or other documentation of acquired knowledge. Once the evaluation has been scheduled, the students should pay the appropriatefeeatthebusinessoffice.Theauthorizationformandthereceiptshouldbepre-sented to the faculty providing the evaluation. Students may receive credit for a maximum of 25 percent of required program semester hours for experiential learning.
Servicemembers Opportunity Colleges (SOC)Spartanburg Technical College is a member of the Servicemembers Opportunity Colleges (SOC). Students having academic credit earned at other institutions while on active duty will have their credit evaluated on a case by case basis. GradesGrading Policy -Coursegradesarefinalwhenfiledbytheinstructors.Astudentmayrequesta review of a grade if he or she believes the instructor erred in assigning the grade. The records officewilladjustthestudent’stranscriptifthereviewconfirmsthatanerrorwasmade.Thestudent must request the review by the last day of the following term.
Grading System - Spartanburg Technical College uses the following system of grades: Quality Used in GPA Credit Hours
Points Calculation Awarded
A Excellent 4 Yes Yes B Above Average 3 Yes Yes C Average 2 Yes Yes D Below Average 1 Yes Yes F Failure 0 Yes No W Withdrawn 0 No No WF Withdrawn Failing 0 Yes No E Exempt 0 No Yes I Incomplete 0 No No AU Audit 0 No No TR Transfer Credit 0 No YesZero-level Transitional Studies: S Satisfactory 0 No Yes SC Satis. Completion 0 No Yes U Unsatisfactory 0 No No W Withdrawn 0 No No A Excellent 0 No Yes
48
Academic Procedures
B Above Average 0 No Yes C Average 0 No Yes D Below Average 0 No Yes F Failure 0 No No GraduationTobeeligibleforgraduationfromSpartanburgTechnicalCollege,astudentmustfulfillthefollowing:1. Apply for and be accepted into the program for which he or she is applying for gradua-
tion.2. Complete all program course requirements in the applicable catalog. A student must
complete a minimum of 25 percent of the total hours required in the program through instruction at the College.
3. Earn a grade point average of at least 2.0 in the courses applicable toward graduation.4.ResolveallfinancialobligationstotheCollegeandreturnallmaterials.5.Makeformalapplicationforgraduationintherecordsofficebythepublicizedgraduation
deadline date. (The deadline to apply for graduation is posted in various locations on campus and is printed in the Student Handbook.)
6. Pay a $20 nonrefundable graduation fee, which is valid for one year. The fee entitles the graduate to participate in the graduation ceremony and covers the cost of award process-ing. Graduates who do not pay the graduation fee may request a transcript indicating theawardearned;however,theywillnotreceiveanawarddocument(degree,diploma,orcertificate).
7. Obtain graduation approval from the department head or division dean.8. Graduation exercises are held once a year. Students should apply for graduation during thesemestertheyplantograduate.Awards(degrees,diplomas,certificates)aremailedtostudents who choose not to participate in graduation exercises.
Semester System Classes are generally scheduled for 15 weeks for the fall and spring semesters and for nine weeks for the summer term.
Transitional StudiesThe Transitional Studies Division offers a variety of courses designed to enhance students' academic abilities. Most of the courses in Transitional Studies are basic skills courses in grammar, writing, reading and mathematics. Other course offerings in the divi-sion include "bridging" courses and pre-entry courses. In addition, Transitional Studies supports all students and faculty through the services of the Testing Center and Tutorial Learning Center.
Basic Skills Courses-Transitional Studies Basic Skills courses are offered both day and evening.Mostclassesareofferedinatraditional"lecture"format;howeversomeclassesmay include a variety of programmed instructional materials. Basic skills courses (zero-level) carry institutional credit but cannot be used to satisfy program requirements for graduation.Thezero-levelcoursenumbersdonotindicatelevelsofdifficulty.
"Bridging" Courses-TransitionalStudies"bridging"coursesaredesignedspecificallytohelp students acquire additional skills and discipline in order to be successful in curricu-lum courses. "Bridging" courses are taught in a lecture format and include a greater de-gree of academic rigor than Basic Skills courses. These courses are also non-degree credit (theymayormaynotbecreditedtowardgraduationforadiplomaorcertificateprogram,but they cannot be credited toward graduation for a degree program).
49
Academic Procedures
Pre-entry Courses - Some of the college's curriculum programs require that students meet certain entry requirements prior to acceptance into the program. Most students will have met these requirements in high school or at another college. However, in some cases the studentmaylackaspecificcoursewhichisrequiredforentryintoacurriculum.Transi-tional Studies offers several courses which enable students to meet these entry require-ments. These courses are non-degree credit courses (they may or may not be credited to-wardgraduationforadiplomaorcertificateprogram,buttheycannotbecreditedtowardgraduation for a degree program).
Withdrawal from the CollegeStudentsshouldmeetwiththeiradvisorstocompleteanofficialadd/dropform.Iftheadvisor is not available, students should contact the department head or division dean. Studentsreceivingfinancialaidshouldnotifythefinancialaidofficepriortocompletingthe withdrawal process. Students are responsible for requesting a refund (if applicable) at the time of withdrawal. Students who discontinue class attendance without formal withdrawal risk having future registration privileges withdrawn.
StudentswhoregisterforcoursesbutneverattendclassanddonotofficiallynotifytheCollege of withdrawal shall be administratively withdrawn. Their transcript will not show any record of enrollment.
Except in extenuating circumstances with the approval by the division dean, instructors drop students from class when 80 percent attendance is not maintained. Some courses have more restrictive attendance policies as indicated in course syllabi. The instructor will award a grade of "W", "WF" or "U" based upon the student's academic standing at the last date of attendance. The instructor for the course being dropped must assign the last date of attendance.
50
Notes
Academic Procedures
51
Arts
and
Scie
nces
52
44 45
Arts and Sciences
Arts and Sciences Division
Associate Degree Programs Associate in Arts Associate in Science Horticulture Technology Interpreter Training
Certificate Programs Landscape Management
Departments English Horticulture Interpreter Training Mathematics/Sciences Social Sciences
53
46 47Arts and Sciences DepartmentsEnglish-Math/Science-Social Sciences-Horticulture-Interpreter Training
Students in the degree, diploma, and certificate programs at Spartanburg Technical College are scheduled for an appropriate number of subjects from the Mathematics/Sciences, Eng-lish, and Social Sciences departments. Also, students who are not working toward a degree, diploma, or certificate often take subjects from these areas to enhance their basic skills. These general education courses are offered both day and evening.
University Transfer ProgramsAssociate in Arts
Associate in Science4 Semesters, Day
6 Semesters, Evening (Minimum)
The University Transfer Programs (UTP) are specifically designed for students whose goal is a baccalaureate degree. The UTP offer the freshman and sophomore years of study required at many universities and colleges. In either program students must complete courses in math, English, humanities, social sciences, and the natural sciences.
The associate in arts degree (AA) is appropriate for students whose goal is a four-year de-gree in areas such as education, English, history, business administration, psychology, social work, and physical education.
The associate in science degree (AS) is appropriate for students whose goal is a four-year degree in a math and/or science-related field such as biology, chemistry, physics, mathemat-ics, medicine, pharmacy, and engineering.
Admission requirements for the University Transfer Programs include assessment in read-ing, math, and English skills. Assessment is waived for students with appropriate transfer or advanced placement credits.
The length of time required to complete a University Transfer Program is dependent upon the number of courses in which the student enrolls each term. Students are advised to follow a course sequence consistent with their four-year degree goal.
University transfer courses are designed to be accepted at South Carolina public four-year colleges and universities and are accepted by a number of private institutions. However, requirements for specific majors vary among institutions. The student is responsible for checking with the four-year institution he or she plans to attend to determine acceptance of credits. Students should, with the assistance of an academic advisor at Spartanburg Technical College, plan their academic programs to meet the requirements of their four-year degree goal. Students must earn a minimum grade of "C" to transfer courses.
Course Requirements for Associate in Arts
Arts and Sciences
54
48 49
Arts and Sciences
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 SPC 205 Public Speaking 3 0 3 Math (transfer level) 3 0 3 Lab Science 3 3 4 PSY 201 General Psychology 3 0 3 PSC 201 American Government 3 0 3 Economics (transfer level) 3 0 3 History 3 0 3 B. Major Courses 15 semester credit hours to be chosen by the student from the following: ART, ECO, ENG, HIS, MUS, PHI, PSY, SOC and any foreign language
C. Electives and/or Additional Hours Required for Graduation CPT 101 Introduction to Computers 3 0 3 15 semester credit hours to be chosen by the student to adapt the pro-gram to his/her objectives
Minimum semester credit hours required for graduation: 61
Course Requirements for Associate in Science
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 SPC 205 Public Speaking 3 0 3 Math (transfer level) 6 0 6 Lab Science 3 3 4 PSY 201 General Psychology 3 0 3 PSC 201 American Government 3 0 3 Economics (transfer level) 3 0 3 History 3 0 3 B. Major Courses 15 semester credit hours to be chosen by the student from the following: BIO, CHM, MAT, PHS, PHY
C. Electives and Other Additional Hours Required for Graduation
55
51
Arts and Sciences
Credit Class Lab Hours CPT 101 Introduction to Computers 3 0 3 13 semester credit hours to be chosen by the student to adapt the pro-gram to his/her objectives.
Minimum semester credit hours required for graduation: 62
Interpreter Training ProgramAssociate Degree in Public Service
4 Semesters
The Interpreter Training Program is a two-year associate degree program which prepares students as beginning interpreters for the hearing impaired. The course work focuses on helping students learn to interpret spoken English into American Sign Language and into manually coded English as well as translate American Sign Language and manually coded English into spoken English. The learning experience includes role playing and videotaping as well as training in transliteration and voice interpreting. Students have the opportunity to participate in interpreting internships at local agencies and institutions. Additional course work in the program includes written and oral communication skills, psychology, deaf his-tory and culture, and interpreting theory. Admission requirements for the Interpreter Training Program include assessment in reading, math/algebra and English skills. Placement in American Sign Language classes is deter-mined by an evaluation of the student's sign language skills. Students who do not possess intermediate level signing skills will be required to complete American Sign Language I and II prior to full acceptance in the Interpreter Training Program. Part-time students require more than four semesters to complete the progam.
Course Requirements for Interpreter Training ProgramAssociate in Public Service
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 PSY 201 General Psychology 3 0 3 Math 3 0 3 SPC 205 Public Speaking 3 0 3 Science 3 3 4 Humanities/Fine Arts 3 0 3
B. Major Courses ITP 101 Introduction to Interpreting 3 0 3 ITP 108 American Sign Language III 3 3 4 ITP 109 American Sign Language IV 3 3 4 Credit
56
Class Lab Hours ITP 104 Interpreting in Educ. Settings 3 0 3 ITP 201 Deaf History & Culture 3 0 3 ITP 202 Transliterating I 3 0 3
C. Electives and/or Additional Hours Required for Graduation ITP 106 Linguistics of American Sign Language 3 0 3 ITP 203 Transliterating II 3 0 3 ITP 204 Interpreting 3 0 3 ITP 206 Sign to Voice Interpreting I 3 0 3 ITP 207 Sign to Voice Interpreting II 3 0 3 ITP 212 Interpreting in Special Settings 3 0 3 ITP 230 Field Experience 0 3 1 ITP 240 Interpreting Internship 0 9 3
*The student must complete one elective course which totals at least 2.0-3.0 semester credit hours .
Minimum semester credit hours required for graduation: 63
Horticulture Technology ProgramAssociate Degree in Agriculture Technology - 4 Semesters
The Horticulture Technology Program is the study of applied plant science emphasizing plant production and use. Horticulture provides training for the landscaping industry, nurs-ery and garden center operations, and greenhouse management, as well as the supporting horticulture supply businesses.
Full-time students in this program usually enroll in four or five courses per term which average 21-24 class hours per week or 17 to 18 credit hours per term. Part-time students re-quire more semesters of attendance to graduate. The exact length depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a semester course outline which describes the courses and the specific semesters in which they are scheduled.
Many of the courses listed require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be an-swered by the program advisor or department head. Program requirements for graduation follow.
Practical Application: The Horticulture Technology Program includes regular classes, indoor and outdoor lab work, greenhouse work, field trips, and special work projects. An ornamen-tal garden, a nursery area, and three greenhouses are on campus to give students practical experience in their outside labs. These areas are maintained by the horticulture students.
Job Opportunities: Nursery operations, landscape management, grounds maintenance,
Arts and Sciences
57
Arts and Sciences
landscape installation, parks and forestry services, retail plant sales, garden center manage-ment, greenhouse operation, and horticulture supply businesses. Spartanburg Technical College has a partnership with Clemson University's Horticulture Department for transfer of credit to Clemson.
Course Requirements for Horticulture Technology Program
Credit Class Lab Hours A. General Education Courses Math Requirement 3 0 3 Humanities Requirement 3 0 3 Social Sciences Requirement 3 0 3 ENG 101 English Composition I 3 0 3 SPC 205 Public Speaking 3 0 3 B. Major Courses HRT 105 Landscape Plant Materials 3 3 4 HRT 110 Plant Form and Function 3 3 4 HRT 125 Soils 3 3 4 HRT 141 Horticulture Pest Control 3 3 4 C. Electives and/or Additional Hours Required for Graduation COL 101 College Orientation 1 0 1 HRT 102 Landscape Design 3 3 4 HRT 117 Designing with Herb. Plants 3 0 3 HRT 139 Plant Propagation 2 3 3 HRT 205 Computers in Horticulture 3 0 3 HRT 223 Irrigation 3 3 4 HRT 230 Greenhouse Technology 3 3 4 HRT 231 Nursery Technology 3 3 4 HRT 241 Turf Management 3 0 3 HRT 253 Landscape Installation 3 3 4 HRT 256 Landscape Management 3 3 4 Electives
Each student must take one elective course which totals at least 2.0 semes-ter credit hours.
58
Minimum semester credit hours required for graduation: 70
Landscape Management Program Certificate - 18 Months; Evening
The Landscape Management Certificate is offered by the horticulture department for evening students who wish to take courses in the specific area of landscape maintenance and man-agement. The objective of this certificate is to create confidence and professionalism in the landscaper and nursery worker by broadening his horticultural knowledge and by increasing his exposure to modern techniques and materials used in landscape management.
The certificate is designed especially for those individuals who are already employed in landscape management and nursery businesses or who desire some training in these areas. This certificate is offered only at night to accommodate individuals presently working in this industry. The Horticulture Advisory Committee selected courses for this certificate that would provide practical applications for the student. The courses are all offered as "credit" courses and can be applied toward the day time associate degree in horticulture. Students who wish to transfer to the associate degree program from the certificate program should verify credits with the department head.
Students can enroll in the certificate at the beginning of any term . In most cases, a student will need to attend classes two nights a week in order to complete the certificate in two years. The cost of the courses is based on credit hours.
Practical Application: The Landscape Management Program includes regular classes and special projects. An ornamental garden and adjacent grounds provide students opportuni-ties for observation and study.
Job Opportunities: Enhancement of job skills for currently employed landscape manage-ment personnel as well as for individuals desiring to enter the landscape management field and nursery fields.
Course Requirements for Landscape Management Credit Class Lab Hours A. General Education Courses None
B. Major Courses HRT 104 Landscape Design 3 0 3 HRT 113 Plant Materials 3 0 3 HRT 117 Designing with Herbaceous 3 0 3 Plants HRT 121 Commercial Irrigation 3 0 3 HRT 144 Plant Pests 3 0 3 HRT 153 Landscape Construction 3 0 3 HRT 154 Grounds Maintenance 3 0 3 HRT 241 Turf Management 3 0 3
Arts and Sciences
59
Busin
ess T
echn
olog
y
60
Business
Business Division
Associate Degree Programs Accounting Computer Technology Management - Fire Service Electives Management - Hospitality Electives Management - Marketing Electives Management - Information Technology Electives Management - Textile Management Electives OfficeSystemsTechnology
Diploma Programs AutomatedOffice System Support Technician
61
Accounting Degree ProgramAssociate Degree21 Months; Day
24 Months; Evening Accounting students are provided the opportunity to develop the skills required to satisfy informational needs of intracompany and intercompany individuals and organizations by analyzing, recording, summarizing, and reporting accounting information. A comprehensive studyoffinancialandmanagerialapplicationswillincludeindividualincometaxprocedures,costandbudgetinganalysisandautomatedaccountingsystems.Studentswillbeexposedto the latest techniques in standard costing, variance analysis, and inventory management. Inordertograduate,full-timestudentsenrolledinthisprogramusuallyenrollinfivecoursespersemesterwhichequatesto15credithoursand15classhoursperweek.Additionalhoursinthecomputerand/oraccountinglabarerequiredinsomesituations.Studentswillberequired to attend one or more summer terms to complete associate degree requirements. Part-timestudentsusuallyrequiremoresemestersofattendancetograduate,withtheexactlength of attendance dependent upon semester offerings and the number of courses taken bythestudent.Uponregistering,eachnewstudentshouldrequestasemestercourseoutlinewhichliststherequiredcoursesandthespecificsemestersinwhichtheyarescheduled. Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletosched-ule a full load of courses and graduate in the normal length of the program since course schedulingisdesignedfornewstudentsenteringinfallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursedescriptionatthebackofthiscatalog.Manycoursesrequireafinalgradeof “C” or better in order to register for advanced courses. These courses are also noted in the course descriptions. In addition, many courses require a grade of “C” or better to apply towardgraduation.Thesecoursesareindicatedundercourserequirements. Anyquestionsconcerningschedulingofcoursesorgraduationrequirementscanbeansweredby the program advisor or the department head. Program requirements for graduation are listedonthefollowingpage. Practical Application: Accounting students complete accounting simulations using micro-computers,developaccountingmodelsusing spreadsheet software,performaccountingapplications using integrated accounting software, anddevelop financial forecasts fromhistorical analysis. The development of problem solving, interpersonal and communication skills is stressed. Job Opportunities: Accounting clerk, junior accountant, payroll clerk, accounting supervisor, junior cost accountant, tax preparer, and public accountant.
Course Requirements for Accounting Degree Program
Business
62
60 Credit Class Lab Hours A. General Education Courses ENG 101 EnglishCompositionI* 3 0 3 ENG 102 EnglishCompositionII 3 0 3 ECO 210 Macroeconomics 3 0 3 MAT 102 IntermediateAlgebra* 3 0 3 MAT 120 ProbabilityandStatistics 3 0 3 MAT 160 MathforBusiness&Finance* 3 0 3SPC 205 PublicSpeaking 3 0 3 B. Major Courses ACC 101 AccountingPrinciplesI* 2 3 3 ACC 102 AccountingPrinciplesII* 2 3 3 ACC 124 IndividualTaxProcedures* 3 0 3 ACC 201 IntermediateAccountingI* 3 0 3 ACC 202 IntermediateAccountingII* 3 0 3 ACC 230 CostAccountingI* 3 0 3 ACC 231 CostAccountingII* 3 0 3 ACC 240 ComputerizedAccounting* 3 0 3 BAF 260 FinancialManagement* 3 0 3 BUS 121 BusinessLawI* 3 0 3 COL 101 CollegeOrientation* 1 0 1 CPT 101 IntroductiontoComputers* 3 0 3 CPT 107 FileEntryOperations 3 0 3 CPT 170 MicrocomputerApplications*3 0 3 MGT101 PrinciplesofManagement* 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0credit hours. *Agradeof“C”orbetterisrequired. Minimumsemestercredithoursrequiredforgraduation:67
Automated Office Diploma ProgramDiploma
Business
63
63
Business
12 months; Day This curriculum prepares students for entry-level clerical office positions. The programprovidesstudentstheopportunitytodevelopskillsinwordprocessing,machinetranscrip-tion,filing,accounting,propertelephonetechniques,andtrainingonelectronictypewritersandcalculators.Personswiththeseskillsareessentialforofficesandareingreatdemandinbusiness,industryandgovernmentoffices. Inordertograduate,full-timestudentsinthisprogramusuallyenrollinfivecoursespersemesterwhichequatesto15classhoursperweekor15credithourspersemester.Additionallab hours may be required to complete assigned projects and practice skills. Attendance dur-ingonesummertermwillberequiredtocompleteprogramrequirements.Part-timestudentsmayrequiremoresemestersofattendancetograduate,withtheexactlengthdependentuponsemester offerings and the number of courses taken by the student. Upon registering, each newstudentshouldrequestasemestercourseoutlinewhichdescribesthecoursesandthespecificsemesterinwhichtheyarescheduled. Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletoschedulea full load of courses and graduate in the normal length of the program since course schedul-ingisdesignedfornewstudentsenteringinfallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursedescriptionatthebackofthiscatalog.Manycoursesrequireafinalgradeof“C” or better in order to register for more advanced courses. The courses are also noted in the course descriptions. In addition, many major courses require a grade of “C” or better to applytowardgraduation.Thesecoursesareindicatedundercourserequirements. Anyquestionsconcerningschedulingofcoursesorgraduationrequirementscanbeansweredby the program advisor or department head. Program requirements for graduation are listed onthefollowingpage. Practical Application:Automatedofficestudentscompleteclassprojectsusingup-to-dateequipment similar to that found in businesses and industries. Microcomputers are used to completewordprocessingprojects.Thedevelopmentofcommunication,interpersonal,andproblemsolvingskillswillbestressed. Job Opportunities: Clerktypist,typist,receptionist,officeclerk,andfileclerk.
Course Requirements for Automated Office Diploma Program Credit Class Lab Hours A. General Education Courses ENG 170 BusinessCommunications* 3 0 3 IDS 101 HumanThought&Learning 3 0 3 MAT 160 MathforBusiness&Finance* 3 0 3 B. Major Courses ACC 111 AccountingConcepts 3 0 3 COL 101 CollegeOrientation* 1 0 1 Credit Class Lab Hours
64
CPT 101 IntroductiontoComputers* 3 0 3 CPT 174 Microcomputer Spreadsheets* 3 0 3 OST 105 Keyboarding* 3 0 3 OST 110 DocumentFormatting* 3 0 3 OST 121 MachineTranscription* 3 0 3 OST 141 OfficeProceduresI* 3 0 3 OST 165 InformationProcessing Software* 3 0 3 OST 167 InformationProcessing Applications* 3 0 3 OST 210 DocumentProduction* 3 0 3 OST 251 AdministrativeSystems& Procedures* 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation None Minimumsemestercredithoursrequiredforgraduation:43 *Agradeof“C”orbetterisrequired.
System Support Technician Diploma ProgramDiploma
12 Months; Day18 Months; Evening
This curriculum prepares students to support user’s needs in a computing environment. Students learn to maintain microcomputer systems, solve user problems, support user ap-plications,andprovideusertrainingasneeded.Graduatesarewellversedinmicrocomputeroperations,includingmicrocomputerbasedbusinessapplicationsoftwareandmicrocomputerhardware.Inaddition,studentslearnoperatingsystemandnetwareconcepts.Inordertograduate,full-timestudentsinthisprogramusuallyenrollinfivecoursespersemester,whichequatesto15credithoursand15classhoursperweek.Inaddition,studentswillbeexpectedtospendbetween5and10hoursperweekoutsideofclassinthecomputerlabtocompleteprojects.Attendanceduringonesummertermwillberequiredtocompleteprogram requirements. Part-time students usually require more semesters of attendance to graduate,withtheexactlengthofattendancedependentuponsemesterofferingsandthenumberofcoursestakenbythestudent.Uponregistering,eachnewstudentshouldrequestasemestercourseoutlinewhichliststhecoursesandthespecificsemesterinwhichtheyare scheduled. Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletosched-ule a full load of courses and graduate in the normal length of the program since course schedulingisdesignedfornewstudentsenteringinfallsemester.Manyofthecourseslistedonthefollowingpagerequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursedescriptionatthebackofthecatalog.Manycoursesrequireafinalgradeof“C”orbetterinordertoregisterformoreadvancedcourses.Thesecourses are also noted in the course descriptions. In addition, many major courses require a gradeof“C”orbettertoapplytowardgraduation.Thesecoursesareindicatedundercourse
Business
65
67
Business
requirements. Any questions concerning scheduling of courses or graduation requirements canbeansweredbytheprogramadvisorordepartmenthead.Programrequirementsforgraduationarelistedonthefollowingpages. Practical Application:Theprogramemphasizeshands-ontrainingusingIBM’scompatibles.Manyprojectswillbecompletedusingcurrentsoftwareandhardwareusedinbusiness.Thecourse of study emphasizes the development of logical thinking, problem solving, interper-sonal and communication skills.
Job Opportunities:Systemsupporttechnician,usersupporttechnicianandnetworktechni-cian.
Graduates of this program may transfer into the associate degree program-management withinformationtechnologyelectives.
Course Requirements for System Support Technician Diploma Program
Credit Class Lab Hours A. General Education Courses ENG101 EnglishCompositionI* 3 0 3 ENG260 Adv.Tech.Communications3 0 3IDS 101 HumanThought&Learning 3 0 3 MAT101 BeginningAlgebra 3 0 3 MAT160 MathforBusiness&Finance* 3 0 3 B. Major Courses COL 101 CollegeOrientation* 1 0 1 CPT 107 FileEntryOperations* 3 0 3 CPT 111 BASICProgrammingI* 3 0 3CPT 114 Computers&Programming* 3 0 3 CPT 178 SoftwareApplications* 3 0 3CPT 179 MicrocomputerWord 3 0 3 Processing*CPT 255 OperatingSystems 2 3 3 Fundamentals* CPT 270 AdvancedMicrocomputer 3 0 3 Applications* IST 245 LocalAreaNetworks* 3 0 3MGT101 PrinciplesofManagement 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation None Minimumsemestercredithoursrequiredforgraduation:42 *Agradeof“C”orbetterisrequired.
Computer Technology Degree ProgramAssociate Degree in Computer Technology
66
21 Months; Day24 Months; Evening
Computer Technology Program students are given the opportunity to develop skills in computer programming, microcomputer operations, system analysis and design, computer softwareapplications,aspectsofcomputersandhowtobestutilizetheminthebusinessenvironment. Since they receive training using up-to-date computer equipment, graduates of this program have excellent job opportunities. Inordertograduate,full-timestudentsinthisprogramusuallyenrollinfivecoursespersemesterwhich equates to 15 credithours and15 classhoursperweekwith additionalassignedlabhours.Studentswillberequiredtoattendoneormoresummertermstocom-plete associate degree requirements. Part-time students usually require more semesters of attendance to graduate. The exact length of attendance depends upon semester offerings andthenumberofcoursestakenbythestudent.Uponregistering,eachnewstudentshouldrequestasemestercourseoutlinewhichliststherequiredcoursesandthespecificsemesterinwhichtheyarescheduled. Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletoschedulea full load of courses and graduate in the normal length of the program since course schedul-ingisdesignedfornewstudentsenteringinfallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursedescriptionatthebackofthiscatalog.Manycoursesrequireafinalgradeof “C” or better in order to register for advanced courses. These courses are also noted in the course descriptions. In addition, many courses require a grade of “C” or better to apply towardgraduation.Thesecoursesareindicatedundercourserequirements. Anyquestionsconcerningschedulingofcoursesorgraduationrequirementscanbeansweredby the program advisor or the department head. Program requirements for graduation are listedonthefollowingpage. Practical Application: The computer technology associate degree offers practical experience inCOBOLandRPGIIIprogramminglanguagesbycompletingmanyprojectsassignedinthecomputerlab.StudentswilllearnhowtoprogramandoperatemicrocomputersandtheIBMAS400minicomputer.Thedevelopmentoflogicalthinking,problemsolving,interpersonaland communication skills is stressed. Job Opportunities: Trainee programmers, entry-level programmers, junior programmers, programmer analyst, system analyst and computer operators.
Course Requirements for Computer Technology Degree Program Credit Class Lab Hours A. General Education Courses Social/BehavioralSciences 3 0 3 Humanities/FineArts 3 0 3 Credit Class Lab Hours
Business
67
71 ENG101 EnglishCompositionI* 3 0 3 MAT 102 IntermediateAlgebra** 3 0 3 MAT 120 ProbabilityandStatistics 3 0 3 SPC 205 PublicSpeaking 3 0 3 B. Major Courses ACC 101 PrinciplesofAccountingI* 2 3 3 COL 101 CollegeOrientation* 1 0 1 CPT 108 WordProcessingI* 1 0 1 CPT 114 Computers& Programming* 3 0 3 CPT 115 COBOLProgrammingI* 2 3 3 CPT 121 RPGProgramming* 2 3 3 CPT 168 ProgrammingLogic& Design* 3 0 3 CPT 174 MicrocomputerSpreadsheet* 3 0 3 CPT 185 Event-DrivenProgram* 3 0 3 CPT 208 SpecialTopicsinComp.Tech*3 0 3 CPT 209 ComputerSystemMgmt.* 3 0 3 CPT 215 COBOLProgrammingII* 2 3 3 CPT 221 RPGProgrammingII* 2 3 3 CPT 242 DataBase* 3 0 3 CPT 244 DataStructures* 3 0 3 CPT 257 OperatingSystems* 3 0 3 CPT 264 SystemsandProcedures* 3 0 3. IST 220 DataCommunications* 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0credit hours.
*Agradeof“C”orbetterisrequired. **Prerequisitealgebracoursesmayberequiredforplacementthat wasdeterminedbytheASSETalgebraentrancetestandagradeof “C” or better is required. Minimumsemestercredithoursrequiredforgraduation:71
Management Degree Program with Fire Service ElectivesAssociate Degree
Business
68
21 Months; Day24 Months; Evening
AttherequestofareafirechiefsandtheSouthCarolinaStateFireman’sAssociation,aspecialmanagementprogramhasbeendesignedspecificallyforindividualswhoarecurrentlywork-ingasapaidorvolunteerfirefighter.Thisprogramwillserveasabuildingblocktowardafour-yearbaccalaureatedegreeinfireserviceadministrationorfirepreventiontechnology. Manyofthecoursesneededareofferedatawidevarietyoftimesduringthedayandeve-ningandinstructorsoftherequiredbusinesscoursesarepreparedtoworkwithstudentstohandlerotatingshiftsandotherschedulingoptionswheneverpossible. Fifteensemesterhoursoffireserviceelectives,whichareofferedthroughdistancelearning,must be taken from The University of Memphis or some other National Fire Academy ac-credited school. Prior training through the National or State Fire Academy cannot be used towardcreditsintheassociatedegreeprogram;however,TheUniversityofMemphishasindicatedthattheywillconsiderthistrainingalongwithworkexperiencetowardabaccalaure-atedegree.AnarticulationagreementbetweentheUniversityofMemphisandSpartanburgTechnicalCollegehasbeensignedallowingSpartanburgTechnicalCollegestudentstotransfertotheUniversityofMemphisascandidatesforthebachelorofprofessionalstudieswithaconcentrationinfireadministrationorfirepreventiontechnology. Studentsinthisprogramwillhavethesameopportunitiesinotherelectivetractsasman-agement students including simulations, research projects, and the development of problem solving, interpersonal and communication skills. Any questions concerning scheduling of coursesorgraduationrequirementscanbeansweredbytheprogramadvisorordepartmenthead.Programrequirementsforgraduationarelistedbelowandonthefollowingpage.
Course Requirements for Management Degree Program with Fire Service Electives
Credit Class Lab Hours A. General Education Courses ECO 210 Macroeconomics 3 0 3 ENG 101 EnglishCompositionI* 3 0 3 ENG 102 EnglishCompositionII* 3 0 3 MAT 110 CollegeAlgebra* 3 0 3 SPC 205 PublicSpeaking 3 0 3 B. Required Core Courses ACC 101 AccountingPrinciplesI* 2 3 3 ACC 102 AccountingPrinciplesII* 2 3 3 BAF 260 FinancialManagement* 3 0 3 BUS 121 BusinessLawI* 3 0 3 COL 101 CollegeOrientation* 1 0 1 CPT 101 IntroductiontoComputers* 3 0 3 Credit Class Lab Hours
Business
69
MGT101 PrinciplesofManagement* 3 0 3 MGT150 Fundamentalsof Supervision* 3 0 3 MGT201 HumanResource Management* 3 0 3 MGT230 ManagingInformation Resources* 3 0 3 MKT 101 Marketing* 3 0 3 C. Fire Service Elective Courses* Thestudentmustcompleteatotalof15semestercredithoursfromthe National Fire Academy Open-Learning Program Accredited Colleges. D. Electives and/or Other Additional Courses Required for Graduation Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0 credit hours. A grade of “C” or better is required. Minimumsemestercredithoursrequiredforgraduation:64
Management Degree Program with Hospitality ElectivesAssociate Degree21 Months; Day
24 Months; Evening StudentsoftheManagementwithHospitalityElectivesProgramareprovidedtheopportunityto develop skills to effectively plan, organize, lead, and control the activities of both hotel andrestaurantorganizations.Focuswillbeplacedonthelodgingphaseofthehospitalityindustry,includingfrontoffice,housekeepingandengineering;aswellasontherestaurantphase, including food service operations, layout and design. Hospitality promotions and servicetechniqueswillalsobeintroduced. Inordertograduate,full-timestudentsinthisprogramusuallyenrollinfivecoursespersemesterwhichequatesto15credithoursand15classhoursperweek.Additionalhoursinthecomputerand/oraccountinglabarerequiredinsomesemesters.Studentswillberequired to attend one or more summer terms to complete associate degree requirements. Part-timestudentsusuallyrequiremoresemestersofattendancetograduate,withtheexactlength of attendance dependent upon semester offerings and the number of courses taken by the student.
Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletosched-ule a full load of courses and graduate in the normal length of the program since course schedulingisdesignedfornewstudentsenteringinfallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursedescriptionatthebackofthiscatalog.Manycoursesrequireafinalgradeof “C” or better in order to register for advanced courses. These courses are also noted in the course descriptions. In addition, many courses require a grade of “C” or better to apply
Business
70
towardgraduation.Thesecoursesareindicatedundercourserequirements.
Anyquestionsconcerningschedulingofcoursesorgraduationrequirementscanbeansweredby the program advisor or the department head. Program requirements for graduation are listedonthefollowingpage. Practical Applications: Students simulate the development and organization of a hotel and restaurant, complete research projects pertaining to the hospitality industry, and complete accountingandfinancesimulationsusingmicrocomputerapplications.Thedevelopmentofproblem solving, interpersonal and communication skills is stressed. Job Opportunities: Front desk manager, housekeeping supervisor, restaurant manager and customer service manager.
Course Requirements for Management Degree Program with Hospitality Electives
Credit Class Lab Hours A. General Education Courses ECO 210 Macroeconomics 3 0 3 ENG 101 EnglishCompositionI* 3 0 3 ENG102 EnglishCompositionII 3 0 3 MAT 102 IntermediateAlgebra* 3 0 3 MAT 120 ProbabilityandStatistics 3 0 3MAT160 MathforBusiness&Finance* 3 0 3 SPC 205 PublicSpeaking 3 0 3 B. Major Courses ACC 101 AccountingPrinciplesI* 2 3 3 ACC 102 AccountingPrinciplesII* 2 3 3 BAF 260 FinancialManagement* 3 0 3 BUS 121 BusinessLawI* 3 0 3 COL 101 CollegeOrientation*• 1 0 1 CPT 101 IntroductiontoComputers 3 0 3 HOS 140 TheHospitalityIndustry* 3 0 3 HOS 150 HotelManagement* 3 0 3 HOS 157 ServiceTechniques* 2 0 2 HOS166 HospitalityPromotion* 2 0 2 HOS 255 FoodServiceManagement* 3 0 3 MGT101 PrinciplesofManagement* 3 0 3 MGT150 FundamentalsofSupervision*3 0 3 MGT201 HumanResource Management* 3 0 3 MGT230 ManagingInformation 3 0 3 Resources* MKT101 Marketing* 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0credit
Business
71
hours. *Agradeof“C”orbetterisrequired. •ThiscoursemustbetakenasacorequisitewithMGT101. Minimumsemestercredithoursrequiredforgraduation:68
Management Degree Program with Marketing ElectivesAssociate Degree 21 Months; Day
StudentsoftheManagementwithMarketingElectivesProgramareprovidedtheopportu-nitytodevelopeffectivemanagementskillsrelatedtomarketingandsales.Emphasiswillbe placed on developing sales strategies to maximize revenues through effective product development,pricing,promotionandplacementinthemarket.Attentionwillalsobegivento retailing, advertising, consumer needs and customer service skills. Inordertograduate,full-timestudentsenrolledinthisprogramusuallyenrollinfivecoursespersemesterwhichequatesto15credithoursand15classhoursperweek.Additionalhoursinthecomputerand/oraccountinglabarerequiredinsomesemesters.Studentswillberequired to attend one or more summer terms to complete associate degree requirements. Part-timestudentsusuallyrequiremoresemestersofattendancetograduate,withtheexactlength of attendance dependent upon semester offerings and the number of courses taken by thestudent.Uponregistering,eachnewstudentshouldrequestasemestercourseoutlinewhichliststherequiredcoursesandthespecificsemesterinwhichtheyarescheduled. Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletoschedulea full load of courses and graduate in the normal length of the program since course schedul-ingisdesignedfornewstudentsenteringinfallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursedescriptionatthebackofthiscatalog.Manycoursesrequireafinalgradeof“C” or better in order to register for advanced courses. These courses are also noted in the course descriptions. In addition, many courses require a grade of “C” or better to apply towardgraduation.Thesecoursesareindicatedundercourserequirements. Anyquestionsconcerningschedulingofcoursesorgraduationrequirementscanbeansweredby the program advisor or the department head. Program requirements for graduation are listedonthefollowingpage.
Practical Application: Students develop an advertising campaign, make numerous sales presentations,conductamarketresearchsurveyandcompleteaccountingandfinancesimula-tions using microcomputer applications. The development of problem solving, interpersonal and communication skills is stressed. Job Opportunities: Salesperson, sales manager trainee, retail manager, advertising supervi-sor, marketing information specialist and customer service manager.
Course Requirements for Management Degree Programwith Marketing Electives
Business
72
Credit Class Lab Hours A. General Education Courses ECO 210 Macroeconomics 3 0 3 ENG101 EnglishCompositionI* 3 0 3 ENG102 EnglishCompositionII 3 0 3 MAT102 IntermediateAlgebra* 3 0 3 MAT 120 Probability&Statistics 3 0 3 MAT 160 MathforBusiness&Finance* 3 0 3 SPC 205 PublicSpeaking 3 0 3 B. Major Courses ACC 101 AccountingPrinciplesI* 2 3 3 ACC 102 AccountingPrinciplesII* 2 3 3 BAF 260 FinancialManagement* 3 0 3 BUS 121 BusinessLawI* 3 0 3 COL 101 CollegeOrientation*• 1 0 1 CPT 101 IntroductiontoComputers* 3 0 3 MGT101 PrinciplesofManagement* 3 0 3 MGT150 FundamentalsofSupervision*3 0 3 MGT201 HumanResourceMgmt* 3 0 3 MGT230 ManagingInfo.Resources* 3 0 3 MKT101 Marketing* 3 0 3 MKT110 Retailing* 3 0 3 MKT120 SalesPrinciples* 3 0 3 MKT135 CustomerServiceSkills* 3 0 3 MKT 221 SalesStrategies* 3 0 3 MKT 240 Advertising* 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0 credit hours.
*Agradeof“C”orbetterisrequired. •ThiscoursemustbetakenasacorequisitewithMGT101.
Minimumsemestercredithoursrequiredforgraduation:70
Management Degree Program with Information Technology Electives
Business
73
Associate Degree21 months; Day
StudentsoftheManagementwithInformationTechnologyElectivesProgramareprovidedtheopportunitytodevelopmanagementskillsrelatedtoinformationtechnology.Focuswillbe placed on the management of personnel involved in maintaining microcomputer systems, supporting users and providing user training. This program also provides a graduate of the system support technician diploma program the opportunity of completing an associate degree by transfer. Inordertograduate,full-timestudentsenrolledinthisprogramusuallyenrollinfivecoursespersemesterwhichequatesto15classhoursperweekor15credithours.Additionallabhours may be required to complete assigned projects and practice skills. Part-time students willrequiremoresemestersofattendancetograduate,withtheexactlengthdependentuponsemester offerings and the number of courses taken by the student. Upon registering, each newstudentshouldrequestasemestercourseoutlinewhichdescribesthecoursesandthespecificsemestersinwhichtheyarescheduled. Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletoschedulea full load of courses or may not be able to graduate in the normal length of the program sincecourseschedulingisdesignedfornewstudentsenteringafallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursesdescriptionatthebackofthiscatalog.Manycoursesrequireafinalgradeof“C”orbetterinordertoregisterformoreadvancedcourses.Thesecourses are also noted in the course descriptions. In addition, many major courses require agradeof“C”orbetter toapply towardgraduation.Thesecoursesare indicatedundercourse requirements. Any questions concerning scheduling of courses or graduation requirements can be an-sweredbytheprogramadvisorordepartmenthead.Programrequirementsforgraduationarelistedbelow. Practical Application: StudentscompletesoftwareapplicationprojectswithemphasisplacedonIBMcompatibles,simulatelocalareanetworkapplications,andaccountingandfinancesimulations using microcomputer applications. The development of problem solving, inter-personal and communications skills is stressed. Job Opportunities: System support manager, user support manager and supervisor of per-sonal computer technicians.
Course Requirements for Management Degree Program with
Information Technology Electives
Credit Class Lab Hours A. General Education Courses ECO 210 Macroeconomics* 3 0 3 ENG 101 EnglishComposition* 3 0 3 ENG102 EnglishCompositionII 3 0 3 Credit
Business
74
Class Lab HoursMAT102 IntermediateAlgebra* 3 0 3 MAT 120 ProbabilityandStatistics* 3 0 3 MAT 160 MathforBusiness&Finance 3 0 3 SPC 205 PublicSpeaking 3 0 3 B. Major Courses ACC 101 AccountingPrinciples* 2 3 3 ACC 102 AccountingPrinciplesII* 2 3 3 BAF 260 FinancialManagement* 3 0 3 BUS 121 BusinessLawI* 3 0 3 COL 101 CollegeOrientation*• 1 0 1 CPT 101 IntroductiontoComputers* 3 0 3 CPT 111 BasicProgramming* 3 0 3 CPT 178 SoftwareApplications* 3 0 3 CPT 179 MicrocomputerWord Processing* 3 0 3 CPT 255 OperatingSystems 3 0 3 Fundamentals* IST 245 LocalAreaNetworks* 3 0 3 MGT101 PrinciplesofManagement* 3 0 3 MGT150 FundamentalsofSupervision*3 0 3 MGT201 HumanResource Management* 3 0 3 MGT230 ManagingInformation 3 0 3 Resources* MKT 101 Marketing* 3 0 3
C. Electives and/or Other Additional Courses Required for Graduation Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0credit hours.
*Agradeof“C”orbetterisrequired. •ThiscoursemustbetakenasacorequisitewithMGT101. Minimumsemestercredithoursrequiredforgraduation:70
Management Degree Program with Textile Management Electives
Business
75
Business
Associate Degree24 Months; Day and 24 Months; Evening
StudentsoftheManagementwithTextileElectiveProgramareprovidedtheopportunitytoobtaintheknowledgeandskillsnecessarytobecomequalifiedforafirstlinesupervisor'spositioninthetextileindustry.Thestudentwillstudyoveralloperationsofamoderntex-tileplantfromrawfibertofinishedproduct.Studieswillincludetimeatareatextileplants,wherestudentswillobserveoperationsthatcorrespondtoclasswork.Thecourseofstudyemphasizes the development of logical thinking, problem solving, interpersonal and com-munication skills.
Inordertograduate,full-timestudentsenrolledinthisprogramusuallyenrollinfivecoursespersemesterwhichequatesto15credithoursand15classhoursperweek.Additionalhoursinthecomputerand/oraccountinglabarerequiredinsomesemesters.Studentswillberequired to attend one or more summer terms to complete associate degree requirements. Part-timestudentsusuallyrequiremoresemestersofattendancetograduatewiththeexactlength of attendance dependent upon semester offerings and the number of courses taken bythestudent.Uponregistering,eachnewstudentshouldrequestasemestercourseoutlinewhichliststherequiredcoursesandthespecificsemesterinwhichtheyarescheduled.
Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletosched-ule a full load of courses and graduate in the normal length of the program since course schedulingisdesignedfornewstudentsenteringinthefallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursedescriptionatthebackofthecatalog.Manycoursesrequireafinalgrade of "C" or better in order to register for advanced courses. These courses are also noted in the course descriptions. In addition, many courses require a grade of "C" or better to apply towardgraduation.Thesecoursesareindicatedundercourserequirements.
Anyquestionsconcerningschedulingofcoursesorgraduationrequirementscanbeansweredby the program advisor or the department head. Program requirements for graduation are listedonthefollowingpage.
Job Opportunities:CardingSupervisor,spinningsupervisor,windingsupervisor,slashingsupervisor,weavingsupervisorandinspectionsupervisor.
Course Requirements forManagement Degree Program with Textile Management Electives
Credit Class Lab HoursA. General Education Courses ENG 101 EnglishCompositionI* 3 0 3 ENG 260 AdvancedCommunications 3 0 3 HSS 205 TechnologyandSociety 3 0 3 IDS 101 HumanThought&Learning 3 0 3 Credit Class Lab Hours
76
MAT 101 CollegeAlgebra* 3 0 3 MAT120 ProbabilityandStatistics 3 0 3 SPC 205 PublicSpeaking 3 0 3 B. Required Core Courses ACC 101 AccountingPrinciplesI* 2 3 3 BUS 121 BusinessLawI* 3 0 3 COL 101 CollegeOrientation*• 1 0 1 CPT 101 IntroductiontoComputers* 3 0 3 MGT101 PrinciplesofManagement* 3 0 3 MGT150 Fund.ofSupervision* 3 0 3 MGT201 HumanResourceMgmt.* 3 0 3 MGT230 ManagingInfor.Resources* 3 0 3 MKT 101 Marketing* 3 0 3 TEX 101 FundamentalsofTextiles* 3 0 3 TEX 111 TextileProcessFiber/Spin* 1 3 2 TEX 115 ManagementSafety* 3 0 3 TEX 121 TextileEngineering* 3 3 4 TEX 201 TextileManufacturing* 3 0 3 TEX 202 TextileTechnology* 4 0 4
C. Electives and/or Other Additional Courses Required Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0credithours. *Agradeof"C"orbetterisrequired.
•ThiscoursemustbetakenasacorequisitewithTEX101. Minimumsemestercredithoursrequiredforgraduation:68
Office Systems Technology Degree ProgramAssociate Degree21 months; Day
This curriculum prepares students to be executive secretaries or administrative assistants. Theprogramprovidesstudentstheopportunitytodevelopskillsinnotetaking,wordpro-cessing,machinetranscription,filing,accounting,propertelephonetechniques,andtrainingonelectronic typewriters and calculators. Studentsgaina thoroughknowledgeofofficeprocedures by completing simulations on up-to-date equipment. Inordertograduate,full-timestudentsenrolledinthisprogramusuallyenrollinfivecoursespersemesterwhichequatesto15classhoursperweekor15credithours.Additionallabhours may be required to complete assigned projects and practice skills. Part-time students willrequiremoresemestersofattendancetograduate,withtheexactlengthdependentuponsemester offerings and the number of courses taken by the student. Upon registering, each newstudentshouldrequestasemestercourseoutlinewhichdescribesthecoursesandthespecificsemestersinwhichtheyarescheduled. Newstudentsbeginningaprograminspringorsummersemestersmaybeunabletoschedule
Business
77
Business
a full load of courses or may not be able to graduate in the normal length of the program sincecourseschedulingisdesignedfornewstudentsenteringafallsemester.Manyofthecourseslistedbelowrequiresuccessfulcompletionofothercourses.Theseprerequisitesarespecifiedattheendofeachcoursesdescriptionatthebackofthiscatalog.Manycoursesrequireafinalgradeof“C”orbetterinordertoregisterformoreadvancedcourses.Thesecourses are also noted in the course descriptions. In addition, many major courses require agradeof“C”orbetter toapplytowardgraduation.Thesecoursesare indicatedundercourse requirements. Any questions concerning scheduling of courses or graduation requirements can be an-sweredbytheprogramadvisorordepartmenthead.Programrequirementsforgraduationarelistedbelow. Practical Application:Officesystemstechnologystudentscompleteclassprojectsusingup-to-date equipment similar to that found in business and industry. Microcomputers are used tocompletewordprocessingprojects.Thedevelopmentofcommunication,interpersonalandproblemsolvingskillswillbestressed. Job Opportunities: Secretary, administrative assistant and executive secretary.
Course Requirements for
Office Systems Technology Degree Program
Credit Class Lab Hours A. General Education Courses ECO 101 BasicEconomics 3 0 3 ENG 170 BusinessCommunications* 3 0 3 ENG175 ProofreadingandEditing* 3 0 3IDS 101 HumanThought&Learning 3 0 3 MAT 160 MathforBusiness&Finance* 3 0 3 MAT 165 Statistics* 3 0 3
B. Major Courses ACC 111 AccountingConcepts 3 0 3 COL 101 CollegeOrientation* 1 0 1 CPT 101 IntroductiontoComputers* 3 0 3 CPT 174 MicrocomputerSpreadsheets*3 0 3 OST 105 Keyboarding* 3 0 3 OST 110 DocumentFormatting* 3 0 3 OST 121 MachineTranscription* 3 0 3 OST 133 ProfessionalDevelopment* 3 0 3 OST 141 OfficeProceduresI* 3 0 3 OST 165 InformationProcessing Software* 3 0 3 OST 167 InformationProcessing Applications* 3 0 3 Credit
78
Business
Class Lab Hours OST 170 Notetaking* 3 0 3 OST 210 DocumentProduction* 3 0 3 OST 251 AdministrativeSystems& Procedures* 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation Thestudentmustcompleteoneelectivecoursewhichtotals2.0or3.0cred-it hours. Minimumsemestercredithoursrequiredforgraduation:61 *Agradeof“C”orbetterisrequired.
79
Heal
th S
cien
ces T
echn
olog
y
80
Health Sciences
Health Sciences Technology
Associate Degree Programs Medical Laboratory Technology Office Systems Technology - Medical Option Radiologic Technology Respiratory Care
Diploma Programs Dental Assisting Early Childhood Development Medical Assisting Practical Nursing Respiratory Care Surgical Technology
Certificate Programs Advanced Child Care Management Early Childhood Development Health Sciences Certificate Health Unit Coordinating Multi-Skilled Health Technology Pre-Dental Hygiene Pre-Health Information Management Pre-Occupational Therapy Assistant Pre-Physical Therapist Assistant
81
Health Sciences
Application Procedure for Health Sciences Technology
The application procedure for Health Sciences Technology Programs includes submit-ting an application form, $10 application fee, high school and college transcripts, and taking the College’s placement test. When all of the above procedures are completed, an admissions meeting will be scheduled with an admissions counselor After acceptance, a health form will be requested and must be completed as directed by the department head. In addition to the above procedures, some health sciences technology programs require departmental interviews. Prerequisites for admission to Health Sciences Technol-ogy Programs are listed below:
• Dental Assisting: one unit high school biology or chemistry, typing or equivalent with a grade of "C" or better
• Medical Assisting: one unit high school biology or chemistry, algebra or equivalent with a grade of "C" or better
• Medical Laboratory Technology: one unit high school biology, chemistry, algebra or equivalent with a grade of "C" or better
• Practical Nursing: one unit high school biology or chemistry, algebra or equivalent with a grade of "C" or better
• Radiologic Technology: one unit high school biology or chemistry, algebra or equivalent with a grade of "C" or better
• Respiratory Care: one unit high school biology or chemistry, algebra or equivalent with a grade of "C" or better
• Surgical Technology: one unit high school biology or chemistry, algebra or equiva-lent with a grade of "C" or better
• Pre-Dental Hygiene: one unit high school biology, chemistry and algebra or equiva-lent with a grade of "C" or better, attendance at Career Talk
• Pre-Health Information Management: one unit high school biology, chemistry and algebra or equivalen with a grade of "C" or better, attendance at Career Talk
• Pre-Occupational Therapy Assistant: one unit high school biology, chemistry and algebra or equivalent with a grade of "C" or better, attendance at Career Talk
• Pre-Physical Therapist Assistant: one unit high school biology, chemistry and alge-bra or equivalent with a grade of "C" or better, attendance at Career Talk. Physics is recommended.
The admissions office considers placement test results and prerequisite course require-ments in determining eligibility for admission.
Accepted health sciences technology applicants may elect to enroll in general education courses or designated major courses prior to enrolling in the health sciences technology program. These students are required to adhere to the academic standards of their chosen curriculum. They must earn a minimum of a 2.0 grade point average and a minimum grade of “C” in required courses, as indicated in the curriculum displays. (Accepted health sci-ences technology applicants should refer to specific academic requirements and standards of the chosen health sciences technology program for specific program information.) Courses which contain a clinical/practicum component cannot be audited.
82
General Requirements of the Health Sciences Technology Programs
All programs require successful completion of the courses listed under each program description. Courses are offered in a prescribed sequence so that all prerequisite require-ments can be fulfilled before entering the next term. These prerequisites are specified at the end of each course description at the back of the catalog. All major courses must be satisfactorily completed in the order they are offered or the student will not be allowed to continue in the next major course(s).
A specific numerical grade is required on all major courses in each program to be eligible for graduation. Any grade below the program's specific numerical grade will not allow a student to enroll in the new curriculum course or courses of which the unsuccessfully completed course is a prerequisite.
Upon entering a Health Sciences Technology Program each student will receive a hand-book outlining specific program requirements and clinical/practicum assignments.
The following criteria must be met in order to re-enter any Health Sciences Technology Division curriculum: reapply and meet current admission and curriculum requirements; update file in admissions and make appointment and meet with the Health Sciences Technology Division counselor; and update health form. Consideration for readmission will be determined by the individual factors affecting the student's exit, the availability of space and the elapsed time interval from date of exit.
Advanced Child Care Management ProgramCertificate - 12 Months; Day and Evening
The Advanced Child Care Management Program is designed to prepare the graduate to work in a supervisory, managment or administrative position in early childhood devel-opment. Specific areas focus on public relations, interpersonal skills, accounting skills, curriculum development, computer skills, communication and problem-solving skills.
Students may enroll full-time or part-time in this three-semester program. The number of courses that can be taken will vary with the individual student in addition to the time that the course is taken (day or evening). Course availability will depend on the number of students enrolled in each course. There is no required sequence in which the courses must be taken.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed below.
Practical Application: Time is spent in classroom and lab activities that enhance the application of early childhood development and management skills to the actual work
Health Sciences
83
environment.
Job Opportunities: Special education facilities, child development centers, etc.
Course Requirements for Advanced Child Care Management Certificate Program
Credit
Class Lab Hours
A. General Education Courses No general education courses required. B. Major Courses ACC 111 Accounting Concepts 3 0 3 COL 101 College Orientation 1 0 1 CPT 101 Introduction to Computers 3 0 3 ECD 102 Growth and Development I 3 0 3 ECD 105 Guidance-Classroom Mgmt. 3 0 3 ECD 107 Exceptional Children 3 0 3 ECD 108 Family and Community Relations 3 0 3 ECD 109 Administration and Supervision 3 0 3 ECD 135 Health, Safety & Nutrition 3 0 3 ECD 137 Methods and Materials 1 6 3 MGT 105 Survey of Management 2 0 2 C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program.
Minimum semester credit hours required for graduation: 30
Dental Assisting Diploma ProgramDiploma - 12 Months; Day
The dental assistant works closely with the dentist in an interesting variety of capacities including chairside assistant, office manager and laboratory assistant. Chairside assisting involves receiving and preparing the patient for treatment, preparing dental instrument setups and assisting the dentist in the treatment of patients. As office manager, the den-tal assistant is a liaison between the dentist and patient by maintaining patient records, making appointments and collecting fees.
Exposing and processing x-rays and following proper radiographic safety procedures are among their responsibilities. Other duties include mixing materials for restorations and impressions, infection control, and providing dental health education to patients.
Health Sciences
84
Health Sciences
Vital attributes of a dental assistant include not only manual dexterity, but a friendly and enthusiastic approach to patients and co-workers.
Full-time day students in this program enroll in two to seven courses per term which average 26 - 36 class hours per week or 9-18 credit hours per term.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed on the following page. Refer to the general introduction of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technology Programs.
Accreditation: Council on Dental Education of the American Dental Association. Graduates of this program are eligible to write the Dental Assisting National Board Examination to become Certified Dental Assistants.
Practical Application: Dental assisting students work on a daily basis in a simulated dental office. A dentist visits weekly during the spring semester to provide students job-related training. In addition, dental assisting students gain clinical experience in local dental of-fices during the second and third semesters.
Job Opportunities: Chairside assistant, receptionist, orthodontic assistant, oral surgery assistant, pediatric dental assistant, endodontist assistant and periodontist assistant.
Course Requirements for Dental Assisting Diploma Program
Credit
Class Lab Hours
A. General Education Courses ENG 165 Professional Communication 3 0 3
MAT 150 Fundamentals of Mathematics 3 0 3 PSY 103 Human Relations 3 0 3
B. Major Courses COL 101 College Orientation 1 0 1 DAT 112 Integrated Human Science 4 0 4 DAT 113 Dental Materials 3
4 4 DAT 115 Ethics and Professionalism 0 3 1
DAT 118 Dental Morphology 2 0 2
DAT 121 Dental Health Education 1 3 2 Credit Class
85
Health Sciences
Lab Hours DAT 122 Dental Office Management 2 0 2
DAT 123 Oral Medicine/Oral Biology 3 0 3 DAT 124 Expanded Functions/Specialties 0 3 1 DAT 127 Dental Radiography 3 4 4 DAT 154 Clinical Procedures I 2 6 4 DAT 174 Office Rotation 0
12 4 DAT 177 Dental Office Experience 0 35 7 C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program.
Minimum semester credit hours required for graduation: 48
Early Childhood Development ProgramsDiploma - 12 months; Day
Certificate - 16 months; Night
The Early Childhood Development Program is concerned with the social, emotional, physical, and mental development of the young child. An early childhood development student requires specific skills and abilities for creating and developing various activities for the education of children both in and out of the classroom.
Full-time day students in this program enroll in four to six courses per term which average 20 - 25 class hours per term or 12. 0 - 18. 0 credit hours per semester. Night schedules vary for ECD Certificate..
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed below and on the following page. Refer to the general introduc-tion of the Health Sciences Technology Division for additional information relevant to all Health Sciences Programs.
Practical Application: The Early Childhood Development Program is affiliated with numer-ous child development centers, private and public kindergartens and special centers for the handicapped. Students gain experience on a weekly basis at these sites.
Job Opportunities: Teacher’s aide in school systems, special education facilities, or child development centers, associate teacher in child development facilities, teacher in child development facilities or Head Start.
Course Requirements for
86
Health Sciences
Early Childhood Development Diploma Program
Credit Class Lab
HoursA. General Education Courses ENG 165 Professional Communications 3 0 3 MAT 150 Fundamentals of Mathematics 3 0 3 PSY 201 General Psychology
3 0 3 B. Major Courses COL 101 College Orientation 1 0 1 ECD 101 Introduction to Early Childhood 3 0 3 ECD 102 Growth and Development I 3 0 3 ECD 103 Growth and Development II 3 0 3 ECD 105 Guidance-Classroom Mgmt. 3 0 3 ECD 131 Language Arts
3 0 3 ECD 132 Creative Experiences 1 6
3 ECD 133 Science and Math Concepts 3 0 3 ECD 135 Health, Safety and Nutrition 3 0 3 ECD 137 Methods and Materials 1 6 3 ECD 143 Supervised Field Experience I 0 9 3 ECD 144 Supervised Field Experience II 0 9 3 PSY 214 Psychology of the Exceptional Child 3 0 3 C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program.
Minimum semester credit hours required for graduation: 46
Course Requirements for Early Childhood Development Certificate Program
Credit Class Lab HoursA. General Education
None
B. Major Courses ECD 101 Introduction to Early Childhood 3 0 3 ECD 102 Growth and Development I 3 0 3 ECD 103 Growth and Development II 3 0 3
87
92
Health Sciences
ECD 105 Guidance-Classroom Mgmt. 3 0 3 ECD 107 Exceptional Children 3 0 3
ECD 131 Language Arts 3 0 3
Credit Class
Lab Hours ECD 132 Creative Experiences 1 6
3 ECD 133 Science and Math Concepts 3 0 3 ECD 135 Health, Safety and Nutrition 3 0 3
C. Electives and/or other Additional Courses Required for Graduation No electives required for this program. Minimum semester credit hours required for graduation: 27
Note: The Early Childhood Development Certificate has been approved as an alternative to the Child Development Associate (CDA) credential required as certification for Head Start teachers.
Health Sciences Certificate ProgramCertificate - 9 months; Day
The Health Sciences Certificate Program will provide entry-level skills for those seeking employment in the health field as a nurse aide after passing the Nurse Aide Certification Examination. This program will allow students who are seeking acceptance into a health sciences curriculum to enroll in courses, some of which will transfer into their chosen curriculum. The Health Sciences Certificate Program will allow the students who want to do something in the health field but are not sure what, to explore options while taking courses that may transfer into their final choice.
In order to graduate, full-time students in this program usually enroll in four or five courses per semester and complete the program in two semesters. Part-time students require more semesters of attendance to graduate. The exact length depends upon the semester offerings and the number of courses taken by the student.
Practical Application: Time is spent in affiliating hospitals, nursing homes and in classroom situations to enhance communication and problem-solving skills.
Job Opportunities: Hospitals, nursing homes, clinics and home health agencies.
Course Requirements for Health Sciences Certificate Program Credit Class Lab HoursA. General Education
88
Health Sciences
COL 103 College Skills 3 0 3 CPT 101 Introduction to Computers 3 0 3 ENG 165 Professional Communications 3 0 3 or Credit Class Lab Hours or ENG 101 English Composition I 3 0 3 MAT 155 Contemporary Mathematics 3 0 3 PSY 103 Human Relations 3 0 3 or PSY 201 General Psychology 3 0 3 B. Major Courses COL 101 College Orientation 1 0 1 AHS 104 Medical Vocabulary/Anatomy 3 0 3 AHS 105 Medical Ethics and Law 2 0 2 AHS 151 Health Care Procedures 3 6 5
C. Electives and/or Additional Courses Required for Graduation No electives required for this program.
Minimum semester credit hours required for graduation: 26
Health Unit Coordinating Certificate ProgramCertificate - 9 months; Day
The health unit coordinator performs clerical duties for nursing units in hospitals, in other hospital departments and doctors' offices. Interpersonal skills are vital in his/her role as a communicator to nursing staff, physicians, other hospital staff, and patients and their families. These skills also include the special area of relating to ill and anxious people. The health unit coordinator has a strong knowledge of medical terminology, medical procedures and diagnostic tests. This knowledge is used to requisition general hospital or medical services from the appropriate department as they are ordered by the physician.Full-time students in this program enroll in five courses per term which average 24 class hours per week or 16 credit hours per term.Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed below and on the following page. Refer to the general introduc-tion of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technology Programs.
Accreditation: Graduates are eligible to write the National Certification Examination for Health Unit Coordinators.
Practical Applications: During the last term of the Health Unit Coordinating Program, students gain practical experience in affiliated hospitals and clinics.
89
Health Sciences
Job Opportunities: Unit secretaries, clerks in other hospital areas, receptionists in doctors' offices, or other medical settings.
Course Requirements for Health Unit Coordinating Certificate Program
Credit Class Lab
HoursA. General Education Courses CPT 107 File Entry Operations 3 0 3 ENG 165 Professional Communications 3 0 3 IDS 101 Human Thought and Learning 3 0 3 B. Major Courses COL 101 College Orientation 1 0 1 AHS 102 Medical Terminology 3 0 3 AHS 104 Medical Vocabulary/Anatomy 3 0 3 AHS 105 Medical Ethics and Law 2 0 2 HUC 101 Health Unit Procedures I 3 0 3 HUC 102 Health Unit Procedures II 3 0 3 HUC 151 Clinical Procedures I 0 12 4 HUC 152 Clinical Procedures II 0 12
4C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program. Minimum semester credit hours required for graduation: 32
Medical Assisting Diploma ProgramDiploma - 12 months
The Medical Assisting Program is designed to provide multiskilled practitioners to the medical community. The medical assistant is able to perform business office procedures, as well as simple nursing skills and selected diagnostic tests. Strong interpersonal skills are required in this field. Full-time students in this program enroll in three to six courses per semester and average 28 to 32 class/lab hours per week, for a total of 14 to 18 credits per term. Program requirements for graduation are listed on the next page. Refer to the general introduction of the Health Sciences Technology Division in the College Catalog for additional information relevant to all health sciences programs.
Accreditation: Graduates of the Medical Assisting Program are eligible to sit for the certification exam offered by the American Association of Medical Assistants (AAMA). Practical Application: The students will spend time completing a clinical component of the program in local physicians’ offices.
90
Job Opportunities: Physicians’ offices, private homes and selected areas in hospitals and clinics.
Course Requirements for Medical Assisting Diploma Program Credit
Class Lab Hours
A. General Education Courses ENG 165 Professional Communications 3 0 3 MAT 160 Math for Business & Finance 3 0 3 PSY 201 General Psychology 3 0 3
B. Major Courses COL 101 College Orientation 1 0 1 AHS 102 Medical Terminology 3 0 3 AHS 104 Medical Vocabulary/Anatomy 3 0 3 MED 103 Medical Assisting Introduction 3 0 3 MED 105 Medical Assisting Office Skills I 3 6 5 MED 106 Medical Assisting Office Skills II 1 6 3 MED 107 Medical Office Management 3 3 4 MED 112 Medical Assisting Pharmacology 1 3 2 MED 114 Medical Assisting Clinical Procedures 2 6 4 MED 115 Medical Office Lab Procedures 3 3 4 MED 156 Clinical Experience I 0 18 6 OST 105 Keyboarding 3 0 3
C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program.
Minimum semester credit hours required for graduation: 50
Medical Laboratory Technology Degree ProgramAssociate Degree - 21 Months; Day
The medical laboratory technician, working under the supervision of a medical technolo-gist, performs tests ranging from simple premarital blood tests to more complex procedures for detecting such diseases as diabetes, anemia, leukemia, and cancer. Specimens such as blood, urine, spinal fluid, other body fluids, and tissues are examined by the medical laboratory technician to provide the physician with accurate test results. These results are used by the physician to diagnose, treat, and subsequently monitor patient prog-ress. As medical investigators, medical laboratory technicians perform blood collection techniques, operate complex electronic equipment, computers, and examine specimens under a microscope. Medical laboratory technicians spend less time with patients than do other allied health professionals, but are important members of the health care team providing vital information which can influence the treatment of patients.
Health Sciences
91
Health Sciences
Full-time students in this program enroll in four to five courses per term which average 23 - 33 class/lab hours per week or 12.0 - 19.0 credit hours per term.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed below and on the following page. Refer to the general introduc-tion of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technology Programs.
Accreditation: National Accrediting Agency for Clinical Laboratory Sciences (NAACLS). Graduates are eligible to write the National Registry Examination.
Practical Application: The MLT program is affiliated with six area hospitals. During the second year of the program, medical laboratory students gain nine months clinical ex-perience at one or more of these hospitals.
Job Opportunities: Hospital laboratories, private laboratories, industrial laboratories, doctors’ offices, and veterinary clinics.
Course Requirements for Medical Laboratory Technology Degree Program
Credit Class Lab Hours A. General Education Courses CPT 101 Introduction to Computers 3 0 3 ENG 101 English Composition I 3 0 3 PSY 201 General Psychology 3 0 3 MAT 155 Contemporary Mathematics 3 0 3 ENG 102 English Composition II 3 0 3
B. Major Courses COL 101 College Orientation 1 0 1 MLT 105 Medical Microbiology 3 3 4 MLT 108 Urinalysis and Body Fluids 2 3 3 MLT 110 Hematology 3
3 4 MLT 115 Immunology 2 4 3 MLT 120 Immunohematology 3 3 4 MLT 130 Clinical Chemistry 3 3 4 MLT 205 Advanced Microbiology 3 3 4 MLT 210 Advanced Hematology 3 3 4 MLT 230 Advanced Clinical Chemistry 3 3 4 MLT 241 Medical Lab Transition 3 0 3 MLT 251 Clinical Experience I 0 15 5 MLT 252 Clinical Experience II 0 15 5
92
MLT 253 Clinical Experience III 0 15 5 MLT 254 Clinical Experience IV 0 15 5 C. Electives and/or other Additional Courses Required for Graduation The student must complete one elective course which totals 2.0-3.0 credit hours.
Minimum semester credit hours required for graduation: 76
Multi-Skilled Health Technology Certificate ProgramCertificate - 1 Semester; Day
The Multi-Skilled Health Technology Program is currently a full-time, one-semester pro-gram designed to provide a multi-skilled technician for acute and long-term care. The multi-skilled technician performs basic and advanced nursing assistant skills, phlebotomy, basic respiratory skills and electrocardiograms (EKGs). The technician is also exposed to problem-solving and team-building strategies.
Full-time students in this program enroll in five courses for one term averaging 21 class hours a week for a total of 13 credit hours.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed below. Refer to the general introduction of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technol-ogy Programs.
Practical Applications: During this program the student spends time in the classroom, lab and clinical settings building proficiency in such health care procedures as making beds, catheter insertion, dressing changes, specimen collection and blood glucose monitor-ing. The student also learns basic phlebotomy techniques, oxygen administration and monitoring techniques and how to do EKGs.
Job Opportunities: Hospitals, physicians' offices, clinics, extended care facilities and home health agencies.
Course Requirements for Multi-Skilled Health Technology Certificate Program
Credit Class Lab HoursA. General Education Courses No general education courses required.
B. Major Courses AHS 140 Therapeutics for Health 2 3 3 AHS 142 Phlebotomy 0 6 2 AHS 151 Health Care Procedures I 3 6 5
Health Sciences
93
AHS 158 Nurse Assisting Techniques II 1 3 2 COL 101 College Orientation 1 0 1 C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program.
Minimum semester credit hours required for graduation: 13
Office Systems Technology Degree Program-Medical OptionAssociate Degree - 21 Months; Day
The skills learned in the Office Systems Technology Program are increasingly regarded as an essential requirement for the effective management and efficient operation of the medical office, medical records department or other related health care facilities. A strong background in medical terminology, typing and transcription allows the graduate to become a medical transcriptionist. Accurate and timely transcribing of the doctor’s dictation is integral to the smooth operation of hospitals and physicians offices.
In addition, the office procedures skills allows him/her to perform in other capacities such as processing medical insurance claims, coding, billing and general office management. In the role of office receptionist, good interpersonal skills are vital to greeting patients and serving their needs.
Full-time students in this program enroll in three to five courses per term which average 16 class hours per week or 15.0 credit hours per term.
Graduates from the program will receive an associate degree in business technology.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed on the following page. Refer to the general introduction of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technology Programs.
Practical Application: Practical experience in local doctors’ offices and health care facili-ties is gained during the last semester.
Job Opportunities: Medical record department, other hospital departments, medical offices, clinics, other health care facilities and independent transcription in one's home.
Course Requirements for
Health Sciences
94
Office Systems Technology Degree Program-Medical Option
Credit Class Lab
HoursA. General Education Courses ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 MAT 160 Math for Business and Finance 3 0 3 SPC 205 Public Speaking 3 0 3 PSY 201 General Psychology 3 0 3 B. Major Courses AHS 102 Medical Terminology 3 0 3 AHS 104 Medical Vocabulary/Anatomy 3 0 3 AHS 118 Medical Coding & Insurance 3 6 5 COL 101 College Orientation 1 0 1 MED 122 Medical Assist. Lab Procedures I 2 0 2 OST 112 Medical Document Formatting 3 0 3 OST 122 Med. Machine Transcription I 3 0 3 OST 143 Office Systems and Procedures 3 0 3 OST 165 Information Processing Software 3 0 3 OST 167 Information Processing Applications 3 0 3 OST 212 Medical Document Production 3 0 3 OST 222 Med. Machine Transcription II 3 0 3 OST 223 Medical Machine Trans. III 3 0 3 OST 252 Med. Systems and Procedures 3 0 3 OST 272 SCWE in Office Systems 0 15 5 PHM 115 Drug Classifications I 2 0 2 C. Electives and/or Other Additional Courses Required for Graduation The student must complete one elective course which totals 2.0-3.0 credit
hours.
Minimum semester credit hours required for graduation: 66
Practical Nursing Diploma ProgramDiploma - 12 Months; Day
A graduate of the Practical Nursing Program administers nursing care to the convalesc-ing and chronically ill patient and assists the registered nurse in providing quality care for the more acutely ill or injured patient. Because of the nature of the career, a strong desire to serve other people is essential. Sound interpersonal skills, as well as technical skills, are required of a graduate practical nurse.
Health Sciences
95
Full-time students in this program enroll in four to five courses per term which average 20- 27 class hours per week for a total of 12.0 - 19.0 credit hours per term .
Specific questions concerning admission requirements, scheduling of courses or gradua-tion requirements can be answered by the department head. Program requirements for graduation are listed below and on the following page. Refer to the general introduc-tion of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technology Programs.
Accreditation: The Practical Nursing Program is approved by the South Carolina Depart-ment of LLR-Board of Nursing. Graduates of the program are eligible to write the Practical Nursing Examination (NCLEX-PN) for state licensure.
Practical Application: During the year , time is spent in affiliated hospitals, doctors’ offices, and surrounding clinics as applicable to the program and associated lectures.
Job Opportunities: Hospitals, doctors’ offices, nursing homes, clinics and private homes.
Course Requirements for Practical Nursing Diploma Program Credit Class Lab
Hours A. General Education Courses ENG 165 Professional Communications 3 0 3 MAT 155 Contemporary Mathematics 3 0
3 PSY 103 Human Relations 3
0 3 B. Major Courses AHS 104 Medical Vocabulary/Anatomy 3 0 3 COL 101 College Orientation 1 0 1 PNR 110 Fundamentals of Nursing 3 6 5 PNR 112 Nutrition 2
0 2 PNR 120 Medical-Surgical Nursing I 3 6 5
PNR 122 Pharmacology 2 2 3 PNR 130 Medical-Surgical Nursing II 3 6 5
PNR 140 Medical-Surgical Nursing III 3 6 5 PNR 150 Maternal and Infant Nursing 2 6 4 PNR 160 Nursing of Children 2 6 4 PNR 170 Nursing of the Older Adult 1 3 2 PNR 181 Special Topics in Pract. Nursing 1 0 1 C. Electives and/or Other Additional Courses Required for Graduation
Health Sciences
96
Health Sciences
No electives required for this program.
Minimum semester credit hours required for graduation: 49
Pre-Dental Hygiene Certificate ProgramCertificate - 9 months; Day, Night
The dental hygienist is a preventive health care professional, a member of the dental health care team. A dental hygienist is trained to provide preventive services in a variety of settings: hospitals, school systems, specialized institutions, public health and in the private dental office. His/her major role is as an educator since the dental hygienist is responsible for individualized patient education plans. Other duties include patient scheduling, exposing and processing x-rays, scaling, polishing and fluoride treatments.
The concept of the program design is simply a shared venture of schools to offer a spe-cialized curriculum. The first phase of the program is offered at Spartanburg Technical College and clusters all of the general education and related course work required for the program. Students may complete the first phase as a full-time or part-time student, designing their schedule according to their needs and personal situation. There is a five-year time limit for this portion, so it is imperative that required courses are completed in a timely fashion. Upon successful completion of the first phase, students are eligible for the second phase. The second phase of the program clusters all of the dental hygiene course work and must be taken at Greenville Technical College. This is a difficult and intensely structured course of study. This portion of the program is offered in daytime only and is full-time lasting four semesters (approximately 60 weeks or 15 months). Graduates from the program will receive a certificate in pre-dental hygiene from Spar-tanburg Technical College and an associate degree in health science from Greenville Technical College and will be eligible to write the National Board Exam and state licen-sure exams.
If you plan to complete phase I at Spartanburg Technical College, you must apply to, and be accepted by, Spartanburg Technical College. The design of your program schedule, term by term registration, course selection and time line is totally coordinated by the advisor at Spartanburg Technical College. The completion of phase I must be concluded in a timely manner (no more than five years). Any "BIO" prefix course must be taken within five (5) calendar years of the planned transfer to Greenville Technical College for phase II, except BIO 218 which must be taken within two (2) calendar years of progression to phase II.
After a student is accepted, he/she will be assigned to a program advisor. Progression through the program must be coordinated by the advisor.
Students must maintain a minimum cumulative GPA of 2.5 with no less than a "C" in each course. If your cumulative GPA falls below 2.5, or you make less than a "C" in a required phase I course, you will be required to repeat the course (once only) and earn a "C" or above before you will be eligible for phase II.
Greenville Technical College reserves the right to make changes in the program at any time without notice.
97
Health Sciences
Course Requirements for Pre-Dental Hygiene Certificate Program - Phase I
Credit Class Lab HoursA. General Education Courses BIO 210 Anatomy and Physiology I 3 3 4 BIO 211 Anatomy and Physiology II 3 3 4 ** BIO 218 Head and Neck Anatomy 0 3 1 ** BIO 225 Microbiology 3 3 4 CHM 105 General, Org. and Biochemistry 3 3 4 ENG 101 Composition I 3 0 3 ENG 102 English Composition II 3 0 3 MAT 120 Probability and Statistics 3 0 3 PSY 201 General Psychology 3 0 3 SPC 205 Public Speaking 3 0 3 SOC 101 Introduction to Sociology 3 0 3
B. Major Courses All major courses must be taken at Greenville Technical College.
C. Electives and/or Additional Courses Required *Humanities Elective *An elective can be taken during phase I or phase II of the program. The elective is any college transfer course equivalent
to 3.0 semester credit hours in the humanities.
**This course must be taken during phase I at Greenville Technical College. The course will be offered at Greenville Technical College in the fall, spring and summer semesters.
Pre-Health Information Management Certificate ProgramCertificate - 9 Months, Day, Night
As routine health care moves away from hospitals toward outpatient care centers, the number of positions becoming available for qualified health information technicians is rapidly increasing. In this area and throughout Upstate South Carolina, there is a grow-ing demand for trained health information management (HIM) graduates. In addition to hospitals and doctors’ offices, opportunities in HIM also exist in industrial clinics, public health agencies, long-term care facilities and the insurance industry, to name a few. Health information technicians design, organize and manage medical records. These professionals have the knowledge and skills to process, analyze and distribute health care information needed by the patient and health facility. A successful health information technician is a detail-oriented person not intimidated by paperwork and computers, with a fascination for medical facts and figures.
Beginning students should have excellent verbal and math skills. High school algebra,
98
biology and chemistry with a grade of "C" or better are required. Students must attend Greenville Technical College’s Career Talk. The concept of the program design is simply a shared venture of colleges to offer a specialized curriculum. This first phase of the program is offered at Spartanburg Technical College and clusters all of the general education and related course work required for the program. Students may complete the first phase as a full-time or part-time student, designing their schedule according to their needs and personal situation. There is a five-year limit to this portion, so it is imperative that required courses are completed in a timely fashion. The second phase of the program clusters all of the health information management course content and must be taken at Greenville Technical College. This portion of the program is offered in the daytime only and is full-time. This is a challenging, highly structured program requiring extensive student commitment for completion. Students who receive a certificate in pre-health information management from Spartanburg Technical College and complete required upper level courses in HIM will be eligible to receive an associate's degree in health science from Greenville Techni-cal College. If you plan to complete phase I at Spartanburg Technical College, you must apply to and be accepted by Spartanburg Technical College. The design of your program schedule, term by term registration, course selection and timeline is coordinated by the advisor at Spartanburg Technical College. The completion of phase I must be concluded in a timely manner (no more that five years). After a student is accepted, he/she will be assigned to a program advisor. Progression through the program must be coordinated by the advisor. Students must maintain a minimum cumulative GPA of 2.5 with no less than a “C” in each course. If your cumulative GPA falls below 2.5 or you make less than a “C” in a required course, you will be required to repeat the course (once only) and earn a “C” or better before you will be eligible for phase II.
Greenville Technical College reserves the right to make changes in the program at any time without notice.
Course Requirements for Pre-Health Information Management Certificate Program - Phase I Credit Class Lab HoursA. General Education Courses AHS 102 Medical Terminology 3 0 3 or AHS 104 Medical Vocabulary/Anatomy 3 0
3 BIO 210 Anatomy and Physiology I 3 3 4 BIO 211 Anatomy and Physiology II 3 3 4 BIO 242* Pharmacology 3 0 3 CPT 101 Introduction to Computers 3 0 3 ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 MAT 120 Probability and Statistics 3 0 3 Credit Class Lab Hours
Health Sciences
99
Health Sciences
PSY 201 General Psychology 3 0 3 SPC 205 Public Speaking 3 0 3 Elective (humanities) 3 0 3 *This course must be taken at Greenville Technical College. B. Major Courses All major courses must be taken at Greenville Technical College (phase II).C. Electives and/or Additional Courses Required Elective (humanities): A student must complete one elective which totals at least three semester credit hours.
Pre-Occupational Therapy Assistant Certificate ProgramCertificate - 9 Months, Day, Night
The Occupational Therapy Assistant Program provides services to those whose abilities to cope with basic tasks of living, work and leisure are threatened or impaired by develop-mental deficits, the aging process, poverty, cultural differences, physical injury or illness, or psychological and social disability. A work environment for an occupational therapy assistant (OTA) may be a hospital, nursing home, mental health facility, rehabilitation facility, school, camp, private home or community agency.
Beginning students should have excellent verbal and math skills. High school algebra, biology and chemistry are required with a grade of "C" or better and physics is recom-mended. Students must attend Greenville Technical College’s Career Talk. The concept of the program design is simply a shared venture of colleges to offer a specialized curriculum. This first phase of the program is offered at Spartanburg Technical College and clusters all of the general education and related course work required for the program. Students may complete the first phase as a full-time or part-time student, designing their schedule according to their needs and personal situation. There is a five year limit for this portion, so it is imperative that required courses are completed in a timely fashion. The second phase of the program clusters all of the occupational therapy course content and must be taken at Greenville Technical College. This portion of the program is offered full-time and offered in the daytime only. This a challenging, highly structured program requiring extensive student commitment for completion. Students who receive a certificate in pre-occupational therapy assisting from Spartanburg Technical College and complete required upper level courses in OTA will be eligible to receive an associate's degree in health science from Greenville Technical College. If you plan to complete phase I at Spar-tanburg Technical College, you must apply to and be accepted by Spartanburg Technical College. The design of your program schedule, term by term registration, course selection and timeline is coordinated by the advisor at Spartanburg Technical College. The comple-tion of phase I must be concluded in a timely manner (no more that five years). After a student is accepted, he/she will be assigned to a program advisor. Progression through the program must be coordinated by the advisor. Students must maintain a minimum cumulative GPA of 2.5 with no less than a “C” in each course. If your cumulative GPA falls below 2.5 or you make less than a “C” in a required course, you will be required to repeat the course (once only) and earn a “C” or better before you will be eligible for phase II.
Greenville Technical College reserves the right to make changes in the program at any
100
Health Sciences
time without notice.
Course Requirements for Pre-Occupational Therapy Assistant Certificate Program - Phase I
Credit Class Lab HoursA. General Education Courses BIO 210 Anatomy and Physiology I 3 3 4 BIO 211 Anatomy and Physiology II 3 4 4 CPT 101 Introduction to Computers 3 0 3 ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 MAT 110 College Algebra 3 0 3 PSY 201 General Psychology 3 0 3 PSY 212 Abnormal Psychology 3 0 3 SPC 205 Public Speaking 3 0 3 *Elective 3 0 3
B. Major Courses All major courses must be taken at Greenville Technical College (phase II)
C. Electives and/or Additional Courses Required *Elective must be selected from PHI 101, PHI 105 or PHI 110
Pre-Physical Therapist Assistant Certificate ProgramCertificate - 9 months; Day, Night
Physical therapy is a health profession which involves direct patient care of individuals who experience temporary or permanent disability due to pain, injury, disease or birth defects. Job opportunities in hospitals and rehabilitation centers are excellent, especially if the graduate is willing to relocate. Working under the supervision of a registered physi-cal therapist, the physical therapist assistant works to prevent pain and disability, relieve pain and promote healing.
Beginning students should have excellent verbal and math skills. High school algebra, biology and chemistry are required with a grade of "C" or better and physics is recom-mended. Students must attend Greenville Technical College's Career Talk and meet their requirement of 20 hours of observation in at least two physical therapy facilities and writing an observation paper. This is Greenville Technical College's requirement that must be met before a student can enter Spartanburg Technical College's pre-physical therapist assistant program and be considered in Greenville Technical College's applicant pool for phase II .
The concept of the program design is simply a shared venture of schools to offer a special-ized curriculum. This first phase of the program is offered at the Spartanburg Technical
101
College and clusters all of the general education and related course work required for the program. Students may complete the first phase as a full-time or part-time student, designing their schedule according to their needs and personal situation. There is a five-year time limit for this portion, so it is imperative that required courses are completed in a timely fashion.
The second phase of the program clusters all of the physical therapy course content and must be taken at Greenville Technical College. However, clinical affiliation may be in an affiliate agency in the student's hometown. This portion of the program is offered in the daytime only and is full-time. This is a difficult, stressful, and intensely structured course of study.
Greenville Technical College reserves the right to make changes in the program at any time without notice.
Graduates from the Physical Therapist Assistant Program will receive a certificate in pre-physical therapist assisting from Spartanburg Technical College and an associate degree in health science from Greenville Technical College and will be eligible to apply for state licensure. The student must pass this exam to practice as a physical therapist assistant.
If you plan to complete phase I at Spartanburg Technical College, you must apply to and be accepted by Spartanburg Technical College. The design of your program schedule, term by term registration, course selection and time line is totally coordinated by the advisor at Spartanburg Technical College. The completion of phase I must be concluded in a timely manner (no more than five years). Any "BIO" prefix course must be taken within two calendar years of the planned transfer to Greenville Technical College for phase II.
After a student is accepted, he/she will be assigned to a program advisor. Progression through the program must be coordinated by the advisor. Students must maintain a minimum cumulative GPA of 2.5 with no less than a "C" in each course. If your cumulative GPA falls below 2.5 or you make less than a "C" in a required course, you will be required to repeat the course (once only) and earn a "C" or better before you will be eligible for Phase II.
Course Requirements for Pre-Physical Therapist Assistant Certificate Program - Phase I
Credit Class Lab HoursA. General Education Courses AHS 102 Medical Terminology 3 0 3 or AHS 104 Medical Vocabulary/Anatomy 3 0 3
Health Sciences
102
Health Sciences
*BIO 210 Anatomy & Physiology I 3 3 4 *BIO 211 Anatomy & Physiology II 3 3 4 CPT 101 Introduction to Computers 3 0 3 ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 MAT 110 College Algebra 3 0 3 PSY 201 General Psychology 3 0 3 PSY 203 Human Growth & Develop. 3 0 3 SPC 205 Public Speaking 3 0 3 Elective (humanities) 3 0 3 B. Major Courses All major courses must be taken at Greenville Technical College.
C. Electives and/or Additional Courses Required Electives (humanities) - A student must complete one elective which
totals at least three semester credit hours.
*This course must be taken within two years of attending Greenville Technical College.
Radiologic Technology Degree ProgramAssociate Degree - 24 months; Day
The radiologic technologist or radiographer is a skilled health professional with a dual responsibility: care of the patient and the performance of radiographic procedures. The technologist assists the radiologist (M.D.) by performing examinations of the body to rule out or confirm diseases, fractures, and other injuries. These duties may be performed not only in the radiology department but also in the emergency room, operating room or at the bedside.
The field of radiology is rapidly expanding to incorporate new technologies offering ad-ditional career opportunities to the trained radiologic technologist.
Full-time students in this program enroll in three to five courses per semester which average 32-38 class hours per week or 11-18 credit hours per semester . Each new class begins only in June of each year.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed on the following page. Refer to the general introduction of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technology Programs.
Accreditation: The Radiologic Technology Program in radiography is accredited by the Joint Review Committee on Education in Radiologic Technology (JRCERT), and gradu-ates are eligible to apply for admission to the certification exam administered by the American Registry of Radiologic Technologists (ARRT). A passing grade on this exam
103
entitles the graduate to use the abbreviations R.T.(R), A.R.R.T., (registered technologist) following his/her name.
Practical Application: The curriculum provides classroom instruction in anatomy and physiology, exposure techniques, positioning, patient care, radiation protection and physics at the college. Topics in mammography, nuclear medicine, radiation therapy, ultrasound, computerized tomography, magnetic resonance imaging, and special proce-dures are included. To complete the comprehensive education plan, clinical experience is obtained in major hospitals in the area.
Job Opportunities: Career opportunities exist primarily in hospitals, clinics, and special-ized doctors’ offices. The curriculum can also be used as a stepping stone for careers in related allied health professions such as ultrasound, nuclear medicine, radiation therapy, computerized tomography, special procedures, magnetic resonance imaging, mammography, teaching, management, and technical sales representation of various x-ray products.
Course Requirements for Radiologic Technology Degree Program
Credit Class
Lab HoursA. General Education Courses CPT 101 Introduction to Computers 3 0 3 ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 MAT 155 Contemporary Math 3 0 3 PSY 201 General Psychology 3 0 3 B. Major Courses AHS 110 Patient Care Procedures 2 0 2 RAD 101 Introduction to Radiography 2 0 2 RAD 105 Radiographic Anatomy 3 3 4 RAD 110 Radiographic Imaging I 2 3 3
RAD 115 Radiographic Imaging II 2 3 3 RAD 121 Radiographic Physics 3 3 4 RAD 130 Radiographic Procedures I 2 3 3 RAD 136 Radiographic Procedures II 2 3 3 RAD 152 Applied Radiography I 1 3 2 Credit Class
Lab Hours RAD 165 Applied Radiography II 0 15 5 RAD 176 Applied Radiography III 0 18 6 RAD 201 Radiation Biology 2 0 2
RAD 205 Radiographic Pathology 2 0 2
Health Sciences
104
RAD 220 Selected Imaging Topics 1 6 3 RAD 230 Radiographic Procedures III 2 3 3 RAD 257 Advanced Radiography I 0 21 7 RAD 268 Advanced Radiography II 0 24 8 RAD 278 Advanced Radiography III 0 24 8 RAD 282 Imaging Practicum 1 3 2 RAD 283 Imaging Practicum 1 6 3 C. Electives and/or Other Additional Courses Required for Graduation The student must complete one elective course which totals 2.0-3.0
credit hours Minimum semester credit hours required for graduation: 92
Respiratory Care ProgramsDiploma - 16 months; Day
Associate Degree - 24 Months; Day
Among the first medical specialists called in emergency treatment of acute respira-tory conditions are the respiratory care practitioners. The respiratory therapist assesses the patient’s need for respiratory care, administers the therapy, evaluates the patient’s response and modifies the care to provide the maximum benefit to the patient. The therapist is a resource to the physician and may function unsupervised. In addition, the therapist supervises, directs and teaches less skilled personnel. Therefore, great individual judgement is required. The technician assists the therapist and provides patient care in non-critical situations. The technician may perform some advanced tasks under the direct supervision of a physician or therapist. Increasing numbers of cardio-respiratory problems, chronic asthma and emphysema victims mean an increasing need for gradu-ates. The Respiratory Care Programs include the diploma program and the associate degree program. Graduates of the 16-month diploma program may seek employment as respiratory care technicians or may elect to continue into the associate degree program. Following the additional eight months of training, graduates from the associate degree may seek employment as respiratory therapists. Full-time students in this program enroll in three to five courses per term which average 17 -30 class/lab hours per week or 9-18.0 credit hours per term.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the program coordinator or department head. Program requirements for graduation are listed. Refer to the general introduction of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technology Programs.
Accreditation: The Respiratory Care Programs are accredited by the Committee on Ac-creditation for Respiratory Care. The sixteen-month graduate receives a diploma and is eligible to apply for admission to the national certification examination. The two-year graduate receives an associate degree in health sciences and is eligible to apply for admission to the national registry examination. Both may also apply for South Carolina state licensure.
Practical Application: Clinical rotations occur during all terms following the first term.
Health Sciences
105
Health Sciences
Students are scheduled at affiliated hospitals and other designated areas where practical experience is gained.
Job Opportunities: Job opportunities are found in hospitals, home care programs, nurs-ing homes and doctors’ offices.
Course Requirements for Respiratory Care Diploma Program
Credit Class
Lab HoursA. General Education Courses ENG 101 English Composition I 3 0 3 MAT 155 Contemporary Mathematics 3 0 3 PSY 201 General Psychology 3 0 3 CPT 101 Introduction to Computers 3 0 3 B. Major Courses AHS 111 Health Related Sciences 3 3 4 RES 101 Introduction to Respiratory Care 3 0 3 RES 105 Basic Respiratory Drugs 1 3 2 RES 106 Respiratory Care Anatomy 2 3 3 RES 111 Pathophysiology 1 3 2 RES 121 Respiratory Skills I 3 3 4 RES 131 Respiratory Skills II 3 3 4 RES 141 Respiratory Skills III 2 3 3 RES 142 Basic Pediatric Care 1 3 2 RES 151 Clinical Applications I 0 15 5 RES 152 Clinical Applications II 0 9 3 RES 232 Respiratory Therapeutics 2 0 2 RES 255 Clinical Practice 0 15 5 C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program.
Minimum semester credit hours required for graduation: 54
Course Requirements for Respiratory Care Associate Degree Program
Credit Class
Lab HoursA. General Education Courses CPT 101 Introduction to Computers 3 0 3
106
ENG 101 English Composition I 3 0 3 ENG 102 English Composition II 3 0 3 MAT 155 Contemporary Mathematics 3 0 3 PSY 201 General Psychology 3 0 3 B. Major Courses AHS 111 Health Related Sciences 3 3 4 RES 101 Introduction to Respiratory Care 3 0 3 RES 105 Basic Respiratory Drugs 1 3 2 RES 106 Respiratory Care Anatomy 2 3 3 RES 111 Pathophysiology 1 3 2 RES 121 Respiratory Skills I 3 3 4 RES 123 Cardiopulmonary Physiology 3 0 3 RES 131 Respiratory Skills II 3 3 4 RES 141 Respiratory Skills III 2 3 3 RES 142 Basic Pediatric Care 1 3 2 RES 151 Clinical Applications I 0 15 5 RES 152 Clinical Applications II 0 9 3 RES 204 Neonatal/Pediatric Care 3 0 3
RES 232 Respiratory Therapeutics 2 0 2 RES 244 Advanced Respiratory Skills I 3 3 4 RES 245 Advanced Respiratory Skills II 1 3 2 RES 246 Respiratory Pharmacology 1 3 2 RES 255 Clinical Practice 0 15 5 RES 275 Advanced Clinical Practice 0 15 5 RES 276 Advanced Clinical Applications II 0 18 6
C. Electives and/or Other Additional Courses Required for Graduation The student must complete one elective course which totals a minimum
of 2.0 credit hours.
Minimum semester credit hours required for graduation: 84
Surgical Technology Diploma ProgramDiploma - 12 Months; Day
Surgical technology is an exciting profession where the work environment is both intense and dynamic. The surgical technologist is an integral part of the surgical team. They must have a thorough knowledge of surgical instruments since part of their responsibility is to assemble the needed instruments and supplies for various types of surgery. To facili-tate the smooth progress of surgery, the surgical technologist anticipates the needs of surgeons by passing instruments in an efficient manner. Passing instruments is a precise skill requiring both manual dexterity and concentration abilities.
A vital role of the technologist is to maintain aseptic techniques and sterile conditions prior to and during surgery to minimize the risk of infection to the patient. The surgical technologist may also assume some patient care responsibilities. Full-time students in
Health Sciences
107
Health Sciences
this program enroll in three to six courses per term which average 28- 36 class hours per week or 12.0-20.0 credit hours per term.
Specific questions concerning admission requirements, scheduling of courses or gradu-ation requirements can be answered by the department head. Program requirements for graduation are listed below. Refer to the general introduction of the Health Sciences Technology Division for additional information relevant to all Health Sciences Technol-ogy Programs.
Accreditation: This program is accredited by the Commission on Accreditation of Al-lied Health Education Programs. Graduates are eligible to write the National Certifying Examination.
Practical Application: During the last six months of the program, thirty hours per week are spent in affiliated hospitals rotating through the operating room, labor and delivery suite, endoscopy unit, outpatient surgery suite, emergency room, and sterile processing department. An optional rotation through doctors' offices is available.
Job Opportunities: Operating rooms, labor and delivery suites, sterile processing depart-ments, doctors' offices, veterinary hospitals, organ and tissue procurement teams and medical sales.
Course Requirements for Surgical Technology Diploma Program
Credit Class
Lab HoursA. General Education Courses ENG 165 Professional Communications 3 0 3 MAT 155 Contemporary Mathematics 3 0 3 PSY 103 Human Relations 3 0 3 B. Major Courses AHS 102 Medical Terminology 3 0 3 COL 101 College Orientation 1 0 1 SUR 101 Introduction to Surgical Tech. 4 3 5 SUR 102 Applied Surgical Technology 2 9 5 SUR 103 Surgical Procedures I 2 6 4 SUR 104 Surgical Procedures I I 4 0 4 SUR 108 Surgical Anatomy I 3 0 3
Credit Class
Lab Hours SUR 109 Surgical Anatomy II 3 0 3 SUR 110 Introduction to Surgical 0 15 5 Practicum SUR 113 Advanced Surgical Practicum 0 18 6 SUR 120 Surgical Seminar 2 0 2
108
Health Sciences
C. Electives and/or Other Additional Courses Required for Graduation No electives required for this program. Minimum semester credit hours required for graduation: 50
109
Indu
stria
l and
Eng
inee
ring
Tech
nolo
gies
110
Engineering Technology
Associate Degree Programs Civil Engineering Technology Electronics Engineering Technology Engineering Graphics Technology- Architectural Drafting Engineering Graphics Technology- Mechanical Drafting General Engineering Technology Mechanical Engineering Technology Certificate Programs Architectural Computer Aided Drafting Mechanical Computer Aided Drafting
Engineering Technology
111
Architectural Computer Aided Drafting Certificate ProgramCertificate- Day; 12 Months
Evening; 24 Months
In the Architectural Computer Aided Drafting Certificate program, a person will obtain a basic knowledge of architectural drafting. Emphasis will be on the application of computer aided drafting in the field of architectural drafting.
Upon completion of this curriculum, a person may seek employment as a drafter or they may continue their education at Spartanburg Technical College as a second year student in Engineering Graphics Technology-Architectural Computer Aided Drafting.
This program can also be used to upgrade experienced drafters and designers on CAD systems used by architectural engineering construction and design/building firms in our area.
Upon registering, each new student should request a semester course outline which de-scribes the courses and specific term in which they are scheduled. Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements are listed below. Upon completion of 27 semester credit hours, the graduate will be awarded a certificate in architectural computer aided drafting.
Course Requirements for Architectural Computer Aided Drafting Certificate Program
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 MAT 102 Intermediate Algebra 3 0 3 MAT 168 Geometry & Trigonometry 3 0 3
B. Major Courses AET 107 Basic Design & Sketching 1 3 2 AET 111 Architectural Comp. Grap. I 1 6 3 AET 221 Architectural Comp. Grap. II 2 6 4 EGR 103 Preparation for Eng. Tech. 1 3 2 EGT 150 Basic CAD 0 6 2 EGT 155 Intermediate CAD 1 3 2 EGT 252 Advanced CAD 2 3 3
Engineering Technology
112
Engineering Technology
Minimum semester credit hours required for graduation: 27
Associate Engineering TechnologyMajor in Civil Engineering Technology Program
Associate Degree - 21 Months; Day
Civil engineering technicians help design, inspect construction of, and test soil conditions for the construction of buildings, bridges, highways, and water lines. Some civil engineering technicians work as land surveyors, for instance, to lay out property lines in a development. Others work in laboratories testing soil to determine, for example, whether the earth in a particular location can support a building footing. Still other civil engineering technicians work for architectural and engineering firms, doing drafting and design work and estimat-ing construction costs. Entry level technicians do fairly routine work under an engineer’s supervision. There is good opportunity for technicians to advance to become supervisors and managers.
In order to graduate, full-time students enrolled in this program usually enroll in four or five courses per term which average 26 class hours per week or 17 credit hours per term. Part-time students usually require more terms of attendance to graduate. The exact length of time for program completion depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a semester course outline which describes the courses and the specific terms in which they are scheduled.
Many of the courses listed below require successful completion of other courses. These pre-requisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be an-swered through the program advisor or department head. Program requirements for gradu-ation are listed below. Upon completion of 75 semester hours, the graduate will be awarded an associate's degree in Engineering Technology.
Students desiring a career in land surveying or construction contracting should consult with the program/ department head for information pertaining to state licensing requirements.
Accreditation: Technology Accreditation Commission of the Accreditation Board for Engi-neering and Technology.
Practical Application: Students in Civil Engineering Technology are involved in many practical experiences, such as boundary and road surveys, soil and materials testing, and construction inspection.
Job Opportunities: Soils technician, designer, draftsmen, inspector, survey party chief, con-struction foreman, civil engineer’s assistant, project manager, technician, civil engineering technician, structural detailer, engineering aide, survey instrument man, estimator, engineer
113
Engineering Technology
associate, design technician and construction superintendent.
Course Requirements forCivil Engineering Technology Program
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 260 Adv. Tech. Communications 3 0 3 HSS 205 Technology & Society 3 0 3 MAT 120 Probability and Statistics 3 0 3 MAT 175 Algebra & Trig. I 3 0 3 MAT 176 Algebra & Trig. II 3 0 3 MAT 177 Calculus 3 0 3 PHS 101 Physical Science I 3 3 4 PSY 103 Human Relations 3 0 3 B. Major Courses CET 105 Surveying I 2 3 3 CET 120 Construction Materials 2 3 3 CET 135 Construction Contracts 2 0 2 CET 205 Surveying II 3 3 4 CET 216 Soil Mechanics 2 3 3 CET 218 Hydraulics 2 3 3 CET 220 Concrete & Steel Design 2 3 3 CET 235 Construction Method & Est. 2 3 3 CET 246 Environm. Systems Tech 2 3 3 CET 251 Highway Design 2 3 3 EGR 101 Intro. to Engr. Tech. 0 3 1 EGR 112 Engineering Programming 2 3 3 EGR 194 Statics & Strength 3 3 4 EGT 101 Basic Technical Drawing 0 6 2 EGT 105 Basic Civil Drafting 0 6 2 EGT 151 Introduction to CAD 2 3 3 C. Electives and/or Other Additional Courses Required for Graduation The students must complete one elective course which totals at
114
Engineering Technology
least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 75
Associate in Engineering TechnologyMajor in Electronics Engineering Technology Program
Associate Degree 21 Months; Day
Electronics engineering technicians help engineers by building and testing the electronics equipment which the engineer has designed. They may work for a computer company where they install, maintain, and repair computers, or they may work for a television station where they maintain audio and video equipment. Some technicians work in manufacturing plants where they help design, build, and repair the electronic instruments that control the operation of production machines. Others work as a manufacturer’s representative or salesperson.
Full-time students enrolled in this program usually enroll in three or four courses per term which average 22 class hours per week or 14 credit hours per term. Part-time students usu-ally require more terms of attendance to graduate. The exact length depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a semester course outline which describes the courses and the specific semesters in which they are scheduled.
Many of the courses listed below and on the following page require successful completion of other courses. These prerequisites and corequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation are listed below and on the following page. Upon completion of 78 semester credit hours, the graduate will be awarded an associate's degree in Engineering Technology.
Accreditation: Technology Accreditation Commission of the Accreditation Board for Engi-neering and Technology.
Practical Application: The Electronics Engineering Technology Department features labs with almost every course. Among the labs included in the department are D.C. circuits, A.C. circuits, active devices, electrical machinery, communications electronics, and micro-processors.
Job Opportunities : Computer technician, radar technician, chief operator - radio and TV stations, communications technician, development technician, field engineering technician,
115
Engineering Technology
electrical machinery technician, quality control inspector/technician, microwave technician, thin-film technologist, nuclear instrumentation technician, electronic repair technician, elec-tronic sales representative and technical writer.
Course Requirements for Electronics Engineering Technology Program
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 260 Advanced Tech. Com. 3 0 3 HSS 205 Technology & Society 3 0 3 MAT 175 Algebra & Trig. I 3 0 3 MAT 176 Algebra & Trig. II 3 0 3 MAT 177 Calculus 3 0 3 PHY 201 Physics I 3 3 4 PHY 202 Physics II 3 3 4 PSY 103 Human Relations 3 0 3 B. Major Courses EET 111 D. C. Circuits 3 3 4 EET 112 A.C. Circuits 3 3 4 EET 131 Active Devices 3 3 4 EET 141 Electronic Circuits 3 3 4 EET 145 Digital Circuits 3 3 4 EET 227 Electrical Machinery 2 3 3 EET 231 Industrial Electronics 3 3 4 EET 235 Programmable Controllers 2 3 3 EET 241 Electronic Communications 3 3 4 EET 243 Data Communications 2 3 3 EET 251 Microprocessor Fundamentals 2 6 4
116
Engineering Technology
EET 261 Electronic Troubleshooting 1 3 2 EET 273 Electronics Senior Project 0 3 1 EGR 112 Engineering Programming 2 3 3 C. Electives and/or Other Additional Courses Required for Graduation The students must complete one elective course which totals at least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 78
Associate in Engineering TechnologyMajor in Engineering Graphics Technology Program
(with Architectural Computer Aided Drafting)Associate Degree - 21 Months; Day
This program will teach the student how to utilize computer driven drafting/design systems in an architectural engineering/construction environment. They will obtain training in ar-chitectural detailing, do analysis of structural and mechanical systems, and study building codes. They will take architectural design concepts and convert them to construction docu-ments in order to construct a building that conforms with established design, budget, and codes. They will be trained to produce finished construction drawings from sketches, verbal descriptions, or raw data, and check their work to see that it meets appropriate codes and design criteria. These technicians will receive instruction in the preparation of construction documents on computer aided drafting/design systems.
Full-time students enrolled in this program usually enroll an average of 25 class hours per week or 16 credit hours per term . Part-time students usually require more terms of atten-dance to graduate. The exact length depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a semester course outline which describes the courses and the specific semesters in which they are scheduled.
Many of the courses listed on the following page require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation
117
Engineering Technology
are listed below. Upon completion of 80 term credit hours, the graduate will be awarded an associate's degree in Engineering Technology.
Practical Application: Engineering Graphics Technology students gain practical experience in drawing, drafting and computer-assisted drafting (CAD). In addition, they perform tests to compare the strength of materials. Also, Engineering Graphics and Engineering Graphics Technology students look at the application of engineering graphics in the Civil, Electronics, and Mechanical Engineering Technology fields.
Job Opportunities: Computer aided drafters, junior detailer, detailer, checker, junior designer, senior designer, chief draftsman, architectural drafter, technical illustrator, drafting instruc-tor and technician.
Course Requirements for Engineering Graphics Technology with
Architectural Computer Aided Drafting Program Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 260 Advanced Tech. Com. 3 0 3 HSS 205 Technology & Society 3 0 3 IDS 101 Human Thought & Learning 3 0 3 MAT 175 Algebra & Trig. I 3 0 3 MAT 176 Algebra & Trig. II 3 0 3 MAT 177 Calculus 3 0 3 PHS 101 Physical Science I 3 3 4 B. Major Courses AET 107 Basic Design & Sketching 1 3 2 AET 111 Arch. Computer Graphics I 1 6 3 AET 221 Arch. Comp. Graphics II 2 6 4 AET 231 Arch. Comp. Graphics III 2 6 4 AET 240 Architectural Graphics IV 3 3 4 AET 247 Mfg. of Prefab. Structures 4 0 4 CET 102 Fundamentals of Surveying 1 3 2 EGR 103 Preparation for Engin. Tech. 1 3 2 EGR 124 Engr. Spreadsheet Applic. 1 3 2 EGR 170 Engineering Materials 2 3 3 EGR 190 Statics 2 3 3 EGT 125 Descriptive Geometry 0 6 2 EGT 150 Basic CAD 0 6 2 EGT 155 Intermediate CAD 1 3 2
118
Engineering Technology
EGT 220 Structural & Piping Applic. 3 3 4 EGT 252 Advanced CAD 2 3 3 MET 211 Strength of Materials 3 3 4 MET 214 Fluid Mechanics 2 3 3 C. Electives and/or Other Additional Courses Required for Graduation The students must complete one elective course which totals at least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 80
Associate in Engineering TechnologyMajor in Engineering Graphics Technology Program
(with Mechanical Computer Aided Drafting) Associate Degree - 21 Months; Day
Engineering graphics technicians are highly skilled drafters. They draw assembly drawings, machine parts, and electrical instruments. Manufacturing plants rely on them to translate the sketches or plans of an engineer into detailed drawings. These Engineering Graphics Technicians specialize in mechanical drawing or pipe drawing and work for manufacturing companies or engineering firms.
Full-time students enrolled in this program usually enroll an average of 25 class hours per week or 16 credit hours per term. Part-time students usually require more terms of atten-dance to graduate. The exact length depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a semester course outline which describes the courses and the specific terms in which they are scheduled.
Many of the courses listed on the following page require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation are listed on the following page. Upon completion of 80 semester credit hours, the graduate will be awarded an associate's degree in Engineering Technology.
Practical Application: Engineering Graphics Technology students gain practical experience
119
Engineering Technology
in drawing, drafting and computer-assisted drafting (CAD). In addition, they perform tests to compare the strength of materials. Also, Engineering Graphics Technology students look at the application of engineering graphics in the Civil, Electronics and Mechanical Engineer-ing Technology fields.
Job Opportunities: Computer-aided drafting, tracer, junior detailer, senior detailer, checker, junior designer, senior designer, chief draftsman, industrial designer, tool designer, technical illustrator, cartographer, drafting instructor and technician.
Course Requirements for Engineering Graphics Technology Program with
Mechanical Computer Aided Drafting
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 260 Advanced Tech. Com. 3 0 3 HSS 205 Technology & Society 3 0 3 IDS 101 Human Thought & Learning 3 0 3 MAT 175 Algebra & Trig. I 3 0 3 MAT 176 Algebra & Trig. II 3 0 3 MAT 177 Calculus 3 0 3 PHS 101 Physical Science I 3 3 4 B. Major Courses EET 101 Basic Electronics 1 3 2 EGR 103 Prep. for Engineering Tech. 1 3 2 EGR 124 Engr. Spreadsheet Applic. 1 3 2 EGR 170 Engineering Materials 2 3 3 EGR 175 Manufacturing Processes 3 0 3 EGR 190 Statics 2 3 3 EGT 103 Print Reading 1 3 2 EGT 110 Engineering Graphics I 2 6 4 EGT 115 Engineering Graphics II 2 6 4 EGT 125 Descriptive Geometry 0 6 2 EGT 150 Basic CAD 0 6 2 EGT 155 Intermediate CAD 1 3 2 EGT 210 Engineering Graphics III 2 6 4 EGT 215 Mechanical Drawing Applicas. 3 3 4 EGT 220 Structural & Piping Applications 3 3 4
120
Engineering Technology
EGT 252 Advanced CAD 2 3 3 MET 211 Strength of Materials 3 3 4 MET 214 Fluid Mechanics 2 3 3 C. Electives and/or Other Additional Courses Required for Graduation The students must complete one elective course which totals at least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 80
Associate in Engineering TechnologyMajor in General Engineering Technology Program
Associate Degree - Day; 21 Months Evening; 48 Months
General Engineering Technology deals with a combination of mechanical, civil and electron-ics engineering technologies. Graduates of this program are generalists and not specialists. Equipment used in the program includes electronic circuits, surveying equipment, and me-chanical equipment. As generalists rather than specialists, students gain practical experience in the civil, mechanical and electronics engineering technology fields.
Full-time students enrolled in this program usually enroll in four or five courses per term which average 22 class hours per week or 17 credit hours per term. Part-time students usu-ally require more terms of attendance to graduate. The exact length depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a semester course outline which describes the courses and the specific terms in which they are scheduled.
Many of the courses listed below require successful completion of other courses. These pre-requisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be an-swered through the program advisor or department head. Program requirements for gradu-ation are listed below. Upon completion of 68 semester credit hours, the graduate will be awarded an associate's degree in Engineering Technology.
Practical Application: Students gain practical experience in the civil, mechanical and elec-tronics engineering technology fields.
Job Opportunities : Technician, engineering technician, draftsman, inspector, engineering aide, design technician, foreman and engineer associate.
Course Requirements for General Engineering Technology Program Credit Class Lab Hours
121
Engineering Technology
A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 260 Adv. Tech. Communications 3 0 3 HSS 205 Technology & Society 3 0 3 MAT 120 Probability and Statistics 3 0 3 MAT 175 Algebra & Trig. I 3 0 3 MAT 176 Algebra & Trig. II 3 0 3 MAT 177 Calculus 3 0 3 PHS 101 Physical Science I 3 3 4 PSY 103 Human Relations 3 0 3 Credit Class Lab Hours
B. Major Courses CET 105 Surveying I 2 3 3 CET 218 Hydraulics 2 3 3 EET 111 DC Circuits 3 3 4 EET 112 AC Circuits 3 3 4 EGR 101 Introduction to Engin. Tech. 0 3 1 EGR 112 Engineering Programming 2 3 3 EGR 175 Manufacturing Processes 3 0 3 EGR 194 Statics & Strength 3 3 4 EGT 101 Basic Technical Drawing 0 6 2 EGT 151 Introduction to CAD 2 3 3 C. Electives and/or Other Additional Courses Required for Graduation The students must complete one elective course which totals at least 2.0 credit hours (excluding COL 101). The student must also take 8 credit hours of technical elective courses that are approved by the Department Head.
Minimum semester credit hours required for graduation: 68
Associate in Engineering Technology Major in Mechanical Engineering Technology Program
Associate Degree - 21 Months; Day
Mechanical engineering technicians help design machinery. They analyze how a machine operates, what size its gears and shafts must be, and what materials to use to make the parts. They work under an engineer’s supervision, doing some design work and some drafting. They rely on their knowledge of math and thermal (heat) science and their understanding of the characteristics of metals and other materials to solve design problems.
Mechanical Engineering Technology deals with all aspects of manufacturing as well as the creation and utilization of mechanical power. The ease with which electrical power and
122
Engineering Technology
mechanical power can be interchanged is an important part of Mechanical Engineering Technology.
Full-time students in this program usually enroll in four or five courses per term which aver-age 23 class hours per week or 16 credit hours per term. Part-time students usually require more terms of attendance to graduate. The exact length depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a semester course outline which describes the courses and the specific terms in which they are scheduled.
Many courses require a final grade of “C” or better in order to register for more advanced courses. These courses are also noted in the course descriptions.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation are listed on the following page. Upon completion of 79 semester credit hours, the graduate will be awarded an associate's degree in Engineering Technology.
Accreditation: Technology Accreditation Commission of the Accreditation Board for Engi-neering and Technology.
Practical Application: Students in Mechanical Engineering Technology perform tests to compare strength and thermal properties of different materials. In addition, Mechanical Engineering Technology students are involved with machining, design, computer-aided drafting and the calibration of instruments.
Job Opportunities : Instrumentation engineering technician, process engineering technician, product designer, heating, air conditioning and ventilation designer, mechanical designer, process control designer, maintenance supervisor, technical sales, tool designer, draftsmen, systems engineering technician, testing technician and manufacturing engineering techni-cian.
Course Requirements for Mechanical Engineering Technology Program
Credit Class Lab Hours A. General Education Courses ENG 101 English Composition I 3 0 3 ENG 260 Advanced Tech Com. 3 0 3 HSS 205 Technology & Society 3 0 3 IDS 101 Human Thought & Learning 3 0 3 MAT 175 Algebra & Trig. I 3 0 3 MAT 176 Algebra & Trig. II 3 0 3 MAT 177 Calculus 3 0 3 PHY 201 Physics I 3 3 4 PHY 202 Physics II 3 3 4 B. Major Courses EET 101 Basic Electronics 1 3 2
123
Engineering Technology
EGR 103 Prep. for Engr. Tech. 1 3 2 EGR 124 Engineering Spreadsheet Applications 1 3 2 EGR 170 Engineering Materials 2 3 3 EGR 175 Manufacturing Processes 3 0 3 EGR 190 Statics 2 3 3 EGT 103 Print Reading 1 3 2 EGT 111 Mechanical Drawing I 0 6 2 EGT 112 Mechnical Drawing II 0 6 2 EGT 150 Basic CAD 0 6 2 EGT 252 Advanced CAD 2 3 3 MET 101 Basic Measuring Principles 0 3 1 MET 211 Strength of Materials 3 3 4 Credit Class Lab Hours MET 212 Kinematics 2 3 3 MET 214 Fluid Mechanics 2 3 3 MET 222 Thermodynamics 3 3 4 MET 224 Hydraulics & Pneumatics 3 0 3 MET 231 Machine Design 3 3 4 C. Electives and/or Other Additional Courses Required for Graduation The students must complete one elective course which totals at least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 79
Mechanical Computer Aided Drafting Certificate ProgramCertificate - Day ; 12 Months
Evening; 24 Months
In the Mechanical Computer Aided Drafting Certificate Program students learn to use a CAD system to solve their graphics problems. The major thrust is in the mechanical field but other areas are also covered. This program can also be used to upgrade experienced drafters and designers. They can receive exemption credit for their experience. Upon completion of this program, a student may continue their education in engineering graphics technology, mechanical computer aided drafting or mechanical engineering technology.
Upon registering, each new student should request a semester course outline which describes the courses and the specific semesters in which they are scheduled.
Course Requirements for Mechanical Computer Aided Drafting Certificate Program
Credit Class Lab Hours A. General Education Courses
124
Engineering Technology
Notes
125
Industrial Technology
Industrial Technology
Associate Degree Programs Automotive Technology (Ford ASSET) General Technology Heating, Ventilation, and Air Conditioning Technology Industrial Electronics Technology Industrial Electronics Technology Automated Manufacturing Technology Option Machine Tool Technology
Diploma Programs Industrial Mechanics Welding
Certificate Programs Air Conditioning and Refrigeration Basic Electronics Computer Numerical Control Operator Graphic Preparation Technology Printing Technology Welding
126
Air Conditioning and Refrigeration Certificate ProgramCertificate; Day and Evening
The Air Conditioning and Refrigeration Certificate Program will train students to have a basic knowledge of heating, cooling and refrigeration. The graduates of the certificate program may choose the residential field to work on houses and small buildings. The program is designed for 12 months, but it is possible to graduate in less time.
In order to graduate, full-time students enrolled in this program usually enroll in three or four courses per term which include 20-25 class hours per week or average 14 credit hours per semester. Part-time students usually require more terms of attendance to graduate. The exact length of the program depends upon semester offerings and the number of courses taken by the student.
Upon registering, each new student should request a program outline.
Many of the courses listed require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation are listed below.
Job Opportunities: Install and service air conditioning and refrigeration in the residential field.
Course Requirements for Air Conditioning and Refrigeration Certificate Program
Credit
Class Lab Hours A. General Education Courses
None B. Major Courses
ACR 101 Fundamentals of Refrigeration 3 6 5
ACR 106 Basic Electricity HVAC 3 3 4
ACR 110 Heating Fundamentals 3 3 4
ACR 120 Basic Air Conditioning 3 3 4
ACR 122 Principles of Air Conditioning
4 3 5 ACR 130 Domestic Refrigeration 3
3 4 ACR 140 Automatic Controls
Industrial Technology
127
Industrial Technology
2 3 3 ACR 210 Heat Pumps
3 3 4 ACR 224 Codes & Ordinances
1 3 2 WLD 102 Introduction to Welding
1 3 2 C. Electives and/or Other Additional Courses Required for Graduation
None
Minimum semester credit hours required for graduation: 37
FORD ASSET Degree Program(Automotive Student Service Educational Training)
Associate Degree - 24 Months; Day
ASSET is a two-year college program leading to an Industrial Technology Associate Degree with a major in automotive technology. It is a joint effort between Ford Motor Company, Spartanburg Technical College and sponsoring Ford and Lincoln-Mercury dealers.
Ford ASSET Program students will learn how to analytically diagnose, service and maintain Ford and Lincoln-Mercury automotive products/components using recommended proce-dures, special tools and Ford service manuals. This program is divided into two parts: classroom/lab instruction and full-time work experi-ence. Throughout the 24-month program, students rotate between approximately eight weeks of classroom instruction at Spartanburg Technical College, and eight weeks of full-time work experience at a Ford or Lincoln-Mercury dealership.
Technical training on Ford automotive products will cover the latest developments of Ford technology including engines, fuel management, electronics, transmission/transaxles, brake systems and air conditioning. In addition, courses in mathematics, communication, and human relations will provide the well-rounded academic background necessary to com-municate and reason effectively.
This system allows the student to apply, in a real world setting, what he or she has learned in the classroom/lab during the previous instructional session. The student also becomes familiar with the dealership environment, its organizational structure and the competencies that are expected of a professional automotive technician.
Course Requirements for FORD ASSET Degree Program Credit
Class Lab Hours A. General Education Courses
ENG 160 Technical Communication 3 0 3
ENG 260 Adv. Technical Communication 3
128
0 3 HSS 205 Technology and Society
3 0 3 MAT 155 Contemporary Mathematics 3
0 3 PSY 103 Human Relations
3 0 3
B. Major Courses AUT 107 Advanced Engine Repair 3
3 4 AUT 111 Brakes
2 3 3 AUT 115 Manual Drivetrain/Axle
2 3 3 AUT 132 Automotive Electricity
3 3 4 AUT 135 Ignition Systems
3 0 3 AUT 142 Heating and Air Conditioning 2
3 3 AUT 145 Engine Performance
3 0 3 AUT 160 Introduction to Automotive Tech. 1
0 1 Credit
Class Lab Hours
AUT 221 Suspension and Steering 2 3 3
AUT 231 Automotive Electronics 4 0 4
AUT 232 Automotive Accessories 2 0 2
AUT 245 Advanced Engine Performance 4 3 5
AUT 251 Automatic Transmission Overhaul 4 3 5
CWE 112 Coop. Work Experience I 0 0 2
CWE 122 Coop. Work Experience II
Industrial Technology
129
126 127 128 1290 0 2 CWE 131 Coop. Work Experience III
0 0 1 CWE 212 Coop. Work Experience IV
0 0 2 CWE 222 Coop. Work Experience V
0 0 2 CWE 231 Coop. Work Experience VI
0 0 1
C. Electives and/or Other Additional Courses Required for Graduation The student must complete one elective course which totals at least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 70 Computer Numerical Control Operator Certificate Program
Certificate; Day and Evening
The Computer Numerical Control (CNC) Machine Operator Certificate Program trains persons in the programming, setup and operation of CNC equipment. The program stresses knowledge and skills in blueprint reading, mathematics, machine tool theory and practice, CNC programming and CNC machine tool operations. Major training emphasis in the pro-gram is directed at local CNC machine tool industry needs and requirements.
The exact length of the program depends upon course offerings and the number of courses taken by the student.
Upon registering, each new student should request a program outline.
Many of the courses listed require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation follow.
Job Opportunities: Machine tool operator, machinist apprentice, production machine opera-tor, computer control machine operator and CNC machine tool programmer.
Course Requirements for Computer Numerical Control Operator Certificate Program
Credit
Industrial Technology
130
Industrial Technology
Class Lab Hours A. General Education Courses
MAT 101 Beginning Algebra 3 0 3
MAT 168 Geometry & Trigonometry 3 0 3
B. Major Courses
EGT 104 Print Reading 3 0 3
MTT 121 Machine Tool Theory I 3 0 3
MTT 122 Machine Tool Practice I 0 12 4
MTT 123 Machine Tool Theory II 3 0 3
MTT 124 Machine Tool Practice II 0 12 4
MTT 250 Principles of CNC 3 0 3
MTT 253 CNC Programming & Operations 0 9 3
MTT 254 CNC Programming I 0 9 3
C. Electives
None
Minimum semester credit hours required for graduation: 32
Basic Electronics Certificate ProgramCertificate
The Basic Electronics Certificate Program is designed to provide skills to persons entering the electronics field. Throughout the program students will study basic electronics using diagnostic equipment. Major training emphasis in the program is directed at analog and digital circuits, motor controls and programmable logic controllers.
The exact length of the program depends upon course offerings and number of courses taken by the student. Many courses in the basic electronics certificate require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Job Opportunities: Motor control installation and repair, programmable logic controllers in-stallation and repair, general electrical maintenance, electrical/electronic equipment sales.
Course Requirements for Basic Electronics Certificate Program
131
130 131 132 133
Industrial Technology
Credit
Class Lab Hours A. General Education Courses
ENG 160 Technical Communication 3 0 3
MAT 101 Beginning Algebra 3 0 3
Credit
Class Lab HoursB. Major Courses
EEM 107 Industrial Computer Techniques 1 3 2
EEM 117 AC/DC Circuits I 3 3 4
EEM 118 AC/DC Circuits II 2 6 4
EEM 125 Electronic Circuits 0 6 2
EEM 131 Solid State Devices 3 3 4
EEM 151 Motor Controls I 2 6 4
EEM 211 AC Machines 2 3 3
EEM 221 DC/AC Drives 2 3 3
EEM 251 Programmable Controllers 3 0 3
EEM 252 Programmable Controllers 1 6 3
Applications C. Electives
None Minimum semester credit hours required for graduation: 38
General Technology Degree ProgramAssociate Degree in Occupational Technology; Day and Evening
132
Industrial Technology
General technology is a continuation program of cross-training which permits a student to receive training in an industrial area major (industrial electronics technology, industrial me-chanics, heating, ventilation and air conditioning, machine tool technology, or welding) and minor in another technical specialty. The student and faculty advisor agree upon a list and sequence of courses to meet a particular employment objective of the student. This course is 21 months in length for a full-time day student. Evening students normally take longer than 21 months to graduate.
In order to graduate, full-time students enrolled in this program usually enroll in four or five courses per term which involve 22-28 class hours per week or average 18 credit hours per term. Part-time students require more terms of attendance to graduate. The exact length depends upon course offerings and the number of courses taken by the student.
Prior to registering, each new student should meet with their advisor and develop a program contract. Many of the courses listed require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation follow.
To apply to the General Technology Program, a student should be a graduate of a one-year diploma program or its equivalent (minimum GPA of 2.0). Students may begin the admis-sions process during their last term.
Course Requirements for General Technology
Credit
Class Lab Hours A. General Education Courses
ENG 160 Technical Communications 3 0 3
ENG 260 Advanced Technical Communications
3 0 3 HSS 205 Technology & Society
3 0 3 MAT 101 Beginning Algebra
3 0 3 PSY 103 Human Relations
3 0 3 See note #1 in Section C.
133
Industrial Technology
B. Major Courses Primary Technical Specialty (select one): 28 semester credit hours (min.) 1. Commercial Graphics Technology: CGC 101 (3.0), CGC 110
(3.0), CGC 122 (3.0), CGC 125 (3.0), CGC 135 (3.0), CGC 206 (3.0), CGC 210 (3.0), CGC 222 (3.0), CGC 225 (3.0), CGC 240 (3.0).
2. H.V.A.C. Technology: ACR 101 (5.0), ACR 106 (4.0), ACR 110 (4.0),
ACR 120 (4.0), ACR 140 (3.0), ACR 210 (4.0), ACR 231 (4.0). 3. Industrial Electronics Technology: EEM 107 (2.0), EEM 117 (4.0), EEM 118 (4.0), EEM 125 (2.0), EEM 131 (4.0), EEM
151 (4.0), EEM 231 (3.0), EEM 241 (3.0), EEM 242 (3.0). 4. IET/Automated Manufacturing Option: AMT 105 (3.0), EEM
117(4.0), EEM 118 (4.0), EEM 125 (2.0), EEM 131 (4.0), EEM 151
(4.0), EEM 231 (3.0), EEM 241 (3.0), EEM 242 (3.0). 5. Industrial Mechanics: IMT 102 (2.0), IMT 104 (2.0), IMT 111 (5.0), IMT 120 (5.0), IMT 130 (5.0), IMT 140 (5.0), IMT 161 (4.0). 6. Machine Tool Technology: EGT 104 (3.0), EGT 108 (2.0), MTT 121 (3.0), MTT 122 (4.0), MTT 123 (3.0), MTT 124
(4.0), MTT 141 (3.0), MTT 211 (3.0), MTT 250 (3.0). 7. Welding: WLD 103 (1.0), WLD 105 (1.0), WLD 106 (4.0), WLD 113 (4.0), WLD 115 (4.0), WLD 117 (4.0), WLD 132
(4.0), WLD 136 (2.0), WLD 154 (4.0), WLD 208 (3.0), WLD 212 (2.0). Secondary Technical Specialty: 12.0 semester credit hours (min.) An additional 12 semester hours (minimum) in a different technical specialty is required. See note #2 in Section C.
C. Electives and/or Other Hours Required for Graduation Additional courses/technical electives: 17.0 SHC (min.) Note #1: One course must provide competencies in the basic use
of computers.
134
Note #2: Additional secondary technical specialty courses may be required to ensure the student's competency in that spe-cialty.
Electives: 2.0 SHC (min. - excluding COL 101)
Minimum semester credit hours required for graduation: 74
Graphic Preparation Technology Certificate ProgramCertificate; Day and Evening
The Graphic Preparation Technology Certificate Program will prepare students to work in all aspects of pre-press operations including electronic publishing, paste-up, process camera and other dark room operations, film assembly, proofing and platemaking.
In order to graduate full-time, students in this program usually enroll in five courses per term which includes 25 class/lab hours per week or an average of 13 credit hours per semester. In addition, students enrolled in this program will be expected to satisfactorily complete a work experience component (CO-OP) at a local printing company. Part-time students usually require more terms of attendance to graduate.
Upon registering, each new student should request a program outline. Some courses listed require successful completion of other courses. These prerequisites are specified at the end of each course in the back of this catalog.
Any questions concerning scheduling of courses, work experience or graduation require-ments can be answered by the program advisor or department head. Program requirements are listed below.
Course Requirements for Graphic Preparation Technology Certificate Program
Credit
Class Lab Hours A. General Education Courses
ENG 160 Tech Communications 3 0 3
MAT 155 Contemporary Math 3 0 3
Credit
Industrial Technology
135
Industrial Technology
Class Lab HoursB. Major Courses CGC 101 Introduction to Graphic Techniques 1
6 3 CGC 110 Electronic Publishing
1 6 3 CGC 125 Basic Offset Preparation
1 6 3 CGC 135 Commercial Graphics Operations 2
3 3 CGC 206 Typography II
2 3 3 CGC 210 Adv. Electronic Publishing
1 6 3 CGC 225 Image Assembly
1 6 3 CGC 240 Senior Project
1 6 3
C. Electives and/or Other Additional Courses Required for Graduation None Minimum semester credit hours required for graduation: 30
Heating, Ventilation, Air Conditioning Technology Degree Program
Associate Degree; Day and Evening
The heating, ventilation and air conditioning (HVAC) career field have four divisions: do-mestic, commercial, industrial and controls. Spartanburg Technical College HVAC gradu-ates repair, install and maintain equipment such as home heating equipment and central air conditioners. They can also work on the larger commercial equipment for cooling and heating. Graduates of HVAC may choose the industrial field to work on large scale equip-ment in multistory buildings, hospitals and nuclear or solar power applications. HVAC technicians are in great demand throughout industry. This course is 21 months in length for a full-time day student.
In order to graduate, full-time students enrolled in this program usually enroll in four or five courses per term which average 22-29 class hours per week or average 17 credit hours per term. Part-time students usually require more terms of attendance to graduate. The exact length depends upon course offerings and the number of courses taken by the student.
Upon registering, each new student should request a program outline which describes the courses.
Many of the courses listed below and on the following page require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
136
Industrial Technology
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation follow.
Job Opportunities: Sales in refrigeration and air conditioning, installer in refrigeration and air conditioning, troubleshooter in refrigeration and air conditioning and electrical controls technician.
Course Requirements for Heating, Ventilation and Air Conditioning Technology
Degree Program
Credit
Class Lab Hours A. General Education Courses
ENG 160 Technical Communications 3 0 3
MAT 155 Contemporary Math 3 0 3
PSY 103 Human Relations 3 0 3
HSS 205 Technology & Society 3 0 3
ECO 101 Basic Economics 3 0 3 B. Major Courses
ACR 101 Fundamentals of Refrigeration 3 6 5
ACR 104 Blueprint Reading HVAC 0 3 1
ACR 106 Basic Electricity HVAC 3 3 4
ACR 110 Heating Fundamentals 3 3 4
ACR 120 Basic Air Conditioning 3 3 4
ACR 122 Principles of Air Conditioning 4 3 5
ACR 130 Domestic Refrigeration 3 3 4
ACR 140 Automatic Controls 2 3 3
137
Industrial Technology
ACR 210 Heat Pumps 3 3 4
ACR 220 Advanced Air Conditioning 3 3 4
ACR 221 Residential Load Calculations 2 0 2
ACR 222 Commercial Load Calculations 2 0 2
ACR 223 Testing and Balancing 2 3 3
ACR 224 Codes & Ordinances 1 3 2
ACR 231 Advanced Refrigeration 3 3 4
ACR 240 Advanced Auto. Controls 2 3 3
WLD 102 Introduction to Welding 1 3 2
C. Electives and/or Other Additional Courses Required for Graduation
The student must complete one elective course which totals at
least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 73
Industrial Electronics Technology Degree ProgramAssociate Degree; Day and Evening
Industrial Electronics Technology pertains to the repair of all types of electrical and electronic equipment, including motor controllers, digital controllers, and instrumentation controls found in various industrial plants and hospitals in this area. Industrial Electronics is a broad field that encompasses manufacturing, medical, and safety controls and environmental control equipment, including programmable controllers. This course is 21 months in length for a full-time day student. Evening students may take longer than 21 months to complete the program. New students should plan to enroll Fall Semester.
In order to graduate, full-time students enrolled in this program usually enroll in four or five courses per term which include 22-28 class hours per week or average 18 credit hours per term. Part-time students usually require more semesters of attendance to graduate. The exact length depends upon course offerings and the number of courses taken by the student.
Upon registering, each new student should request a program outline which describes the courses and the specific terms in which they are scheduled.
Many of the courses listed below and on the following page require successful completion
138
Industrial Technology
of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation follow.
Practical Application: Students in the Industrial Electronics Technology Department are involved in using test equipment, operating motor controllers, operating electronic motors, and building electronic circuits. In addition, these students are involved with microproces-sor programming and operations, programmable logic controllers (PLC) programming and operations, fundamental computer programming and operations, and basic robotics.
Job Opportunities: Electronic instrumentation repair, electronic troubleshooter in plant, electronic equipment installer, plant electrician, power distribution, computer maintenance, general electrical wiring, broadcast station repair and maintenance, electrician and electronics helper, general building maintenance (electrical), and biomedical repair technician.
Course Requirements for Industrial Electronics Technology Degree Program
Credit
Class Lab Hours A. General Education Courses
ENG 160 Technical Communications 3 0 3
HSS 205 Technology and Society 3 0 3
MAT 168 Geometry & Trigonometry 3 0 3
MAT 101 Beginning Algebra 3 0 3
PSY 103 Human Relations 3 0 3
B. Major Courses EEM 107 Industrial Computer Technology 1
3 2 EEM 117 AC/DC Circuits I
3 3 4 EEM 118 AC/DC Circuits II
2 6 4 EEM 121 Electrical Measurements
2 3 3 EEM 125 Electronic Circuits
139
Industrial Technology
0 6 2 EEM 131 Solid State Devices
3 3 4 EEM 151 Motor Control I
2 6 4
Credit
Class Lab Hours
EEM 211 AC Machines 2 3 3
EEM 221 DC/AC Drives 2 3 3
EEM 231 Digital Circuits I 1 6 3
EEM 241 Microprocessors I 3 0 3
EEM 242 Microprocessors II 2 3 3
EEM 251 Programmable Controllers 3 0 3
EEM 252 Programmable Controllers Applications
1 6 3 EEM 275 Technical Troubleshooting
3 0 3 EEM 276 Applied Troubleshooting
1 6 3
C. Electives and/or Other Additional Courses Required for Graduation The student must complete one elective course which totals at
least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 67
Industrial Electronics TechnologyAutomated Manufacturing Technology Option Degree Program
Associate Degree
Industrial Electronics Technology/Automated Manufacturing Technology Option is an appli-
140
cation-oriented two year program. Graduates of the program will be trained in maintenance, installation, operation and servicing of high technology automated systems. Emphasis in the program will include analysis, troubleshooting, and operation of a flexible manufacturing system as well as a robot work cell. The course is 21 months in length for the full-time day student. Evening students may require more than 21 months to complete the program.
In order to graduate, full-time students enrolled in this program usually enroll in four or five courses per term which involve 22-28 class hours per week or average 18 credit hours per term. Part-time students usually require more terms of attendance to graduate. The exact length depends upon course offerings and the number of courses taken by the student.
Upon registering, each new student should request a program outline which describes the courses and the specific terms in which they are scheduled.
Many of the courses listed below and on the following page require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation follow.
Practical Application: Students of the Industrial Electronics Technology/Automated Manu-facturing Technology program experience training on robots, computer integrated systems, robot controllers, programmable logic controllers, microprocessors, motor control circuits, electronic circuits, mechanical systems, fluid power systems and computer programming.
Job Opportunities: Robotics technician, automated systems technician, maintenance/robots, electromechanical technician, systems specialist. Areas of employment will include manu-facturing, assembly, finishing and materials handling.
Course Requirements for Industrial Electronics TechnologyAutomated Manufacturing Technology Option Degree Program
Credit
Class Lab Hours A. General Education Courses
Industrial Technology
141
ENG 160 Technical Communications 3 0 3
MAT 101 Beginning Algebra 3 0 3
MAT 168 Geometry & Trigonometry 3 0 3
PSY 103 Human Relations 3 0 3
HSS 205 Technology and Society 3 0 3
B. Major Courses
AMT 105 Robotics and Auto. Control I 2 3 3
AMT 205 Robotics and Auto. Control II 1 6 3
AMT 206 Electricity and Automation 0 6 2
EEM 117 AC/DC Circuits I 3 3 4
EEM 118 AC/DC Circuits II 2 6 4
EEM 125 Electronic Circuits 0 6 2
EEM 131 Solid State Devices 3 3 4
EEM 151 Motor Controls I 2 6 4
EEM 211 AC Machines 2 3 3
EEM 231 Digital Circuits I 1 6 3
EEM 241 Microprocessors I 3 0 3
EEM 242 Microprocessors II 2 3 3
EEM 251 Programmable Controllers 3 0 3
EEM 252 Programmable Controller Applications
1 6 3
IMT 102 Industrial Safety 2 0 2
IMT 113 Power Tool Operations
Industrial Technology
142
1 3 2 IMT 121 Drive Systems
1 3 2 IMT 131 Hydraulics and Pneumatics 4
0 4 IMT 160 Preventive Maintenance
3 0 3
C. Electives and/or Other Additional Courses Required for Graduation The student must complete one elective course which totals at
least 2.0 credit hours (excluding COL 101).
Minimum semester credit hours required for graduation: 74
Industrial Mechanics Diploma Program
Diploma; Day and Evening
Industrial mechanics are concerned with the installation, maintenance and repair of machin-ery and production facilities of industrial plants. The industrial mechanic must be knowl-edgeable in blueprint reading, mathematics, hydraulics, pneumatics, basic electricity, basic welding and the proper use of hand and power tools, as well as develop analytical skills and mechanical ability to troubleshoot and make many different types of repairs. This program is 12 months in length for a full-time day student. Evening students will require more than 12 months to complete the program.
In order to graduate, full-time students enrolled in this program usually enroll in four or five courses per term which include approximately 28 class hours per week or average 17 credit hours per term. Part-time students require more semesters of attendance to gradu-ate. The exact length depends upon course offerings and the number of courses taken by the student.
Upon registering, each new student should request a program outline which describes the courses and the specific term in which they are scheduled.
Many of the courses listed require successful completion of other courses. These prerequisites are specified at the end of each course description at the back of this catalog.
Any questions concerning scheduling of courses or graduation requirements can be answered through the program advisor or department head. Program requirements for graduation follow.
Job Opportunities: General industrial plant mechanic, industrial machinery mechanic, ma-chinery overhauler, machinery repairman, machinery rebuilder, mechanical maintenance mechanic and quality control technician.
Course Requirements for Industrial Mechanics Diploma Program
Industrial Technology
143
Industrial Technology
Credit
Class Lab Hours
A. General Education Courses ENG 160 Technical Communications
3 0 3 HSS 205 Technology and Society
3 0 3 MAT 155 Contemporary Mathematics 3
0 3
B. Major Courses EEM 107 Industrial Computer Techniques 1
3 2 IMT 102 Industrial Safety
2 0 2 IMT 104 Schematics
2 0 2 IMT 111 Industrial Tools
3 6 5 IMT 120 Mechanical Installation
3 6 5 IMT 130 Fluid Power
2 9 5 IMT 140 Industrial Electricity
3 6 5 IMT 141 Electrical Control Devices
4 3 5
144
Industrial Technology
Notes
145
Cour
se D
escr
iptio
ns
1998-1999STC Catalog Copy
146
ACC 101 ACCOUNTING PRINCIPLES I (2-3-3.0) This course introduces basic accounting procedures for analyzing, recording, and summarizing financial transactions, adjusting and closing the financial records at the end of the accounting cycle, and preparing financial statements. Emphasis is also placed on accounting for current and long-term assets, current liabilities, and partnerships.Corequisite(s): COL 101 ACC 102 ACCOUNTING PRINCIPLES II (2-3-3.0) This course emphasizes managerial accounting theory and practice in basic accounting and procedures for cost accounting, budgeting, cost-volume analysis, and financial statement analysis. Additional financial topics covered will include accounting for long-term liabilities, corporations, and cash flow statements.Prerequisite(s): ACC 101 with a minimum grade of “C.”
ACC 111 ACCOUNTING CONCEPTS (3-0-3.0)This course is a study of the principles of the basic accounting functions-Collecting, recording, analyzing, and reporting information.Prerequisite(s): None
ACC 115 MANAGERIAL ACCOUNTING (3-0-3.0)This course is a study of the types and uses of internal accounting information for management decision-making, evaluation and financial planning.Prerequisite(s): ACC 101 with a minimum grade of “C.” ACC 124 INDIVIDUAL TAX PROCEDURES (3-0-3.0) This course is a study of the basic income tax structure from the standpoint of the individual, including the prepa-ration of individual income tax returns. Prerequisite(s): None ACC 201 INTERMEDIATE ACCOUNTING I (3-0-3.0) This course explores fundamental processes of accounting theory, including the preparation of financial statements. Topics will include current asset and liability management as well as future and present value of cash flows.Prerequisite(s): ACC 102 with a minimum grade of “C.” ACC 202 INTERMEDIATE ACCOUNTING II (3-0-3.0) This course covers the application of accounting principles and concepts to account evaluation and income deter-mination, including special problems peculiar to corporations and the analysis of financial reports. Other topics will include cash flow statements and constructing financial statements from incomplete records.Prerequisite(s): ACC 201 with a minimum grade of “C.”
ACC 230 COST ACCOUNTING I (3-0-3.0) This course is a study of the accounting principles involved in job order cost systems. Topics will include the general flow of costs through a production cycle, and the preparation and use of job cost sheets. Process cost systems will be introduced.Prerequisite(s): ACC 102 with a minimum grade of “C.”
ACC 231 COST ACCOUNTING II (3-0-3.0) This course is a study of the accounting principles involving processing and standard cost systems. Emphasis will be placed on cost variance analysis, joint product and by-product costing, direct costing, break-even analysis, cost-volume profit analysis, budgeting and decision-making.Prerequisite(s): ACC 230 with a minimum grade of “C.” ACC 240 COMPUTERIZED ACCOUNTING (3-0-3.0) This course is a study of using the computer to design and implement various accounting functions, including financial transactions, records, statements, reports and documents. Emphasis will be placed on providing analytical studies using output information. This course will involve hands-on training using microcomputers.Prerequisite(s): ACC 101 with a minimum grade of “C.” ACR 101 FUNDAMENTALS OF REFRIGERATION (3-6-5.0)
ACC
147
This course covers the refrigeration cycle, refrigerants, pressure temperature relationship, and system compo-nents. ACR 104 PRINT READING FOR HVAC (0-3-1.0)This course covers reading and interpreting prints used in HVAC installation and maintenance. ACR 106 BASIC ELECTRICITY FOR HVAC/R (3-3-4.0) This course includes a basic study of electricity, including Ohms’ Law and series and parallel circuits as they relate to heating, ventilating, air conditioning and/or refrigeration systems. ACR 110 HEATING FUNDAMENTALS (3-3-4.0)This course covers the basic concepts of oil, gas, and electric heat, their components and operation. ACR 120 BASIC AIR CONDITIONING (3-3-4.0)This course is a study of various types of air conditioning equipment including electrical components, schematics and service to the refrigerant circuit. ACR 122 PRINCIPLES OF AIR CONDITIONING (4-3-5.0) This course is a study of the air cycle, psychrometrics, load estimating and equipment selection. ACR 130 DOMESTIC REFRIGERATION (3-3-4.0)This course is a study of domestic refrigeration equipment. ACR 140 AUTOMATIC CONTROLS (2-3-3.0)This course is a study of the adjustment, repair and maintenance of a variety of pressure and temperature sensitive automatic controls.
ACR 210 HEAT PUMPS (3-3-4.0)This course is a study of theory and operational principles of the heat pump. ACR 220 ADVANCED AIR CONDITIONING (3-3-4.0) This course is an advanced study of air conditioning systems. ACR 221 RESIDENTIAL LOAD CALCULATIONS (2-0-2.0) This course is a study of heat losses/gains in residential structures. ACR 222 COMMERCIAL LOAD CALCULATIONS (2-0-2.0) This course is a study of heat losses/gains in commercial structures.
ACR 223 TESTING AND BALANCING (2-3-3.0)This course covers testing and balancing of air distribution induct work and water flow in piping.
ACR 224 CODES AND ORDINANCES (1-3-2.0)This course covers instruction on how to reference appropriate building codes and ordinances where they apply to installation of heating and air conditioning equipment.
ACR 231 ADVANCED REFRIGERATION (3-3-4.0)This course is an in-depth study of commercial and industrial refrigeration equipment. ACR 240 ADVANCED AUTOMATIC CONTROLS (2-3-3.0) This course is a study of pneumatic and electronic controls used in air conditioning and refrigeration.
AET 107 BASIC DESIGN AND SKETCHING (1-3-2.0)This course is a study of the fundamentals of color, texture, shape and composition. Free hand sketching is also introduced.
AET
148
AET 111 ARCHITECTURAL COMPUTER GRAPHICS I (1-6-3.0) This course includes architectural/construction, basic computer-aided design commands, and creation of construc-tion industry symbols and standards. Corequisite(s): EGT 150
AET 221 ARCHITECTURAL COMPUTER GRAPHICS II (2-6-4.0) This course includes a study of CAD commands with architectural applications and routines. A complete set of working drawings of a residential or commercial building using the computer as the drafting tool is produced. Prerequisite(s): AET 111
AET 231 ARCHITECTURAL COMPUTER GRAPHICS III (2-6-4.0)This course covers advanced CAD applications. A complete set of construction documents for a residential or commercial building, including a specification outline, is produced and presented.
AET 240 ARCHITECTURAL GRAPHICS IV (3-3-4.0)This course involves a well-developed set of working drawings including details, oral/graphic presentation of the drawings and building systems drawings as appropriate. AET 247 MANUFACTURING OF PREFABRICATED STRUCTURES (4-0-4.0) This course covers the study and application of the methods and procedures of manufacturing pre-engineered and pre-cut buildings and structural systems. AHS 102 MEDICAL TERMINOLOGY (3-0-3.0)This course covers medical terms, including roots, prefixes, and suffixes, with emphasis on spelling, definition, and pronunciation. AHS 104 MEDICAL VOCABULARY/ANATOMY (3-0-3.0) This course introduces the fundamental principles of medical terminology and includes a survey of human anatomy and physiology. AHS 105 MEDICAL ETHICS AND LAW (2-0-2.0) This course provides a study of ethical conduct and legal responsibility related to health care.
AHS 110 PATIENT CARE PROCEDURES (2-0-2.0) This course provides a study of the procedures and techniques used in the general care of the patient. AHS 111 HEALTH RELATED SCIENCES (3-3-4.0) This course introduces modules of instruction in chemistry, microbiology, and physics with emphasis on their application to health care. Prerequisite(s): MAT 155, RES 101, RES 105, RES 106, RES 121
AHS 118 MEDICAL CODING AND INSURANCE (3-6-5.0) This course includes a study of coding procedures and their relationship to insurance. Prerequisite(s): AHS 123, OST 165 with a minimum grade of “C.” AHS 140 THERAPEUTICS FOR HEALTH (3-0-3.0)This course provides a basic study of therapeutic agents applicable to health science and nursing professions.
AHS 142 PHLEBOTOMY (0-6-2.0)This course is a study of phlebotomy procedures utilized in clinical facilities and physicians' offices.
AHS 151 HEALTH CARE PROCEDURES I (3-6-5.0)This course includes a study of fundamental health skills related to the patient/client in all of life's stages.
AHS 155 SPECIAL TOPICS IN HEALTH CARE (3-0-3.0)This course emphasizes specialized job-related education in health care.
AHS 158 NURSE ASSISTING TECHNIQUES II (1-3-2.0)
AET
149
AUT
This course includes the application of nurse assisting techniques in the acute care setting.
AMT 101 AUTOMATED MANUFACTURING OVERVIEW (1-3-2.0)) ElectiveThis course is a survey of automated manufacturing concepts.
AMT 105 ROBOTICS & AUTOMATED CONTROL I (2-3-3.0) This course includes assembling, testing, and repairing equipment used in automation. Concentration is on con-necting, testing, and evaluating automated controls and systems.
AMT 205 ROBOTICS AND AUTOMATED CONTROL II (1-6-3.0) This course covers installation, testing, troubleshooting, and repairing of automated systems. AMT 206 ELECTRICITY & AUTOMATION (0-6-2.0) This course progresses from introduction to principles of automation, including a study of various mechanical devices used in automated manufacturing, and electrical components used to control the machines. Lab projects include design, fabrication, and operation of various real and simulated processes.
ART 101 ART HISTORY AND APPRECIATION (3-0-3.0) This is an introductory college transfer course designed to expose students to the history and appreciation of art, including the elements and principles of the visual arts. ART 105 FILM AS ART (3-0-3.0) TelecourseThis college transfer course provides an introduction to the appreciation of film and covers the elements and principles of cinema with historical and contemporary examples.
AUT 107 ADVANCED ENGINE REPAIR (3-3-4.0)This course includes an advanced application of engine fundamentals, including engine removal, internal diagnostic and repair procedures, engine assembly and installation procedures.Prerequisite(s): AUT 132 and AUT 160
AUT 111 BRAKES (2-3-3.0)This course is a study of the fundamentals of hydraulics and brake components in their application to automotive brake systems.Prerequisite(s): AUT 132 and AUT 160 AUT 115 MANUAL DRIVE TRAIN/AXLE (2-3-3.0)This course is a basic study of clutches, gearing, and manual transmission operation, including the basic study of rear axles and rear axle set up.Prerequisite(s): AUT 132 and AUT 160 AUT 132 AUTOMOTIVE ELECTRICITY (3-3-4.0)This course is a study of electricity as used in automotive applications. This course includes DC and AC principles and their various uses in the automobile. The relationship between Ohm’s Law and actual automotive circuits is demonstrated.Corequisite(s): AUT 160
AUT 135 IGNITION SYSTEMS (3-0-3.0)This is a study of both primary and secondary electronic ignition systems, including distributorless ignition sys-tems, theory of operation and diagnostic techniques, and applications of diagnostics using the oscilloscope and other appropriate test equipment.Prerequisite(s): AUT 132 and AUT 160
AUT 142 HEATING AND AIR CONDITIONING (2-3-3.0) This course covers the purpose, construction, operation, diagnosis, and repair of automotive ventilation, heating and air conditioning systems of automotives. Prerequisite(s): AUT 132 and AUT 160 AUT 145 ENGINE PERFORMANCE (3-0-3.0)
150
AUT
This course covers the diagnosis of various performance problems using the appropriate diagnostic equipment and diagnostic manuals. Logical thinking is also included in the course. Prerequisite(s): AUT 132 and AUT 160 AUT 160 INTRODUCTION TO AUTOMOTIVE TECHNOLOGY (1-0-1.0) This course is an introduction to the automotive field, including an introduction to the different automotive fields available such as automotive technician, shop foreman, service manager, shop owner, etc. Corequisite(s): AUT 132
AUT 221 SUSPENSION AND STEERING (2-3-3.0)This course covers the diagnosis and repair of front and rear suspension problems, using suspension diagnostic charts, shop manuals and alignment equipment.Prerequisite(s): AUT 132 and AUT 160
AUT 231 AUTOMOTIVE ELECTRONICS (4-0-4.0)This course includes the study of solid state devices, microprocessors and complete diagnostics using the latest available equipment. Prerequisite(s): AUT 132 and AUT 160
AUT 232 AUTOMOTIVE ACCESSORIES (2-0-2.0) This course is a study of devices and systems considered accessories by the automotive industry. Study includes windshield wiper systems, power door locks, windows and seats, radios and clocks. Prerequisite(s): AUT 132 and AUT 160 AUT 245 ADVANCED ENGINE PERFORMANCE (4-3-5.0) This course includes “hands-on” diagnostics, including an in-depth study and use of the oscilloscope in diagnosing engine performance problems. Prerequisite(s): AUT 132 and AUT 160 AUT 251 AUTOMATIC TRANSMISSION OVERHAUL (4-3-5.0) This course is an advanced study of transmission overhaul procedures, including proper overhaul procedures used to repair overdrive transmissions and transaxles. Prerequisite(s): AUT 132 and AUT 160
BAF 260 FINANCIAL MANAGEMENT (3-0-3.0) This course is a study of financial analysis and planning. Topics include working capital management, capital budgeting and cost of capital. Financial forecasting, operating and financial leverage will also be discussed. Prerequisite(s): ACC 102 with a minimum grade of “C.”
BIO 100 INTRODUCTORY BIOLOGY (4-0-4.0) This is a course in general biology designed to introduce principles of biology. The emphasis in this course is on human physiology and the role that humans play in the biosphere. A minimum grade of “C” is required in order to receive credit in this course. (Non-Degree Credit)Prerequisite(s): RDG 039 or placement. BIO 101 BIOLOGICAL SCIENCE I (3-3-4.0) This college transfer course is the first of a sequence introducing biology. Topics include the scientific method, basic biochemistry, cell structure and function, cell physiology, cell reproduction and development, Mendelian genetics, population genetics, natural selection, evolution, and ecology.Prerequisite(s): High school biology or chemistry or BIO 100. BIO 102 BIOLOGICAL SCIENCE II (3-3-4.0) This college transfer course is a continuation of introductory biology which includes classification of organisms and structural and functional considerations of all kingdoms (particularly major phyla as well as viruses). Vertebrate animals and vascular plants are emphasized. Prerequisite(s): BIO 101 BIO 205 ECOLOGY (3-0-3.0)
151
158 159CET
This college transfer course introduces basic principles of population biology, ecology, and environmental science as applied to the study of the interactions between human kind and the biosphere. BIO 210 ANATOMY & PHYSIOLOGY I (3-3-4.0) This college transfer course is the first in a sequence of courses, including an intensive coverage of the body as an integrated whole. All body systems are studied. The following topics are covered: chemical basis of life, cell, tissues, skeleton, muscular system, integument, nervous system and sense organs. Prerequisite: High School Biology or Chemistry, BIO 100 or CHM 100. BIO 211 ANATOMY & PHYSIOLOGY II (3-3-4.0) This college transfer course is a continuation of a sequence of courses, including intensive coverage of the body as an integrated whole. All body systems are studied. The following topics are covered: endocrine, circulatory, lymphatic, immune, respiratory, digestive and urinary systems and fluid/electrolyte balance. Prerequisite(s): BIO 210 BUS 121 BUSINESS LAW I (3-0-3.0) This course is a study of legal procedures, law and society, classifications and systems of law, the tribunals admin-istering justice and their actions, contracts, sales, transfer of titles, rights and duties of the parties, conditions, and warranties. Prerequisite(s): None
CET 102 FUNDAMENTALS OF SURVEYING (1-3-2.0) This course includes the study of fundamental surveying theory, equipment, and procedures. CET 105 SURVEYING I (2-3-3.0) This course includes surveying theory and practice; care and use of instruments; traversing procedures; and computation of closure. Prerequisite(s): MAT 102
CET 120 CONSTRUCTION MATERIALS (2-3-3.0) This course includes a study of basic materials used in construction, including research of building product specifications. CET 135 CONSTRUCTION CONTRACTS (2-0-2.0) This course covers construction contracts; owner, engineer, contractor relations and responsibilities; contract performance requirements; bidding procedures; format; and interpretation of specifications. CET 205 SURVEYING II (3-3-4.0) This course includes electro-optical instrumentation techniques and complex computations used in surveying. Prerequisite(s): CET 105
CET 216 SOIL MECHANICS (2-3-3.0)This course covers soil types, their engineering properties, and techniques of field and laboratory identification and testing.
CET 218 HYDRAULICS (2-3-3.0) This course includes the fundamentals of flow, control, disposal of water, and flow through open and closed conduits, orifices, and wires. Prerequisite(s): EGR 194 CET 220 CONCRETE & STEEL DESIGN (2-3-3.0) This course covers the study of reinforced concrete and steel structural components.Prerequisite(s): EGR 194
CET 235 CONSTRUCTION METHODS & ESTIMATING (2-3-3.0) This course covers basic construction techniques with emphasis on cost estimating. Prerequisite(s): CET 120 CET 238 CONSTRUCTION PLANNING AND SCHEDULING (1-3-2.0) Elective
152
This course covers the decision-making process involved in organizing the labor, materials, and equipment for a construction project.
CET 246 ENVIRONMENTAL SYSTEMS TECHNOLOGY (2-3-3.0) This course covers a study of the sources, treatment, collection and distribution of water and waste water.Prerequisite(s): CET 218 CET 251 HIGHWAY DESIGN (2-3-3.0) This course covers a study of the design and construction of a highway. Prerequisite(s): CET 105
CGC 101 INTRODUCTION TO GRAPHICS TECHNIQUES (1-6-3.0)This course covers the processes of printed reproduction with an emphasis on offset printing. A variety of printing equipment and operating techniques are included.
CGC 110 ELECTRONIC PUBLISHING (1-6-3.0)This is an introductory course to the fundamentals of electronic publishing.
CGC 122 BASIC OFFSET PRESS OPERATION (1-6-3.0)This course covers the basic competencies required to operate an offset press.
CGC 125 BASIC OFFSET PREPARATION (1-6-3.0)This course covers the basics of preparing a job to be reproduced from the mechanical stage to preparing the offset printing plate.
CGC 135 COMMERCIAL GRAPHICS OPERATIONS (3-0-3.0)This course is a study of customer service, cost factors, quality issues and daily operations associated with the commercial graphics industry.
CGC 206 TYPOGRAPHY II (2-3-3.0)This course covers advanced typography and photocomposition.
CGC 210 ADVANCED ELECTRONIC PUBLISHING (2-3-3.0)This course covers a wide range of computer hardware, software and peripherals.
CGC 222 ADVANCED OFFSET PRESS OPERATIONS (2-3-3.0)This course covers advanced techniques in the operation of the offset press.
CGC 225 IMAGE ASSEMBLY (2-3-3.0)This course covers an in-depth study of the image assembly techniques used for offset printing.
CGC 230 EQUIPMENT MAINTENANCE AND REPAIR (2-6-4.0)This course covers routine equipment maintenance procedures.
CGC 235 FINISHING OPERATIONS (2-3-3.0)This course addresses issues of finishing the printed product following press production. Topics include cutting, folding and binding techniques, proper paper handling, storage and shipping.
CGC 240 SENIOR PROJECT IN COMMERCIAL GRAPHICS (1-6-3.0)This course consists of advanced projects related to the commercial graphics industry.
CGC 250 SPECIAL PROJECTS IN COMMERCIAL GRAPHICS (1-6-3.0)This course consists of special projects related to the commercial graphics industry. CHM 100 INTRODUCTORY CHEMISTRY (4-0-4.0)
CET
153
162 163
This is an introductory course in general chemistry and principles of chemistry. Emphasis is placed on mathemati-cal solutions and laboratory techniques. A minimum grade of “C” is required in order to receive credit in this course. (Non-Degree Credit)Prerequisite(s): MAT 039, RDG 039 or placement. CHM 105 GENERAL, ORGANIC AND BIOCHEMISTRY (3-3-4.0)This course is a study of the fundamental principles of chemistry, including atomic and molecular structure, com-mon substances and reactions, introduction to organic chemistry and biochemistry.Prerequisite(s): High school chemistry or CHM 100.
CHM 110 COLLEGE CHEMISTRY I (3-3-4.0) This is the first college transfer course in a sequence which includes the following topics: atomic and molecular structure, nomenclature and equations, properties, reactions and states of matter, stoichiometry, gas laws, solu-tions, and equilibria. Corequisite(s): MAT 102
CHM 111 COLLEGE CHEMISTRY II (3-3-4.0) This college transfer course is a continuation of the study of atomic and molecular structure, nomenclature and equations, properties, reactions and states of matter, stoichiometry, gas laws, solutions, and equilibria. Other topics included are kinetics, thermodynamics, and electrochemistry. Prerequisite(s): CHM 110
CHM 211 ORGANIC CHEMISTRY I (3-3-4.0)This is the first in a sequence of courses that includes nomenclature, structure and properties and reaction mecha-nisms of basic organic chemistry.Prerequisite(s): CHM 110 with a minimum grade of “C.”
CHM 212 ORGANIC CHEMISTRY II (3-3-4.0)This course is a continuation of basic organic chemistry. Topics include nomenclature, structure and properties, reaction mechanisms of basic organic chemistry, biochemistry and spectroscopy.Prerequisite: CHM 211 with a minimum grade of “C.” COL 101 COLLEGE ORIENTATION (1-0-1)This course may include selected topics such as career planning, study skills, stress management, tutoring, group guidance, and other subjects to facilitate student success. Workplace interpersonal and problem-solving skills will be emphasized.Corequisite(s): ACC 101 or CPT 114 or MGT 101 or MKT 101 or OST 105.Note: Enrollment in this course by other than business division students is subject to approval by the business division dean.
COL 103 COLLEGE SKILLS (3-0-3.0) This course may include selected topics such as career planning study skills, stress management, tutoring, group guidance, and other subjects to facilitate student success.
CPT 101 INTRODUCTION TO COMPUTERS (3-0-3.0) This course covers basic computer history, theory and applications, including word processing, spreadsheets, data bases, and the operating system. Prerequisite(s): None
CPT 107 FILE ENTRY OPERATIONS (3-0-3.0) This course includes a study of data entry and word processing using a computer system. Exercises stress speed, accuracy, and familiarity with common office forms. Prerequisite(s): None
CPT 108 WORD PROCESSING I (1-0-1.0)This course is an introduction to the basic concepts of microcomputer word processing.
CPT 111 BASIC PROGRAMMING I (3-0-3.0)
CPT
154
This course introduces the BASIC programming language, emphasizing the logical design, development, testing and debugging of structured BASIC programs. Topics include arithmetic operations, decision structures, looping formatted output, arrays, subroutines and file structures.Prerequisite(s): CPT 114 CPT 114 COMPUTERS & PROGRAMMING (3-0-3.0) This course introduces computer concepts and programming. Topics include basic concepts of computer architecture, files, memory, and input/output devices. Programming is done in a modern high-level procedural language. Corequesite: COL 101
CPT 115 COBOL PROGRAMMING I (2-3-3.0) This course introduces the nature and use of the common business oriented language — COBOL. COBOL will be taught on an AS400 computer.Prerequisite(s): CPT 168 with a minimum grade of “C.”
CPT 121 RPG PROGRAMMING I (2-3-3.0) This course introduces the RPG programming language, emphasizing the designing, coding, testing, and debug-ging of RPG programs. RPG III will be taught on an AS400 computer.Prerequisite(s): CPT 168 with a minimum grade of “C.”
CPT 151 MACHINE OPERATIONS (3-0-3.0))This course covers the major functions of the operations department of a computer center. Students learn the operating system and operation of an AS400 minicomputer.
CPT 168 PROGRAMMING LOGIC AND DESIGN (3-0-3.0) This course examines problem-solving techniques applied to program design. Topics include a variety of docu-mentation techniques as means of solution presentation. Prerequisite(s): CPT 114 and CPT 264 with a minimum grade of “C.”
CPT 170 MICROCOMPUTER APPLICATIONS (3-0-3.0) This course introduces microcomputer applications software, including word processing, data bases, spreadsheets, graphs, and their integration. Prerequisite(s): CPT 101 with a minimum grade of “C.” CPT 174 MICROCOMPUTER SPREADSHEETS (3-0-3.0) This course introduces the use of spreadsheet software on the microcomputer. Topics include creating, editing, using formulas, using functions, and producing graphs. Prerequisite(s): CPT 114 or CPT 101 with a minimum grade of “C.” Transitional Mathematics.
CPT 178 SOFTWARE APPLICATIONS (3-0-3.0)Using electronic spreadsheet and relational data base management software programs, this course focuses on complex microcomputer applications.Prerequisite(s): CPT 114 CPT 179 MICROCOMPUTER WORD PROCESSING (3-0-3.0) This course introduces microcomputer word processing. Topics include creating, editing, formatting, and printing documents. Prerequisite(s): CPT 101 or CPT 114 with a minimum grade of “C.”
CPT 185 EVENT-DRIVEN PROGRAMMING (3-0-3.0)This course introduces the student to the devlopment of software applications using an Event-Driven Language.Prerequisite(s): CPT 114 and CPT 264 with a minimum grade of "C."
CPT 208 SPECIAL TOPICS IN COMPUTER TECHNOLOGY (3-0-3.0)This course focuses on changes in computer technology.
CPT
155
166 167
CWE
Prerequisite(s): CPT 114 and CPT 264 with a minimum grade of “C.” NOTE: Enrollment approved by department head in computer technology.
CPT 209 COMPUTER SYSTEMS MANAGEMENT (3-0-3.0)This course examines the methods and procedures used in maintaining microcomputer systems. Topics include hardware and software installation, configuration, operations and troubleshooting.Prerequisite(s): CPT 114 with a minimum grade of "C." CPT 215 COBOL PROGRAMMING II (2-3-3.0) This course emphasizes file maintenance and tables using advanced concepts in COBOL. COBOL will be taught on the AS400 computer.Prerequisite(s): CPT 115 with a minimum grade of “C.”
CPT 221 RPG PROGRAMMING II (2-3-3.0) This course introduces the advanced concepts of the RPG programming language. RPG III will be taught on the AS400 computer.Prerequisite(s): CPT 121 with a minimum grade of “C.”
CPT 234 C PROGRAMMING I (3-0-3.0)This introductory course in C programming emphasizes the designing, coding, testing and debugging of C programs involving input/output operations, data types, storage classes, decision structures, looping, functions, preprocessor directives, arrays and simple pointers.Prerequisite(s): CPT 168 with a minimum grade of “C.”
CPT 242 DATABASE (3-0-3.0) This course introduces data base models and the fundamentals of data base design. Topics include data base structure, data base processing, and application programs which access a data base. A microcomputer data base package will be used.P r e r e q u i s i t e ( s ) : C P T 2 4 4 w i t h a m i n i m u m g r a d e o f “ C . ”
CPT 244 DATA STRUCTURES (3-0-3.0) This course examines data structures widely used in programming. Topics include linked lists, stacks, queues, trees, and sorting and searching techniques. Prerequisite(s): CPT 114 and CPT 264 with a minimum grade of “C.”
CPT 255 OPERATING SYSTEM FUNDAMENTALS (2-3-3.0) This course examines popular operating systems of several different types of computers. Topics include command languages, utility programs, and screen design. Prerequisite(s): CPT 114 with a minimum grade of “C.” CPT 257 OPERATING SYSTEMS (3-0-3.0) This course examines the theory of operating systems and how the operating system theory is implemented in current operating systems. Prerequisite(s): CPT 114 with a minimum grade of “C.” CPT 264 SYSTEMS AND PROCEDURES (3-0-3.0) This course covers the techniques of system analysis, design, development, and implementation. Corequisite: CPT 114.
CPT 270 ADVANCED MICROCOMPUTER APPLICATIONS (3-0-3.0)This course emphasizes the integration of popular microcomputer software packages using advanced concepts in microcomputer applications software. Problem solving and trouble shooting of microcomputer hardware and software problems are addressed.Prerequisite(s): CPT 114, CPT 178, CPT 255 CWE 101 COOPERATIVE WORK EXPERIENCE PREPARATION (0-0-1.0) This course includes preparation for cooperative work experience. CWE 112 COOPERATIVE WORK EXPERIENCE I (0-0-2.0)
156
CWE
This course includes cooperative work experience in an approved setting. CWE 113 COOPERATIVE WORK EXPERIENCE I (0-0-3.0) This course includes cooperative work experience in an approved setting. CWE 122 COOPERATIVE WORK EXPERIENCE II (0-0-2.0) This course includes cooperative work experience in an approved setting. CWE 123 COOPERATIVE WORK EXPERIENCE II (0-0-3.0) This course includes cooperative work experience in an approved setting.
CWE 131 COOPERATIVE WORK EXPERIENCE III (0-0-1.0)This course includes cooperative work experience in an approved setting.
CWE 132 COOPERATIVE WORK EXPERIENCE III (0-0-2.0) This course includes cooperative work experience in an approved setting. CWE 133 COOPERATIVE WORK EXPERIENCE III (0-0-3.0) This course includes cooperative work experience in an approved setting. CWE 212 COOPERATIVE WORK EXPERIENCE IV (0-0-2.0) This course includes cooperative work experience in an approved setting. CWE 213 COOPERATIVE WORK EXPERIENCE IV (0-0-3.0) This course includes cooperative work experience in an approved setting.
CWE 222 COOPERATIVE WORK EXPERIENCE IV (0-0-2.0) This course includes cooperative work experience in an approved setting.
CWE 231 COOPERATIVE WORK EXPERIENCE VI (0-0-1.0)This course includes cooperative work experience in an approved setting.
DAT 112 INTEGRATED HUMAN SCIENCES (4-0-4.0) This course provides a basic study of human anatomy, physiology, and microbiology as related to dental science and the practice of dental assisting. DAT 113 DENTAL MATERIALS (3-4-4.0) This course is a study of physical and chemical properties of matter and identification, characteristics, and ma-nipulation of dental materials. DAT 115 ETHICS & PROFESSIONALISM (0-3-1.0) This course introduces a cursory history of dental assisting, professional associations, scope of service in dentistry, and ethical, legal and professional considerations. The state dental practice act is reviewed. DAT 118 DENTAL MORPHOLOGY (2-0-2.0) This course emphasizes the development, eruption, and individual characteristics of each tooth and surrounding structures. DAT 121 DENTAL HEALTH EDUCATION (1-3-2.0) This course defines the responsibilities of the dental assistant in individual and community dental health education with emphasis on the etiology of dental disease, methods for prevention, and principles of nutrition in relationship to oral health and preventive dentistry. Prerequisite(s): DAT 118, DAT 112
DAT 122 DENTAL OFFICE MANAGEMENT (2-0-2.0)
157
ECD
This course provides a study of the business aspect of a dental office. Prerequisite(s): DAT 154Corequisite(s): DAT 124 DAT 123 ORAL MEDICINE/ORAL BIOLOGY (3-0-3.0) This course presents a basic study of oral pathology, pharmacology, nutrition, and common emergencies as related to the role of the dental assistant.Prerequisite(s): DAT 112, DAT 118 DAT 124 EXPANDED FUNCTIONS/SPECIALTIES (0-3-1.0) This course offers practice in performing the expanded clinical procedures designated by the South Carolina State Board of Dentistry for Dental Assistants. Prerequisite(s): DAT 118, DAT 154
DAT 127 DENTAL RADIOGRAPHY (3-4-4.0) This course provides the fundamental background and theory for the safe and effective use of X-radiation in dentistry. It encompasses the history of X-rays, production and uses of radiation, radiographic film, exposure factors, interpretation of radiographs and radiation hygiene. Prerequisite(s): DAT 112, DAT 118, DAT 154 DAT 154 CLINICAL PROCEDURES I (2-6-4.0) This course includes preparation to assist a dentist efficiently in four-handed dentistry. Emphasis is on the names and functions of all dental instruments, the principles involved in their use, and the assistants’ role in dental instrumentation.
DAT 174 OFFICE ROTATIONS (0-12-4.0) This is an introductory course to a general office with emphasis placed on chairside assisting and office manage-ment. Prerequisite(s): All DAT courses first semester DAT 177 DENTAL OFFICE EXPERIENCE (0-35-7.0) This course consists of practice in the dental office or clinic with rotation of assignments to encompass experiences in office management and clinical experience in all areas of dentistry. Prerequisite(s): All DAT courses first and second semesters
ECD 101 INTRODUCTION TO EARLY CHILDHOOD (3-0-3.0) This course includes an overview of the history, theories, and curriculum models of early education. Emphasis is on current trends/issues, with a review of state/national regulations. Characteristics of quality programs and professional teachers are explored in the course. ECD 102 GROWTH & DEVELOPMENT I (3-0-3.0) This course is an extensive study of philosophies and theories of growth and development of infants/toddlers. Focus is on "total" development of the child, with emphasis on physical, social, emotional, cognitive, and nutritional areas. Developmental tasks and appropriate activities are explored in the course. ECD 103 GROWTH & DEVELOPMENT II (3-0-3.0) This course is an in-depth study of preschool children growing and developing in today’s world. Focus is on "total" development of the child with emphasis on physical, social, emotional, cognitive, and nutritional areas of development. Developmental tasks and appropriate activities are explored in the course. ECD 105 GUIDANCE-CLASSROOM MANAGEMENT (3-0-3.0) This course is an overview of developmentally appropriate, effective guidance and classroom management tech-niques for the teacher of young children. A positive proactive approach is stressed in the course. ECD 107 EXCEPTIONAL CHILDREN (3-0-3.0) This course includes an overview of special needs children and their families. Emphasis is on prevalence of disor-ders, treatment modalities, community resources serving exceptional children, the teacher’s role in mainstreaming and early identification, and on federal legislation affecting exceptional children.
158
172 173
ECD
ECD 108 FAMILY AND COMMUNITY RELATIONS (3-0-3.0) This course includes an overview of techniques and materials promoting effective family/programs partnerships to foster positive child development. Emphasis is on availability and accessibility of community resources, and on developing appropriate communication skills.
ECD 109 ADMINISTRATION AND SUPERVISION (3-0-3.0) This course is a study of the role and responsibilities of an early childhood administrator. Special factors are on monetary matters, space management, curriculum, health and food services, and relations among the public, staff and parents. ECD 131 LANGUAGE ARTS (3-0-3.0) This course is a study of methods and materials in age-appropriate language experiences. Opportunities are provided to develop listening, speaking, prereading and prewriting skills through planning, implementation, and evaluation of media, methods, techniques and equipment. Methods of selection, evaluation, and presentation of children’s literature are included.
ECD 132 CREATIVE EXPERIENCES (1-6-3.0) In this course the importance of creativity and independence in creative expression are stressed. A variety of age-appropriate media, methods, techniques and equipment are utilized. Students plan, implement, and evaluate instructional activities.
ECD 133 SCIENCE & MATH CONCEPTS (3-0-3.0) This course includes an overview of pre-number and science concepts developmentally-appropriate for young children. Emphasis is on the planning, implementation, and evaluation of developmentally-appropriate activities utilizing a variety of methods and materials. ECD 135 HEALTH, SAFETY AND NUTRITION (3-0-3.0) This course covers a review of health/safety practices recommended for child care and includes information on common diseases and health problems. Certification preparation is provided in pediatric safety, CPR, and First Aid. Guidelines and information on nutrition and developmentally-appropriate activities are also studied in the course. ECD 137 METHODS AND MATERIALS (1-6-3.0) This course includes an overview of developmentally-appropriate methods and materials for planning, implement-ing, and evaluating environments. Emphasis is on integrating divergent activities in each curriculum area.
ECD 143 SUPERVISED FIELD EXPERIENCE I (0-9-3.0) This course includes emphasis on planning, implementing, and evaluating scheduled programs, age appropriate methods, materials, activities, and environments of early childhood principles and practices.Prerequisite(s): ECD 132 ECD 144 SUPERVISED FIELD EXPERIENCE II (0-9-3.0) This course includes emphasis on planning, implementing, and evaluating scheduled programs, age-appropriate methods, materials, activities, and environments in all areas of responsibility in programs dealing with young children.Prerequisite(s): ECD 132, ECD 143
ECO 101 BASIC ECONOMICS (3-0-3.0) This course is a study of comparative economic systems, forms of business organizations, business operations, and wage and price determination. ECO 210 MACROECONOMICS (3-0-3.0) This college transfer course includes the study of fundamental principles and policies of a modern economy to include markets and prices, national income accounting, business cycles, employment theory and fiscal policy, banking and monetary controls, and the government’s role in economic decisions and growth.
159
174 175 172 173
EEM
ECO 211 MICROECONOMICS (3-0-3.0) This college transfer course includes the study of the behavior of households and firms, including supply and demand, elasticity, price/input in different market structures, pricing of resources, regulations, and comparative advantage and trade.
EEM 107 INDUSTRIAL COMPUTER TECHNIQUES (1-3-2.0) This course is an introduction to microcomputers. Topics include definitions of computer types, hardware and software structure, movement of data, and application of microcomputers. EEM 117 AC/DC CIRCUITS I (3-3-4.0)This course is a study of direct and alternating theory, Ohm’s Law, series, parallel, and combination circuits. Circuits are constructed and tested.
EEM 118 AC/DC CIRCUITS II (2-6-4.0)This course is a continuation of the study of direct and alternating current theory to include circuit analysis using mathematics and verified with electrical measurements.
EEM 121 ELECTRICAL MEASUREMENTS (2-3-3.0)This course covers the basic principles of electrical measuring instruments and how they are used in industries. EEM 123 SCHEMATICS ANALYSIS (3-0-3.0) ElectiveThis course covers the interpretation of electrical and electronic schematics, including the mathematical analysis of these circuits. EEM 125 ELECTRONIC CIRCUITS (0-6-2.0)This course covers the basic circuits encountered in industrial equipment. Both theoretical and practical experi-ences are included. EEM 131 SOLID STATE DEVICES (3-3-4.0)This course is a study of semiconductor theory and common solid state devices. Circuits are constructed and tested.
EEM 140 NATIONAL ELECTRICAL CODE (3-0-3.0) ElectiveThis course is a study of the national electrical code and is based on the latest codes as published by the National Fire Protection Association (NFPA).
EEM 151 MOTOR CONTROLS I (2-6-4.0)This course is an introduction to motor controls, including a study of the various control devices and wiring used in industrial processes. EEM 162 INTRODUCTION TO PROCESS CONTROL (3-0-3.0) This course is an introduction to control systems theory and process control characteristics. EEM 211 AC MACHINES (2-3-3.0)This course is a study of application, operation, and construction of AC machines.
EEM 221 DC/AC DRIVES (2-3-3.0)This course covers the principles of operation and application of DC drives and AC drives. EEM 231 DIGITAL CIRCUITS I (1-6-3.0)This course is a study of the logic elements, mathematics, components, and circuits utilized in digital equipment. Emphasis is placed on the function and operation of digital integrated circuit devices. EEM 241 MICROPROCESSORS I (3-0-3.0)This course is an introduction to basic microprocessor concepts such as microprocessor structure, numbering systems, computer arithmetic, programming, architecture, and basic interfacing techniques. Corequisite: EEM 242
160
176 177EEM 242 MICROPROCESSORS II (2-3-3.0)This course is a continuation of the study of microprocessor programming and interfacing techniques.Corequisite(s): EEM 241
EEM 251 PROGRAMMABLE CONTROLLERS (3-0-3.0)This course is an introduction to programmable control systems with emphasis on basic programming techniques. A variety of input/output devices and their applications are covered. EEM 252 PROGRAMMABLE CONTROLLERS APPLICATIONS (1-6-3.0) This course covers the application of programmable controller theories and operation procedures. Topics such as interfacing data manipulation and report generation are covered. Programmable controller projects are constructed, operated, and tested. EEM 275 TECHNICAL TROUBLESHOOTING (3-0-3.0) This course consists of a systematic approach to troubleshooting. Techniques used to analyze proper circuit opera-tion and malfunctions are studied. Corequisite(s): EEM 276 EEM 276 APPLIED TROUBLESHOOTING (1-6-3.0)This course is an application of electronic troubleshooting methods. The student analyzes, troubleshoots, and repairs circuits.
EET 101 BASIC ELECTRONICS (1-3-2.0)This course is a survey of electrical and electronic circuits and measurement methods for non-electronics engineer-ing technology students. Circuits are constructed and tested.
EET 111 DC CIRCUITS (3-3-4.0) This course is a study of resistance, voltage, current, power and energy in series, parallel, and series-parallel circuits using Ohm's Law, Kirchhoff’s Laws, and circuit theorems. Circuits are analyzed using mathematics and verified using electrical instruments. Corequisite(s): MAT 178
EET 112 AC CIRCUITS (3-3-4.0) This course is a study of capacitive and inductive reactance and impedance in series, parallel, and series-parallel circuits. It also includes power, power-factor, resonance and transformers. Circuits are analyzed using mathematics and verified using electrical instruments. Prerequisite(s): EET 111 with a minimum grade of “C.” Corequisite(s): MAT 179 EET 113 ELECTRICAL CIRCUITS I (3-3-4.0) ElectiveThis course is a study of DC and AC covering resistance and impedance in series, parallel and series - parallel circuits using Ohm's Law, Kirchhoff's Laws and basic circuit theorems. Circuits are analyzed using mathematics and verified using electrical instruments.
EET 131 ACTIVE DEVICES (3-3-4.0) This course is a study of semiconductor theory and principles, diodes and diode circuits, transistors, transistor circuits, and other components. Circuits are modeled, constructed, and tested. Corequisite(s): EET 112
EET 141 ELECTRONIC CIRCUITS (3-3-4.0) This course is a study of electronic circuits using discrete and integrated devices, including analysis, construction, testing and troubleshooting. Prerequisite(s): EET 131
EET 145 DIGITAL CIRCUITS (3-3-4.0) This course is a study of number systems, basic logic gates, boolean algebra, logic optimization, flip-flops, counters and registers. Circuits are modeled, constructed, and tested.Corequisite(s): MAT 178
EEM
161
178 179 176 177EET 227 ELECTRICIAL MACHINERY (2-3-3.0)This course is a study of AC and DC electromechanical energy conversion devices, theory, applications and control. Devices are tested and verified using electrical instruments.Prerequisite(s): EET 112
EET 231 INDUSTRIAL ELECTRONICS (3-3-4.0) This course is a survey of topics related to industrial application of electronic devices and circuits. The course covers switches, DC and AC motor controls, sensors and transducers, open and closed loop control circuits and voltage converting interfaces. Circuits are constructed and tested. Prerequisite(s): EET 131
EET 235 PROGRAMMABLE CONTROLLERS (2-3-3.0) This course is a study of relay logic, ladder diagrams, theory of operation, and applications. Loading ladder diagrams, debugging, and troubleshooting techniques are applied to programmable controllers. Prerequisite(s): EET 112
EET 241 ELECTRONIC COMMUNICATION (3-3-4.0) This course is a study of the theory of transmitters and receivers, with an emphasis on the receivers, mixers, IF amplifiers and detectors. Some basic FCC rules and regulations are also covered.Prerequisite(s): EET 131 EET 243 DATA COMMUNICATIONS (2-3-3.0)This course is a study of the techniques for sending and receiving information. Topics include media characteristics, modulation and demodulation, signal conversions, multiplexing and demultiplexing, protocols, industrial standards, networks and error detection, and correction. Circuits are modeled, constructed and tested.Prerequisite(s): EET 145
EET 251 MICROPROCESSOR FUNDAMENTALS (2-6-4.0) This course is a study of binary numbers; microprocessor operation, architecture, instruction sets, and interfacing with operating systems; and applications in control, data acquisition, and data reduction and analysis. Programs are written and tested. Prerequisite(s): EET 145 EET 261 ELECTRONIC TROUBLESHOOTING (1-3-2.0) This course is a study of the systematic techniques for troubleshooting electronic equipment. Logical procedures are emphasized rather than specific circuits. Students are required to troubleshoot and repair selected equipment. Prerequisite(s): EET 241 EET 273 ELECTRONICS SENIOR PROJECT (0-3-1.0)In this course an instructor-approved project is constructed and tested.
EET 274 SELECTED TOPICS IN EET (3-0-3.0) ElectiveThis course is a study of current topics related to EET. Technical aspects of practical applications are discussed.
EGR 101 INTRODUCTION TO ENGINEERING TECHNOLOGY (0-3-1.0) This course is an introduction to computers and reporting formats. EGR 103 PREPARATION FOR ENGINEERING TECHNOLOGY (1-3-2.0)This course covers the opportunities available and basic skills needed for careers in engineering technology. Topics of study include concepts and terminologies used in engineering technology, use of scientific calculators, problem solving techniques and SI system of measurements. Students are introduced to computers and their usage as a tool in engineering technology.
EGR 112 ENGINEERING PROGRAMMING (2-3-3.0) This course covers interactive computing and the basic concepts of programming. Corequisite(s): MAT 102 EGR 124 ENGINEERING SPREADSHEET APPLICATIONS (1-3-2.0)This course includes the use of spreadsheets, software for Data Manipulation, graphing, problem analysis, statisti-cal analysis and hypothesis testing.
EGR
162
EGR 170 ENGINEERING MATERIALS (2-3-3.0) This course is a study of the properties, material behaviors, and applications. Prerequisite(s): Permission of Instructor EGR 175 MANUFACTURING PROCESSES (3-0-3.0) This course includes the processes, alternatives, and operations in the manufacturing environment. EGR 190 STATICS (2-3-3.0) This course is a study of forces and the effect of forces acting on bodies in equilibrium without motion. Prerequisite(s): MAT 178
EGR 194 STATICS AND STRENGTH OF MATERIALS (3-3-4.0) This course covers external and internal forces in structures and/or machines, including conditions of equilibrium, systems of force, moments of inertia and friction. It also covers the stress/strain relationships in materials. Prerequisite(s): MAT 102
EGT 101 BASIC TECHNICAL DRAWING (0-6-2.0) This course covers the basics of drafting, emphasizing line quality, lettering, and basic drafting conventions.
EGT 103 PRINT READING (1-3-2.0))This course is an introduction to basic print reading and interpretation, including layout, projection and dimen-sioning. EGT 104 PRINT READING (3-0-3.0) This course covers the interpretation of industrial drawings.
EGT 105 BASIC CIVIL DRAFTING (0-6-2.0)This course covers residential architectural drafting, structures and site topographical maps.Prerequisite(s): EGT 101 EGT 108 ADVANCED PRINT READING AND SKETCHING (1-3-2.0) This course is a study of the interpretation of complicated drawings. Drafting and sketching techniques are included. Prerequisite(s): EGT 104
EGT 110 ENGINEERING GRAPHICS I (2-6-4.0) This is an introductory course in engineering graphics science which includes beginning drawing techniques and development of skills to produce basic technical drawings. Prerequisite(s): EGT 150
EGT 111 MECHANICAL DRAWING I (0-6-2.0)This course is an introduction to the principles and practices of mechanical drawing.Prerequisite(s): EGT 150
EGT 112 MECHANICAL DRAWING II (0-6-2.0)This course includes topics such as section views, auxiliary views, and threads and fasteners.Prerequisite(s): EGT 111
EGT 115 ENGINEERING GRAPHICS II (2-6-4.0) This course in engineering graphics science includes additional drawing techniques for industrial applications. Prerequisite(s): EGT 110 EGT 125 DESCRIPTIVE GEOMETRY (0-6-2.0) This course is designed to aid in solving drafting problems associated with single or intersecting surfaces which are not necessarily placed in the principal planes in space.
EGR
163
ENG
Prerequisite(s): EGT 115 or AET 111 EGT 150 BASIC CAD (0-6-2.0)This course covers the basics of computer aided drafting, including hardware, software systems, and operating systems and development of skills for creating and plotting simple technical drawings.
EGT 151 INTRODUCTION TO CAD (2-3-3.0) This course covers the operation of a computer aided drafting system. The course includes interaction with a CAD station to produce technical drawings. EGT 155 INTERMEDIATE CAD (1-3-2.0) This course covers advanced computer aided drafting skills, including topics such as creating isometrics and script files and customizing menus, text fonts, and hatch fonts to produce advanced drawings. Prerequisite(s): EGT 150
EGT 210 ENGINEERING GRAPHICS III (2-6-4.0) This advanced course in engineering graphics science covers the production of technical working drawings. Prerequisite(s): EGT 115
EGT 215 MECHANICAL DRAWING APPLICATIONS (3-3-4.0) This advanced drawing course covers industrial applications. Prerequisite(s): EGT 115 EGT 220 STRUCTURAL AND PIPING APPLICATIONS (3-3-4.0) This advanced drawing course covers structural steel and process piping applications. Prerequisite(s): EGT 150
EGT 252 ADVANCED CAD (2-3-3.0)This course covers advanced concepts of CAD software and applications.
ENG 038 DEVELOPMENTAL ENGLISH I (3-0-3.0)Intended for students who need assistance in basic writing. Based on assessment of student needs, instruction in-cluding writing short compositions in which students demonstrate control of mechanics, word usage, and sentence structure. This course emphasizes a review of grammar.
ENG 039 DEVELOPMENTAL ENGLISH II (3-0-3.0)Intended for students who need assistance in basic writing. Based on assessment of student needs, instruction in-cluding writing short compositions in which students demonstrate control of mechanics, word usage, and sentence structure. This course introduces the writing process.Prerequisite(s): ENG 039. ENG 100 INTRODUCTION TO COMPOSITION (3-0-3.0) This course is a study of basic writing and different modes of composition and may include a review of usage. A minimum grade of “C” is required for credit. (Non-degree credit)Prerequisite: Placement.
ENG 100A INTRODUCTION TO COMPOSITION (5-0-3.0) This course is a study of basic writing and different modes of composition and may include a review of usage. A minimum grade of “C” is required for credit. (Non-degree credit)Prerequisite: ENG 039.
ENG 101 ENGLISH COMPOSITION I (3-0-3.0)This is a college course in which the following topics are presented: a study of composition in conjunction with appropriate literary selections, with frequent theme assignments to reinforce effective writing. A review of standard usage and the basic techniques of research are also presented. A minimum grade of “C” is required for credit. Prerequisite(s): ENG 100 or ENG 100A with a minimum grade of “C” or placement.
ENG 102 ENGLISH COMPOSITION I (3-0-3.0)This is a college transfer course in which the following topics are presented: development of writing skills through logical organization, effective style, literary analysis and research. An introduction to literary genre is included.
164
Prerequisite(s): ENG 101 with a minimum grade of “C.”
ENG 150 BASIC COMMUNICATIONS (3-0-3.0)This course develops practical oral and written communication skills (Non-degree credit). A minimum grade of “C” is required in order to take the next course in the sequence.Prerequisite(s): ENG 039.
ENG 160 TECHNICAL COMMUNICATIONS (3-0-3.0) This course is a study of various technical communications such as definitions, processes, instructions, descriptions, and technical reports both written and oral. A minimum grade of “C” is required for progression to ENG 260.Prerequisite(s): ENG 039 or placement. ENG 165 PROFESSIONAL COMMUNICATIONS (3-0-3.0) This course develops practical written and oral professional communication skills. A minimum grade of “C” is required for credit. Prerequisite(s): ENG 039 or placement. ENG 170 BUSINESS COMMUNICATIONS (3-0-3.0) This course presents a comprehensive survey of business English usage and communication skills. A minimum grade of “C” is required for credit.Prerequisite(s): ENG 039 or placement. ENG 175 PROOFREADING AND EDITING (3-0-3.0) This course presents intensive application of advanced proofreading and editing skills, including usage and punctuation.Prerequisite: ENG 170 with a minimum grade of “C.”
ENG 201 AMERICAN LITERATURE I (3-0-3.0) This college transfer course is a study of American literature from the Colonial Period to the Civil War.Prerequisite(s): ENG 102 with a minimum grade of “C.”
ENG 202 AMERICAN LITERATURE II (3-0-3.0) This college transfer course is a study of American literature from the Civil War to the present.Prerequisite(s): ENG 102 with a minimum grade of “C.” ENG 205 ENGLISH LITERATURE I (3-0-3.0) This is a college transfer course in which the following topics are presented: the study of English literature from the Old English Period to the Romantic Period with emphasis on major writers and periods. Prerequisite(s): ENG 102 with a minimum grade of “C.”
ENG 206 ENGLISH LITERATURE II (3-0-3.0) This is a college transfer course in which the following topics are presented: the study of English literature from the Romantic Period to the present with emphasis on major writers and periods.Prerequisite(s): ENG 102 with a minimum grade of “C.”
ENG 208 WORLD LITERATURE I (3-0-3.0) This college transfer course is a study of masterpieces of world literature in translation from the ancient world to the sixteenth century. Prerequisite(s): ENG 102 with a minimum grade of “C.”
ENG 209 WORLD LITERATURE II (3-0-3.0) This college transfer course is a study of masterpieces of world literature in translation from the seventeenth century to the present. Prerequisite(s): ENG 102 with a minimum grade of “C.”
ENG 238 CREATIVE WRITING (3-0-3.0) This college transfer course presents an introduction to creative writing in various genres.
ENG
165
HIS
Prerequisite(s): ENG 102 with a minimum grade of “C.” ENG 260 ADV TECH COMMUNICATIONS (3-0-3.0)This course develops skills in research techniques and increases proficiency in written and oral technical com-munications.Prerequisite(s): ENG 160 or ENG 101 with a minimum grade of “C.”
EVT 201 ENVIRONMENTAL SCIENCE (3-0-3.0) ElectiveAn introduction to the basic principles of environmental science including ecology, energy, resources, waste management, air, water and soil pollution.
EVT 210 INTRODUCTION TO ENVIRONMENTAL LAW (3-0-3.0) ElectiveThis course includes coverage of Federal and State legislation governing consequences of actions that potentially could threaten the environment. FRE 101 ELEMENTARY FRENCH I (3-1-4.0) This college transfer course consists of a study of the four basic language skills: listening, speaking, reading and writing, including an introduction to French culture. FRE 102 ELEMENTARY FRENCH II (3-1-4.0) This college transfer course continues the development of basic language skills and includes a study of French culture. Prerequisite(s): FRE 101
GEO 101 INTRODUCTION TO GEOGRAPHY (3-0-3.0)This course is an introduction to the principles and methods of geographic inquiry. GER 101 ELEMENTARY GERMAN I (3-1-4.0)This college transfer course is a study of the four basic language skills: listening, speaking, reading, and writing. The course will include an introduction to German culture. GER 102 ELEMENTARY GERMAN II (3-1-4.0) This college transfer course continues the development of the four basic language skills and the study of German culture. Prerequisite(s): GER 101 HIS 101 WESTERN CIVILIZATION TO 1689 (3-0-3.0) This college transfer course is a survey of Western Civilization from ancient times to 1689, including the major political, social, economic, and intellectual factors shaping western cultural tradition.
HIS 102 WESTERN CIVILIZATION POST 1689 (3-0-3.0) This college transfer course is a survey of Western Civilization from 1689 to the present, including major political, social, economic, and intellectual factors which shape the modern western world. Prerequisite(s): none HIS 112 NONWESTERN CIVILIZATION (3-0-3.0)This college transfer course is a survey of the major developments and characteristics of nonwestern civilization and cultures in Asia, Africa and the Americas.
HIS 201 AMERICAN HISTORY: DISCOVERY TO 1877 (3-0-3.0) This college transfer course is a survey of U.S. History from discovery to 1877. This course includes political, social, economic, and intellectual developments during this period. HIS 202 AMERICAN HISTORY: 1877 TO PRESENT (3-0-3.0) This college transfer course is a survey of U.S. History from 1877 to the present. This course includes political, social, economic, and intellectual developments during this period. Prerequisite(s): None
166
HOS
HOS 140 THE HOSPITALITY INDUSTRY (3-0-3.0)This course is a survey of the hospitality industry and the principles of operations of both lodging and food service industries.Prerequisite: MGT 101
HOS 150 HOTEL MANAGEMENT (3-0-3.0)This course covers the management of the lodging phase of the hospitality industry, including front office, house-keeping and engineering.Prerequisite: HOS 140
HOS 157 SERVICE TECHNIQUES (2-0-2.0)This course is a study of the various types of personal services required in the hospitality industry.Prerequisite: HOS 140
HOS 166 HOSPITALITY PROMOTION (2-0-2.0)This course is a study of the organization and function of a hospitality sales department, including products, competitors, markets, sales tools, selling techniques and customers.Prerequisite: HOS 140
HOS 255 FOOD SERVICE MANAGEMENT (3-0-3.0)This course is a study of operational food service management. Topics include food service operations, layout and design of restaurants, marketing and sales promotion, and food and beverage procedures.Prerequisite: HOS 140 HRT 101 INTRODUCTION TO HORTICULTURE (3-0-3.0) This course covers the basic principles of horticulture as it relates to commercial production. It includes a survey of the important areas of horticulture, including nursery production and sales, greenhouse operations, landscaping, turf, fruits, and vegetables.
HRT 102 LANDSCAPE DESIGN (3-3-4.0) This course is a study of landscape design principles and the application of landscape drafting techniques and plant selection to produce a finished landscape plan. Prerequisite(s): HRT 105 HRT 104 LANDSCAPE DESIGN & IMPLEMENTATION (3-0-3.0) This course is a study of landscape design and drafting as well as landscape installation techniques. HRT 105 LANDSCAPE PLANT MATERIALS (3-3-4.0) This course is a study of plant materials that are used in the southeastern landscaping and nursery trade. Identifica-tion of plants by common and scientific nomenclature, characteristics, culture, and use are included. HRT 110 PLANT FORM & FUNCTION (3-3-4.0) This course is a study of morphology, anatomy, and physiology of higher plants. Emphasis is on plant structure, functions of plant parts, plant processes, plant growth and development, and plant inheritance. HRT 113 PLANT MATERIALS (3-0-3.0) This course is a study of herbaceous and woody plant materials used in the landscaping and nursery trade.
HRT 117 DESIGN W/HERBACEOUS PLANTS (3-0-3.0) This course is a study of soft-stemmed plant materials. Emphasis is on habit of growth, size, period of bloom, color, and cultural requirements of annuals and perennials. Also provided is an introduction to design principles and landscape drafting.
HRT 121 COMMERCIAL IRRIGATION (3-0-3.0) This course examines the use of irrigation in the landscape industry with emphasis on design, equipment suitability, water application procedures, and construction. Design projects and job bidding are also included.
167
HRT
HRT 125 SOILS (3-3-4.0) This course is a study of soils and plant nutrition. Emphasis is on physical and chemical properties, water, organic matter and life of soils. Materials and methods for supplying nutrients to horticulture plants are also included.
HRT 139 PLANT PROPAGATION (2-3-3.0) This course is a study of the fundamental principles and techniques involved in plant propagation. HRT 141 HORTICULTURE PEST CONTROL (3-3-4.0) This course includes a study of the identification and control of insects, diseases, and weeds that are pests of horticultural plants. HRT 144 PLANT PESTS (3-0-3.0) This course is a study of horticulturally important insects, plant diseases, and weeds. Emphasis is on identifica-tion, prevention, and control.
HRT 153 LANDSCAPE CONSTRUCTION (3-0-3.0)This course covers the requirements and techniques of landscape of wood, concrete and brick structures as well as landscape lighting, water gardening and planting. HRT 154 GROUNDS MAINTENANCE (3-0-3.0) This course covers cost estimation of a landscape design and its maintenance, preparation of contracts, and devel-opment and implementation of maintenance schedules. HRT 205 COMPUTERS IN HORTICULTURE (3-0-3.0) This course explores the use of computers in horticultural operations. Various applications are demonstrated, and hands-on learning activities including data management, advertising and marketing, and design projects are utilized. HRT 223 IRRIGATION (3-3-4.0) This course includes the study and application of the design principles and materials used in horticultural irriga-tion. Prerequisite(s): HRT 102 HRT 230 GREENHOUSE TECHNOLOGY (3-3-4.0) This course is the study of commercial greenhouse production techniques and facility management. Prerequisite(s): HRT 110 and HRT 117 HRT 231 NURSERY TECHNOLOGY (3-3-4.0) This course is a study of wholesale and retail nursery operations. Emphasis is on producing container and field-grown plants and the retail sales of these and other garden products. Prerequisite(s) HRT 105 and HRT 110 HRT 241 TURF MANAGEMENT (3-0-3.0) This course is a study of the identification, use, culture, and maintenance of turf grasses. Emphasis is on the installation and management of turf in residential, commercial, and public areas. HRT 253 LANDSCAPE INSTALLATION (3-3-4.0) This course is a study of the installation of landscapes, including reading plans, planting, and construction of necessary structures. Instruction in various styles of landscape features and the development of cost estimates and bids are included. Prerequisite(s): HRT 102 HRT 256 LANDSCAPE MANAGEMENT (3-3-4.0) This course is a study of proper grounds management procedures. Landscape maintenance tasks, scheduling, estimating, and bidding are included.Prerequisite(s): HRT 105, HRT 125, and HRT 141. HRT 270 SPEC TOPICS IN HORTICULTURE (3-0-3.0)
168
HRT
This course includes special topics in the area of horticulture. Prerequisite(s): Permission of instructor.
HRT 271 HORTICULTURE INTERNSHIP (0-40-8.0) This course includes supervised comprehensive work experience in the horticulture industry. Work in a horticulture related position under supervision of the instructor and employer is required. Prerequisite(s): Must have completed 1 year of horticulture and/or permission of instructor.
HSS 205 TECHNOLOGY AND SOCIETY (3-0-3.0)This course is an investigation of the impact of the 20th century technological changes in America on the indi-vidual, society, and the physical environments. A survey of technological advances from ancient times to present will preface the 20th century focus.
HUC 101 HEALTH UNIT PROCEDURES I (3-0-3.0) This course includes a study of non-nursing hospital procedures as they relate to the coordination of a nursing unit.
HUC 102 HEALTH UNIT PROCEDURES II (3-0-3.0) This course includes a study of health unit procedures. Prerequisite(s): All first semester courses.
HUC 151 CLINICAL PROCEDURES I (0-12-4.0) This course covers practical application in clinical settings of non-nursing hospital procedures as they relate to the coordination of a nursing unit. HUC 152 CLINICAL PROCEDURES II (0-12-4.0)This course includes emphasis on practical application in the clinical setting of health unit procedures. Prerequisite(s): All first semester courses.
IDS 101 HUMAN THOUGHT & LEARNING (3-0-3.0) This course explores the principles, methods, and applications of human thought and learning, including such topics as attention, information processing, problem-solving, hypothesis testing, memory, argumentation, learning theory, and cognitive awareness.
IDS 102 PERSONAL AND CAREER ASSESSMENT (3-0-3.0)This course covers an in-depth examination of personal needs, wants, values, strengths, abilities and interests of the individual. Multiple inventories and evaluation strategies allow the student to evaluate and apply individual data to a personal career choice. IMT 102 INDUSTRIAL SAFETY (2-0-2.0)This course covers safety awareness and practices found in industry. IMT 104 SCHEMATICS (2-0-2.0)This course covers the interpretation of mechanical, fluid power, and/or electrical schematics.
IMT 111 INDUSTRIAL TOOLS (3-6-5.0)This course covers the use of hand and/or power tools.
IMT 112 HAND TOOL OPERATIONS (1-6-3.0) ElectiveThis course covers hand tools, power tools and precision measuring instruments.
IMT 113 POWER TOOL OPERATIONS (1-3-2.0)This course covers the use of power tools and their applications in industrial and service areas.
IMT 120 MECHANICAL INSTALLATIONS (3-6-5.0)This course covers techniques of assembling, rigging and installation and/or maintenance of mechanical equip-ment.
169
ITP
IMT 121 DRIVE SYSTEMS (1-3-2.0)This course covers drive system consisting of belts and pulleys, chains and sprockets, and gear drives used to transmit power. IMT 130 FLUID POWER (2-9-5.0)This course covers the basic principles of hydraulics and pneumatics, including the installation, maintenance, troubleshooting and repair of various systems.
IMT 131 HYDRAULICS & PNEUMATICS (4-0-4.0)This course covers the basic technology and principles of hydraulics and pneumatics. IMT 140 INDUSTRIAL ELECTRICITY (3-6-5.0)This course covers basic electrical fundamentals, including measuring devices, circuitry and controls for industrial circuits. IMT 141 ELECTRICAL CONTROL DEVICES (4-3-5.0) This course covers principles and applications of electrical motor control circuits and the industrial equipment.
IMT 160 PREVENTIVE MAINTENANCE (3-0-3.0)This course covers preventive maintenance techniques. IMT 161 MECHANICAL POWER APPLICATION (1-9-4.0)This course covers mechanical transmission devices, including procedures for installation, removal, and main-tenance. IMT 170 STATISTICAL PROCESS CONTROL (3-0-3.0) This course is a study of the concepts and charts used in quality control. IST 220 DATA COMMUNICATIONS (3-0-3.0) This course is a study of the fundamentals of data communications. Basic signaling, networking, and various transmission media are covered. Prerequisite(s): CPT 114 with a minimum grade of “C.”
IST 245 LOCAL AREA NETWORKS (3-0-3.0)This course is a study of the methods used to interconnect computers, terminals, word processors, facsimile and other office machines within a given area. Examples of vendor implementations are used to illustrate various ap-proaches. Current microcomputer netware software will be used.Prerequisite(s): CPT 178 and CPT 255.
ITP 101 INTRODUCTION TO INTERPRETING (3-0-3.0)This course introduces the profession of interpreting, the role and function of an interpreter, the National Registry of interpreters for the deaf code of ethics and professionalism. The course also introduces the basic theories, principles and practices of interpreting, physical factors, techniques, compensation and certification processes.
ITP 102 AMERICAN SIGN LANGUAGE I (3-3-4.0)This course is designed to expose students to visual readiness and basic vocabulary, grammar feature and non-manual behaviors all focusing on receptive language skill development.
ITP 103 AMERICAN SIGN LANGUAGE II (3-3-4.0)This course is a continuation of ASL 101 designed to expose students to additional vocabulary, grammar features and non-manual behaviors all focusing on conversational skills.Prerequisite: ITP 102 or equivalent skills.
ITP 104 INTERPRETING IN EDUCATIONAL SETTINGS (3-0-3.0)This course will reinforce basic theories and techniques as related to mainstream educational settings K-12 and the community college.Prerequisite(s): ITP 101, 103, 201, 212 or permission of instructor.
170
ITP 106 LINGUISTICS OF AMERICAN SIGN LANGUAGE (3-0-3.0)This course consists of a study of the structure, grammar, and syntax of American Sign Language.Prerequisite(s): American Sign Language I and II or EquivalentCorequisite(s): ITP 101, 103 or permission of instructor.
ITP 107 ADVANCED FINGERSPELLING (0-3-1.0)This is a lab class consisting of in depth practice of receptive and expressive fingerspelling.Prerequisite(s): American Sign Language I and II or equivalent.
ITP 108 AMERICAN SIGN LANGUAGE III (3-3-4.0)This course is a continuation of ASL 102 and covers additional vocabulary, grammar features and non-manual behaviors all focusing on conversational skills.Prerequisite: ITP 103 or equivalent skills.
ITP 109 AMERICAN SIGN LANGUAGE IV (3-3-4.0)This course concentrates on intermediate conversational and discourse skills using American Sign Language. This course is conducted entirely using American Sign Language.Prerequisite: ITP 102, 103, 108 or equivalent skills.
ITP 201 DEAF HISTORY AND CULTURE (3-0-3.0)This course studies the history of deaf education, the deaf community, and attitudinal changes toward languages as they affect deaf culture.
ITP 202 TRANSLITERATING I (3-0-3.0)This course presents the skills required to transmit English into manually coded English and vice versa and intro-duces a variety of manual codes and their relationship to American Sign Language.Corequisite(s): ITP 103 or equivalent.
ITP 203 TRANSLITERATING II (3-0-3.0)This course provides further studies in transmitting English into a manually coded system and vice versa. It also introduces other sign English codes and how they relate to American Sign Language.Prerequisite: ITP 108, 202.
ITP 204 INTERPRETING (3-0-3.0)This course develops accuracy and clarity in expressive interpreting at a speed of 80 to 125 WPM. Role play in actual experiences.Prerequisite: ITP 101, 108, 201 and 212.
ITP 206 SIGN TO VOICE INTERPRETING I (3-0-3.0)This course provides classroom work giving verbatim translations and voicing materials. There is an emphasis on the use of tapes and simulated situations. Vocabulary development, word endings and use of temporary signs are included. The student will learn to translate simultaneously from manual to spoken English and to interpret from ASL into spoken English. In addition, the student will acquire skill in reading and translating the manual alphabet and in interpreting from various forms of manual communication into appropriate English diction.Prerequisite(s): ITP 101, 108 and 201.
ITP 207 SIGN TO VOICE INTERPRETING II (3-0-3.0)This course continues with voicing and translating American Sign Language into verbatim spoken English. Video taping and simulated situations will be incorporated. Prerequisite(s): ITP 101, 108, 201 and 206.
ITP 212 INTERPRETING IN SPECIAL SETTINGS (3-0-3.0)This course will reinforce basic theories and techniques in relation to specialized interpreting settings and con-sumer needs, including the following: Oral, Deaf/Blind, Minimal Language Competency, Telephone, Religious, Performing Arts, Social Service, Medical, Mental Health and Legal.
ITP
171
MAT
ITP 213 ARTISTIC INTERPRETING (3-0-3.0)This course consists of a study of a variety of theatrical situation for interpreting such as music, theater, poetry and literature. Students will participate in artistic productions.Prerequisite(s): ITP 101, 108 or permission of department head.
ITP 230 FIELD EXPERIENCE (0-3-1.0)This course provides practical experience through observation of professional interpreters, attendance at profes-sional workshops and social/cultural events for and with deaf people, and weekly recitations with instructors. Students keep weekly journals.Prerequisite(s): ITP 101 and 102.
ITP 240 INTERPRETING INTERNSHIP (0-9-3.0)This course allows students to gain practical experience assuming the role of a professional interpreter in a struc-tured setting with on-going feedback from a professional interpreter. This course is taken during the student's last semester and with the approval of the department head.
MAT 038 DEVELOPMENTAL MATHEMATICS I (3-0-3.0)Intended for students who need assistance in basic arithmetic skills. Based on assessment of student needs, instruc-tion includes performing the four arithmetic operations with whole numbers, fractions, decimals, percents, and an introduction to measurement, algebraic and geometric concepts. Word problem skills are emphasized. Arithmetic operations are stressed.
MAT 039 DEVELOPMENTAL MATHEMATICS II (3-0-3.0)Intended for students who need assistance in basic arithmetic skills. Based on assessment of student needs, instruc-tion includes performing the four arithmetic operations with whole numbers, fractions, decimals, percents, and an introduction to measurement, algebraic and geometric concepts. Word problem skills are emphasized. Pre-algebra and geometric concepts are stressed.Prerequisite(s): MAT 038
MAT 100 INTRODUCTION COLLEGE MATH (5-0-5.0) This course includes the following topics in an algebraic context: mathematical methods, techniques, ways of thinking, and problem solving. A minimum grade of “C” is required in order to receive credit in this course. (Non-Degree)Prerequisite(s): MAT 039 or placement. MAT 101 BEGINNING ALGEBRA (3-0-3.0) This course includes the following topics: operations with signed numbers; addition, subtraction, multiplication, and division with algebraic expressions; factoring; techniques for solving linear and fractional equations; and an introduction to graphing.Prerequisite(s): MAT 039 or placement. MAT 102 INTERMEDIATE ALGEBRA (3-0-3.0) This course includes the following topics: properties of numbers; fundamental operations with algebraic expres-sions; polynomials; systems of equations; ratio and proportion; factoring; functions; graphs; solutions of linear inequalities; and linear and quadratic equations. Prerequisite(s): MAT 101 with a minimum grade of “C” or placement. MAT 110 COLLEGE ALGEBRA (3-0-3.0) This college transfer course includes the following topics: polynomial, rational, logarithmic, and exponential functions; inequalities; systems of equations and inequalities; matrices; determinants; simple linear programming; solutions of higher degree polynomials; combinatorial algebra, including the binomial theorem; and introduction to probability. Prerequisite(s): MAT 102 with a minimum grade of “C” or placement.
MAT 111 COLLEGE TRIGONOMETRY (3-0-3.0) This college transfer course includes the following topics: circular functions; trigonometric identities; solution of
172
right and oblique triangles; solution of trigonometric equations; polar coordinates; complex numbers, including DeMoivre's’s theorem; vectors; conic sections; sequences; and series. Prerequisite(s): MAT 110 with a minimum grade of “C.”
MAT 120 PROBABILITY & STATISTICS (3-0-3.0)This college transfer course includes the following topics: introductory probability and statistics, including orga-nization of data, sample space concepts, random variables, counting problems, binomial and normal distributions, central limit theorem, confidence intervals, and test hypothesis for large and small samples; types I and II errors; linear regression; and correlation. Prerequisite(s): MAT 101 with a minimum grade of “C.”
MAT 130 ELEMENTARY CALCULUS (3-0-3.0) This college transfer course includes the following topics: differentiation and integration of polynomials; rational, logarithmic, and exponential functions; and interpretation and application of these processes. Prerequisite(s): MAT 110 with a minimum grade of “C.” MAT 140 ANALYTICAL GEOMETRY & CALCULUS I (4-0-4.0) This college transfer course includes the following topics: derivatives and integrals of polynomials; rational, loga-rithmic, exponential, trigonometric, and inverse trigonometric functions; curve sketching; maxima and minima of functions; related rates; work; and analytic geometry. Prerequisite(s): MAT 111 with a minimum grade of “C.”
MAT 141 ANALYTICAL GEOMETRY & CALCULUS II (4-0-4.0) This college transfer course includes the following topics: continuation of calculus of one variable, including analytic geometry, techniques of integration, volumes by integration, and other applications; infinite series, including Taylor series and improper integrals. Prerequisite(s): MAT 140 with a minimum grade of “C.”
MAT 150 FUNDAMENTALS OF MATH (3-0-3.0) This course includes the following topics: elementary number theory; basic algebra and geometry; English and SI measurements; ratio and proportion; statistics; and graph interpretation.Prerequisite(s): MAT 038 or placement. MAT 155 CONTEMPORARY MATHEMATICS (3-0-3.0) This course includes techniques and applications of the following topics: elementary number theory; algebra; geometry; measurement; graph sketching and interpretations; and descriptive statistics. Prerequisite(s): Completion of MAT 039 or placement. MAT 160 MATH FOR BUSINESS & FINANCE (3-0-3.0) This course includes the following topics: commissions, mark-on, depreciation, interest on unpaid balances, compound interest, payroll, taxes, and graphs. Prerequisite(s): Completion of MAT 039 or placement. MAT 165 STATISTICS (3-0-3.0) This course includes the following topics: statistical data, statistical methods, presentation of data, sampling techniques, measures of central tendency, variability, correlation, and probability.
MAT 168 GEOMETRY & TRIGONOMETRY (3-0-3.0) This course includes the following topics: points, lines, angles, and angle measure; triangles; polygons; circles; geometric solids; trigonometric solution of triangles; graph of the sine function; and vectors. Prerequisite(s): MAT 101
MAT 175 ALGEBRA AND TRIGONOMETRY I (3-0-3.0) This course includes the following topics: basic laws and operations of algebra, linear and quadratic equations, systems of equations, introduction to trigonometry and vectors, concepts of functions, and graphs of functions. Prerequisite(s): MAT 102 with a minimum grade of “C” or placement.
MAT 176 ALGEBRA AND TRIGONOMETRY II (3-0-3.0) This course includes the following topics: advanced algebra, exponential and logarithmic functions, complex
MAT
173
numbers, trigonometric identities, and graphs of trigonometric functions. Additional topics may include statistics and discrete mathematics.Prerequisite(s): MAT 175 with a minimum grade of “C” or placement.
MAT 177 CALCULUS (3-0-3.0) This course includes the following topics: differentiation and integration of polynomial and rational functions with applications of these processes. Prerequisite(s): MAT 176 with a minimum grade of “C” or placement. MAT 211 MATH FOR ELEMENTARY EDUCATION I (3-0-3.0) This college transfer course includes the following topics: logic, set theory, properties of and operations on count-ing numbers, integers, rational numbers, and real numbers. Prerequisite(s): MAT 101 with a minimum grade of “C.”Corequisite: MAT 102 MAT 212 MATH FOR ELEMENTARY EDUCATION II (3-0-3.0) This college transfer course includes the following topics: basic algebra, introductory geometry, probability, and statistics. Prerequisite(s): MAT 211 with a minimum grade of “C.” MAT 215 GEOMETRY (3-0-3.0) This college transfer course includes the following topics: Euclidean geometry of points, lines, triangles, circles, and polygons; right triangle trigonometry; and analytical geometry of the straight line. (This course is designed primarily for elementary teachers.)Prerequisite(s): MAT 212 with a minimum grade of “C.”
MAT 240 ANALYTIC GEOMETRY AND CALCULUS III (4-0-4.0)This course includes the following topics: Multivariable calculus including vectors; Partial derivatives and their applications to maximum and minimum problems with and without constraints; Line integrals; Multiple integrals in rectangular and other coordinates; Stokes' and Green's theorems. Prerequisite: MAT 141 with a minimum grade of “C.”
MED 103 MEDICAL ASSISTING INTRODUCTION (3-0-3.0)This course provides an introduction to the profession of medical assisting, including qualifications, duties and the role of the medical assistant.
MED 105 MEDICAL ASSISTING OFFICE SKILLS I (3-6-5.0)This course provides a study of receptionist duties, records maintenance, insurance form processing and office machine use.
MED 106 MEDICAL ASSISTING OFFICE SKILLS II (1-6-3.0)This course introduces the student to machine transcription with emphasis in transcribing medical correspondence, reports and histories. Prerequisite(s): AHS 102, OST 105
MED 107 MEDICAL OFFICE MANAGEMENT (3-3-4.0)This course provides a study of the principles and practices of banking and accounting procedures, billing methods and office management. Prerequisite(s): MED 105
MED 112 MEDICAL ASSISTING PHARMACOLOGY (1-2-3.0)This course provides a study of principles of pharmacology, drug therapy and the administration of medication.Prerequisite(s): AHS 104, MED 103
MED 114 MEDICAL ASSISTING CLINICAL PROCEDURES (2-6-4.0)This course covers examination room techniques, including vital signs, specialty examination, minor surgical techniques and emergency procedures. Prerequisite(s): AHS 104
MED 115 MEDICAL OFFICE LAB PROCEDURES I (3-3-4)This course provides a study of laboratory techniques commonly used in physician's offices and other facilities. Prerequisite(s): AHS 104
MED
174
MED
MED 122 MEDICAL OFFICE LAB PROCEDURES I (2-0-2.0)This course introduces the student to beginning techniques of laboratory procedures commonly performed in a physician’s office and other clinical agencies.
MED 156 CLINICAL EXPERIENCE I (0-18-6.0)This course provides direct experience in a physician's office or other selected medical facilities.Prerequisite(s): MED 103, MED 105, MED 106, MED 112, MED 114 and MED 115
MET 101 BASIC MEASURING PRINCIPLES (0-3-1.0)This course covers the theory and practical application of basic measuring instruments used in a modern inspec-tion (metrology) facility.
MET 211 STRENGTH OF MATERIALS (3-3-4.0) This course covers externally applied forces and internally induced stresses in structural members and machine components. Materials selection and sizing components to meet requirements are included. Prerequisite(s): EGR 190 MET 212 KINEMATICS (2-3-3.0) This course covers mathematical and drafting solutions of problems involving linkage motion and velocities and acceleration of points on common mechanical devices. Prerequisite(s): MAT 178 MET 214 FLUID MECHANICS (2-3-3.0) This course is a study of the physical properties of fluids and includes hydrostatics, buoyancy, flow of incompress-ible fluids, orifices, venturis and nozzles. Prerequisite(s): MAT 178
MET 222 THERMODYNAMICS (3-3-4.0)This course includes the study of the thermodynamics principle of heat, work, non-flow and steady flow processes, and cycles. The use of thermodynamics tables and charts are stressed.Prerequisite(s): PHY 201
MET 224 HYDRAULICS & PNEUMATICS (3-0-3.0) This course covers basic hydraulics and pneumatic principles and circuits. System components such as pumps, compressors, piping, valves, cylinders, fluid motors, accumulators and receivers are discussed. Prerequisite(s): MET 214
MET 231 MACHINE DESIGN (3-3-4.0) This course covers the design and applications of machine elements such as shafts, couplings, springs, brakes, clutches, gears and bearings. It also covers the applications of principles of DC/AC, statics, strength of materials, engineering drawing and dynamics to the design of simple machines. Prerequisite(s): MET 211, EGR 170
MGT 101 PRINCIPLES OF MANAGEMENT (3-0-3.0) This course is a study of management theories, emphasizing the management functions of planning, decision making, organizing, leading, and controlling. The analysis of business operations is also introduced.Corequisite(s): COL 101 MGT 105 SURVEY OF MANAGEMENT (2-0-2.0) This course is a study of the basic principles of management and supervision. The management functions of planning, decision making, organizing, leading, and controlling are stressed. Prerequisite(s): NoneNOTE: This course may not be used as an elective in those programs which require MGT 101.
MGT 150 FUNDAMENTALS OF SUPERVISION (3-0-3.0) This course is a study of supervisory principles and techniques required to effectively manage human resources
175
MLT
in an organization. First-line management is emphasized. Topics to be covered include motivation, planning and staffing, productivity, and the role of management in human relations.Prerequisite(s): MGT 101 with a minimum grade of “C.”
MGT 201 HUMAN RESOURCE MANAGEMENT (3-0-3.0)This course is a study of personnel administration functions within a business organization. Major areas of study include job analysis, recruitment, selection and assessment of personnel; and wage, salary and benefit administra-tion. Labor union relations will also be covered.Prerequisite(s): MGT 101 with a minimum grade of “C.” MGT 205 LABOR RELATIONS (3-0-3.0)This course is a study of unionism, collective bargaining, labor legislation and contemporary labor relations is-sues.
MGT 230 MANAGING INFORMATION RESOURCES (3-0-3.0) This course is a study of the development, use and management of information resources, and systems in busi-ness and industry. Concepts of designing information systems including data flows, sources, storage, retrieval, processing and reporting will be covered. Prerequisite(s): ACC 101, MGT 101 and CPT 101 with a minimum grade of “C.” MKT 101 MARKETING (3-0-3.0) This course covers an introduction to the field of marketing with a detailed study of the marketing concept and the processes of product development, pricing, promotion, and marketing distribution. Other topics will include consumer psychology, research and information systems, advertising and legislative considerations.Corequisite(s): COL 101 MKT 110 RETAILING (3-0-3.0) This course is a study of the importance of retailing in American business and covers the concepts of store loca-tion, layout, merchandising, display, pricing, inventory control, promotional programs and profit management. Demographics as it relates to retailing is also discussed.Prerequisite(s): MKT 101 with a minimum grade of “C.”
MKT 120 SALES PRINCIPLES (3-0-3.0) This course is a study of the personal selling process with special emphasis on determining customer needs and developing effective communications and presentation skills. Prerequisite(s): MKT 101 with a minimum grade of “C.”
MKT 135 CUSTOMER SERVICE TECHNIQUES (3-0-3.0) This course is a study of the techniques and skills required for providing customer service excellence, including illustrations to turn customer relations into high standards of customer service, satisfaction, and repeat sales. Prerequisite(s): MKT 101 with a minimum grade of “C.” MKT 221 SALES STRATEGIES (3-0-3.0) This course is a study of the organization and function of sales management, with emphasis on sales forecasting and the hiring and training of sales personnel. Prerequisite(s): MKT 120 with a minimum grade of “C.” MKT 240 ADVERTISING (3-0-3.0) This course is a study of the role of advertising in the marketing of goods and service, including types of advertis-ing, media, how advertising is created, agency functions, and regulatory aspects of advertising. Also introduced will be display ads, copy and art work preparation, printing, and selection of media.Prerequisite(s): MKT 101 with a minimum grade of “C.”
MLT 105 MEDICAL MICROBIOLOGY (3-3-4.0) This course provides a survey of organisms encountered in the clinical microbiology laboratory, including steril-ization and disinfection techniques.
176
MLT
MLT 108 URINALYSIS AND BODY FLUIDS (2-3-3.0) This course introduces the routine analysis and clinical significance of urine and other body fluids. Prerequisite(s): MLT 130, MLT 115 MLT 110 HEMATOLOGY (3-3-4.0) This course provides a study of the basic principles of hematology, including hemoglobins, hematocrit, white and red counts, and identification of blood cells. Prerequisite(s): MLT 115
MLT 115 IMMUNOLOGY (2-4-3.0)This course provides a study of the immune system, disease states and the basic principles of immunologic test-ing. MLT 120 IMMUNOHEMATOLOGY (3-3-4.0) This course introduces the theory and practice of blood banking, including the ABO, RH and other blood group systems, compatibility testing, and HDN. . Prerequisite(s): MLT 115 MLT 130 CLINICAL CHEMISTRY (3-3-4.0) This course focuses on the study of nutritional, functional and excretional chemicals in blood and body fluids, including testing techniques and clinical significance. MLT 205 ADVANCED MICROBIOLOGY (3-3-4.0) This course provides a detailed study of microorganisms and the currently accepted procedures for identification of these microorganisms in the clinical laboratory. Prerequisite(s): MLT 105, MLT 115 MLT 210 ADVANCED HEMATOLOGY (3-3-4.0) This course provides a study of the diseases of blood cells and other hematologic procedures including coagula-tion. Prerequisite(s): MLT 110, MLT 115 MLT 230 ADVANCED CLINICAL CHEMISTRY (3-3-4.0) This course focuses on advanced theory, principles and instrument techniques used in clinical chemistry. Prerequisite(s): MAT 155, MLT 115, MLT 130
MLT 241 MEDICAL LAB TRANSITION (3-0-3.0)This course correlates laboratory procedures and concepts with emphasis on higher level cognitive applications.Prerequisite(s): All first year MLT courses
MLT 251 CLINICAL EXPERIENCE I (0-15-5.0) This course provides an integrated, clinically-based rotation which correlates cognitive and technical skills in selected areas of the clinical laboratory. Prerequisite(s): All first year MLT courses MLT 252 CLINICAL EXPERIENCE II (0-15-5.0) This course provides an integrated, clinically-based rotation which correlates cognitive and technical skills in selected areas of the clinical laboratory. Prerequisite(s): All first year MLT courses
MLT 253 CLINICAL EXPERIENCE III (0-15-5.0) This course provides an integrated, clinically-based rotation which correlates cognitive and technical skills in selected areas of the clinical laboratory. Prerequisite(s): All first year MLT courses
MLT 254 CLINICAL EXPERIENCE IV (0-15-5.0) This course provides an integrated, clinically-based rotation which correlates cognitive and technical skills in selected areas of the clinical laboratory.
177
MTT
Prerequisite(s): All first year MLT courses
MTT 121 MACHINE TOOL THEORY I (3-0-3.0)This course covers the principles involved in the production of precision metal parts. Corequisite(s): EGT 104 MTT 122 MACHINE TOOL PRACTICE I (0-12-4.0)This course covers practical experiences using the principles in Machine Tool Theory I. Corequisite: MTT 121 MTT 123 MACHINE TOOL THEORY II (3-0-3.0)This course covers the principles involved in machining parts using machine tools, including lathes, mills, drill presses, jig bores, and the attachments for each. Prerequisite(s): MTT 121, 122, EGT 104 MTT 124 MACHINE TOOL PRACTICE II (0-12-4.0)This course covers the practical application of the principles in Machine Tool Theory II. Corequisite(s): MTT 123, EGT 108
MTT 125 MACHINE TOOL THEORY III (3-0-3.0)This course covers the principles involved in the machining, heat treating, and grinding of complex metal parts. Prerequisite(s): MTT 123, MTT 124, EGT 108
MTT 126 MACHINE TOOL PRACTICE III (0-12-4.0) This course covers the practical application of the principles in Machine Tool Theory III. Corequisite(s): MTT 125 MTT 141 METALS & HEAT TREATMENT (3-0-3.0)This course is a study of the properties, characteristics, and heat treatment procedures of metals. MTT 211 DIE THEORY (3-0-3.0)This course is a study of die components as they relate to the complete die. MTT 215 TOOL ROOM MACHINING I (0-12-4.0)This course covers advanced machine tool operations, including an introduction to basic diemaking. Prerequisite(s): MTT 125, MTT 126, MTT 211
MTT 216 TOOL ROOM MACHINING II (0-12-4.0)This course covers advanced machine tool operations, including complex die operations. Prerequisite(s): MTT 215, MTT 211 MTT 241 JIGS AND FIXTURES I (2-0-2.0)This course includes the theory necessary to design working prints of simple jigs and fixtures. Prerequisite(s): MTT 125, MTT 126, EGT 104, EGT 108. MTT 246 PLASTIC MOLDMAKING I (2-0-2.0)This course is an introduction to moldmaking and plastics. Prerequisite(s): EGT 104, EGT 108, MTT 125, MTT 126
MTT 250 PRINCIPLES OF CNC (3-0-3.0)This course is an introduction to the coding used in CNC programming. Prerequisite(s): MTT 121, 122, 123, 124, EGT 104, MAT 101 MTT 253 CNC PROGRAMMING AND OPERATIONS (0-9-3.0) This course is a study of the planning, programming, selecting tooling, determining speeds and feeds, setting up, operating and testing of CNC programs on CNC machines.
178
Prerequisite(s): MTT 250
MTT 254 CNC PROGRAMMING I (0-9-3.0)This course is a study of CNC programming, including machine language and computer assisted programming. Prerequisite(s): MTT 250, MTT 253
MUS 105 MUSIC APPRECIATION (3-0-3.0)This course is an introduction to the study of music with focus on the elements of music and their relationships, the musical characteristics of representative works and composers, common musical forms and genres of various western and non-western historical style periods, and appropriate listening experiences.
OST 105 KEYBOARDING (3-0-3.0) This course focuses on the mastery of keyboarding and formatting principles. Letters and memorandums will be introduced.Corequisite(s): COL 101 OST 110 DOCUMENT FORMATTING (3-0-3.0) This course emphasizes speed, accuracy, and developing document formatting skills using keyboarding competen-cies. Reports, tables, specialized correspondence, and employment documents will be typed.Prerequisite(s): OST 105 with a minimum grade of “C.” OST 112 MEDICAL DOCUMENT FORMATTING (3-0-3.0) This course covers terminology unique to the medical office. Emphasis is on increasing speed, improving accuracy, and developing formatting skills. Prerequisite(s): All first semester courses.
OST 121 MACHINE TRANSCRIPTION (3-0-3.0) This course provides experience in transcribing documents from dictation equipment. Emphasis is placed on development of accuracy, effective listening techniques, and proper punctuation of business documents. Prerequisite(s): OST 105 with a minimum grade of “C.” OST 122 MEDICAL MACHINE TRANSCRIPTION I (3-0-3.0) This course provides experience in transcribing medical documents from dictation equipment. Prerequisite(s):All second semester courses. OST 133 PROFESSIONAL DEVELOPMENT (3-0-3.0)This course emphasizes development of personal and professional skills required as an office worker in areas such as projecting a professional image, job seeking skills, office etquitte, ethics, and time and stress management. Prerequisite(s): None.
OST 141 OFFICE PROCEDURES I (3-0-3.0) This is an introductory course to a variety of office procedures and tasks using business equipment, systems and procedures. Filing and telephone techniques will be included.Prerequis i te(s ) : OST 105 wi th a minimum grade of “C” or current ly enrol led .
OST 143 OFFICE SYSTEMS AND PROCEDURES (3-0-3.0) This course emphasizes procedures and applications used in the office environment. Medical filing systems and telephone techniques will be included.Prerequisite(s): All summer term courses
OST 165 INFORMATION PROCESSING SOFTWARE (3-0-3.0) This course includes applications of information processing software. Emphasis is placed on functions for accept-able document formatting and processing. Microcomputers will be used to complete assigned projects using a popular software package. Prerequisite(s): OST 105 with a minimum grade of “C.”
MUS
179
OST 167 INFORMATION PROCESSING APPLICATIONS (3-0-3.0) This course emphasizes applications and features of information processing software. Microcomputers will be used to complete assigned projects including word processing, spreadsheet and a graphic presentation program.Prerequisite(s): OST 165 with a minimum grade of “C.”
OST 170 NOTETAKING (3-0-3.0)This is an introductory course using the alphabet for rapid notetaking. Dictation and transcription of familiar material are included.Prerequisite(s): OST 105 with a minimum grade of "C." OST 210 DOCUMENT PRODUCTION (3-0-3.0) This course emphasizes the production of documents found in typical business offices. The major focus is on productivity and excellence in document production. A simulation will be completed..Prerequisite(s): OST 110 with a minimum grade of “C.”
OST 212 MEDICAL DOCUMENT PRODUCTION (3-0-3.0) This course covers the production of documents found in medical offices. The major focus is on productivity and excellence in medical document production. Emphasis is placed on diagnostic and therapeutic output.Prerequisite(s): All second semester courses.
OST 222 MEDICAL MACHINE TRANSCRIPTION II (3-0-3.0) This course is designed to develop speed and accuracy in transcribing complex medical terms and documents from dictation equipment. Tapes dictated by physicians who speak with foreign accents are included.Prerequisite(s): All summer term courses.
OST 223 MEDICAL MACHINE TRANSCRIPTION III (3-0-3.0) This course emphasizes the development of speed and accuracy in transcribing a variety of medical documents from physicians’ unedited dictation. Emphasis is placed on transcribing tapes with background noises and dictated by physicians with foreign accents.Prerequisite(s): AHS 118, OST 143, OST 167, OST 222 OST 251 ADMINISTRATIVE SYSTEMS AND PROCEDURES (3-0-3.0) This course covers processing information in the electronic office. Emphasis is on increasing proficiency in per-forming a variety of office tasks. A simulation will be completed.Prerequisite(s): OST 141 with a minimum grade of “C.”
OST 252 MEDICAL SYSTEMS AND PROCEDURES (3-0-3.0) This course emphasizes development of proficiency in integrating skills commonly performed in medical offices. Microcomputers and electronic typewriters will be used to complete a medical simulation.Prerequisite(s): AHS 118, OST 143, OST 167, OST 222
OST 272 SCWE IN OFFICE SYSTEMS (0-18-6.0)This course integrates office skills within an approved work site related to office systems.Prerequisite(s): AHS 118, OST 143, OST 167, OST 222
PHI 101 INTRODUCTION TO PHILOSOPHY (3-0-3.0) This course includes a topical survey of the three main branches of philosophy - epistemology, metaphysics, and ethics-and the contemporary questions related to these fields. Discussions of eastern views, continental philosophy and science are also included. PHM 115 DRUG CLASSIFICATIONS I (2-0-2.0)This course covers an introduction of pharmacologic classification of drugs, including generic and brand names, and a survey of actions and reactions of the major pharmacologic groups, including routes of administration and dosage forms.
PHS
180
PHS 101 PHYSICAL SCIENCE I (3-3-4.0) This college transfer course is the first of a sequence of courses in physical science and includes an introduction to science with emphasis on science terminology and investigations of the physical world. Topics are selected from astronomy, chemistry, geology and physics. Corequisite(s): MAT 102
PHY 201 PHYSICS I (3-3-4.0) This is the first in a sequence of physics courses. Topics include mechanics, wave motion, sound, heat, electro-magnetism, optics, and modern physics. Corequisite: MAT 175 with a minimum grade of “C.” Prerequisite(s): MAT 110 and Corequisite: MAT 11
PHY 202 PHYSICS II (3-3-4.0) This course covers physics topics, including mechanics, wave motion, sound, heat, electromagnetism, optics, and modern physics. Prerequisite(s): PHY 201 PHY 221 UNIVERSITY PHYSICS I (3-3-4.0) This is the first of a sequence of college transfer courses. The course includes a calculus based treatment of the following topics: vectors, laws of motion, rotation, vibratory and wave motion. Prerequisite(s): MAT 140 or MAT 177
PHY 222 UNIVERSITY PHYSICS II (3-3-4.0) This college transfer course is a continuation of calculus based treatment of the following topics: thermodynamics, kinetic theory of gases, electricity and magnetism, including electrostatics, dielectrics, electric circuits, magnetic fields and induction phenomena. Prerequisite(s): PHY 221
PNR 110 FUNDAMENTALS OF NURSING (3-6-5.0) This course provides an introduction to basic principles and beginning skills necessary to the nursing process. Concepts are integrated relating to physiological and psychosocial needs of the individual. Legal and ethical roles of the practical nurse are emphasized. PNR 112 NUTRITION (2-0-2.0) This course is a study of the nutritional needs of the individual throughout the life cycle. The basic elements of nutrition, the function of the nutrients in the body, and selected therapeutic diets are presented in the course. Prerequisite(s): PNR 110, PNR 120, AHS 104, PNR 122, MAT 155
PNR 120 MEDICAL/SURGICAL NURSING I (3-6-5.0) This course is a beginning study utilizing the nursing process. Concepts include physiological, psychosocial, nutritional, and health and safety needs of the adult. Clinical experiences address selected commonly occurring health problems having predictable outcomes. PNR 122 PHARMACOLOGY (2-2-3.0) This is an introductory course to the concepts of pharmacology and medication administration. Emphasis is on calculation of dosages, administration of medications, and correct use of abbreviations. Effects of specific drugs are presented.Corequisite(s): PNR 110, PNR 120 PNR 130 MEDICAL/SURGICAL NURSING II (3-6-5.0) This course is a continuation of the study of the nursing process. Concepts include the physiological, psychosocial, nutritional and health and safety needs of the adult. Clinical experiences address selected commonly occurring health problems having predictable outcomes. Prerequisite(s): PNR 110, PNR 120, AHS 104, PNR 122, MAT 155 PNR 140 MEDICAL/SURGICAL NURSING III (3-6-5.0)
PHY
181
This course is a continuation of the study of the nursing process. Concepts include physiological, psychosocial, nutritional, and health and safety needs of the adult. Clinical experiences address selected commonly occurring health problems having predictable outcomes. Prerequisite(s): PNR 110, PNR 120, AHS 104, PNR 122, MAT 155
PNR 150 MATERNAL AND INFANT NURSING (2-6-4.0) This course is a study utilizing the nursing process to meet the needs of the childbearing family. Clinical experiences address the care of the healthy mother from conception through postpartum and the care of the normal newborn. Prerequisite(s): PNR 130, PNR 140, PNR 112, PNR 170
PNR 160 NURSING OF CHILDREN (2-6-4.0) This course is a study utilizing the nursing process as it relates to the care of the children. Clinical experiences address the care of children with commonly occurring illnesses. Concepts of growth and development, pharmacol-ogy, nutrition and mental health are integrated. Prerequisite(s): PNR 130, PNR 140, PNR 112, PNR 170
PNR 170 NURSING OF THE OLDER ADULT (1-3-2.0) This course is a study utilizing the nursing process. Concepts include physiological, psychosocial, nutritional, and health and safety needs of the older patient. Clinical experiences address selected commonly occurring health problems having predictable outcomes. Prerequisite(s): PNR 110, PNR 120, AHS 104, PNR 122, MAT 155
PNR 181 SPECIAL TOPICS IN PRACTICAL NURSING (1-0-1.0) This course covers special topics in Practical Nursing. Prerequisite(s): PNR 130, PNR 140, PNR 112, PNR 170
PSC 201 AMERICAN GOVERNMENT (3-0-3.0) This college transfer course is a study of national governmental institutions with emphasis on the Constitution, the functions of the executive, legislative and judicial branches, civil liberties and the role of the electorate. PSY 103 HUMAN RELATIONS (3-0-3.0) This course is a study of human relations, including the dynamics of behavior, interrelationships, and personality as applied in everyday life. The course is a study of the technical and the administrative systems including orga-nization design, technology, job redesign and enrichment, leadership and appraising performance. Other topics deal with work problems and behavioral effectiveness, including communicating, managing change and using organizational development interventions. Classes stimulate students to think practically and to resolve human relations problems.
PSY 201 GENERAL PSYCHOLOGY (3-0-3.0) This college transfer course includes the following topics and concepts in the science of behavior: scientific method, biological basis for behavior, perception, motivation, learning, memory, development, personality, abnormal behavior, therapeutic techniques, and social psychology. A critical thinking approach fosters student curiosity, stimulates thought and encourages the application of psychological principles in solving problems and analyzing situations. PSY 203 HUMAN GROWTH AND DEVELOPMENT (3-0-3.0) This college transfer course is a study of the physical, cognitive and social factors affecting human growth, de-velopment, and potential. Prerequisite(s): PSY 201
PSY 214 PSYCHOLOGY OF THE EXCEPTIONAL CHILD (3-0-0)This course is a study of the growth, development and training of exceptional children, including children with disabilities and the gifted.Prerequisite(s): PSY 201
QAT 232 STATISTICAL QUALITY CONTROL (3-0-3.0) This course covers quality control in industry, constructing frequency distributions, statistical concepts applied to charts and fundamentals of sampling plans. Prerequisite(s): MAT 120
RAD
182
RAD
RAD 101 INTRODUCTION TO RADIOGRAPHY (2-0-2.0) This course provides an introduction to radiologic technology with emphasis on orientation to the radiology depart-ment, ethics and basic radiation protection.
RAD 105 RADIOGRAPHIC ANATOMY (3-3-4.0) This course includes the study of the structures of the human body and the normal function of its systems. Special emphasis is placed on radiographic anatomy. Corequisite(s): Rad 130 RAD 110 RADIOGRAPHIC IMAGING I (2-3-3.0) This course provides a detailed study of the parameters controlling radiation quality and quantity for radiographic tube operation and image production. Prerequisite(s): AHS 110, RAD 101, RAD 152
RAD 115 RADIOGRAPHIC IMAGING II (2-3-3.0) This course continues a detailed study of primary and secondary influencing factors and accessory equipment related to imaging. Prerequisite(s): MAT 155, RAD 105, RAD 110, RAD 165
RAD 121 RADIOGRAPHIC PHYSICS (3-3-4.0) This course introduces the principles of radiographic physics, incorporating theory and application of basic prin-ciples underlying the operation and maintenance of X-ray equipment. Prerequisite(s): MAT 155, RAD 115, RAD 230, RAD 257 RAD 130 RADIOGRAPHIC PROCEDURES I (2-3-3.0) This course provides an introduction to radiographic procedures. Positioning of the chest, abdomen and extremi-ties are included. Prerequisite(s): RAD 101, RAD 152, AHS 110Corequisite(s): RAD 105 RAD 136 RADIOGRAPHIC PROCEDURES II (2-3-3.0) This course is a study of radiographic procedures for visualization of the structures of the body. Prerequisite(s): MAT 155, RAD 105, RAD 110, RAD 130, RAD 165
RAD 152 APPLIED RADIOGRAPHY I (1-3-2.0) This course introduces the clinical environment of the hospital by providing basic use of radiographic equipment and routine radiographic procedures. RAD 165 APPLIED RADIOGRAPHY II (0-15-5.0) This course includes the use of radiographic equipment and performance of radiographic procedures within the clinical environment of the hospital. Prerequisite(s): RAD 152, RAD 101, AHS 110 RAD 176 APPLIED RADIOGRAPHY III (0-18-6.0)This course includes clinical education needed for building competence in performing radiographic procedures within the clinical environment. Prerequisite(s): MAT 155, RAD 105, RAD 110, RAD 130, RAD 165
RAD 201 RADIATION BIOLOGY (2-0-2.0) This course is a study of the principles of radiobiology and protection. It emphasizes procedures that keep radia-tion exposure to patients, personnel, and the population at large to a minimum. Prerequisite(s): RAD 121, RAD 268, RAD 282 RAD 205 RADIOGRAPHIC PATHOLOGY (2-0-2.0) This course provides a survey of disease processes significant to the Radiographer, including etiology, diagnosis, prognosis, and treatment. Prerequisite(s): RAD 105, RAD 110, RAD 130, RAD 165
183
RES
RAD 220 SELECTED IMAGING TOPICS (1-6-3.0) This course is a study of advanced topics unique to the radiological sciences. Prerequisite(s): RAD 115, RAD 121, RAD 201, RAD 205, RAD 230, RAD 278, RAD 283 RAD 230 RADIOGRAPHIC PROCEDURES III (2-3-3.0) This course is a study of special radiographic procedures. Prerequisite(s): RAD 115, RAD 136, RAD 176, RAD 205
RAD 257 ADVANCED RADIOGRAPHY I (0-21-7.0) This course includes independently performing routine procedures in a radiology department, including involve-ment in advanced radiographic procedures. Prerequisite(s): RAD 115, RAD 136, RAD 176, RAD 205 RAD 268 ADVANCED RADIOGRAPHY II (0-24-8.0) This course includes routine radiographic examinations, as well as advanced procedures, while continuing to build self-confidence in the clinical atmosphere. Prerequisite(s): RAD 230, RAD 257 RAD 278 ADVANCED RADIOGRAPHY III (0-24-8.0) This course includes routine and advanced radiographic procedures in the clinical environment. Prerequisite(s): RAD 121, RAD 268, RAD 282 RAD 282 IMAGING PRACTICUM (1-3-2.0) This clinical course provides an opportunity for exploration of career opportunities in radiology and advanced imaging modalities. Prerequisite(s): RAD 230, RAD 257 RAD 283 IMAGING PRACTICUM (1-6-3.0) This clinical course provides an opportunity for exploration of career opportunities in radiology and advanced imaging modalities. Prerequisite(s): RAD 121, RAD 230, RAD 268, RAD 282
RDG 038 DEVELOPMENTAL READING I (3-0-3.0)Intended for students who need improvement in basic reading skills. Based on assessment of student needs, instruc-tion includes vocabulary, comprehension, use of reference materials, and an introduction to analysis of literature. This course emphasizes basic vocabulary and comprehension skills.
RDG 039 DEVELOPMENTAL READING II (3-0-3.0)Intended for students who need improvement in basic reading skills. Based on assessment of student needs, instruc-tion includes vocabulary, comprehension, use of reference materials, and an introduction to analysis of literature. This course emphasizes more advanced vocabulary and comprehension skills as well as an introduction to reference materials and analysis of literature.Prerequisite(s): RDG 038 or placement.
RDG 100 CRITICAL READING (3-0-3.0) This course covers the application of basic reading skills to improve critical comprehension and higher order think-ing skills. A grade of "C" or better is required in order to receive credit in this course. (Non-Degree)Prerequisite(s): RDG 039 or placement.
RES 101 INTRODUCTION TO RESPIRATORY CARE (3-0-3.0) This course includes introduction topics pertinent to entering the respiratory care profession, i.e., medical terminol-ogy, ethical issues, and legal issues.
RES 105 BASIC RESPIRATORY DRUGS (1-3-2.0)This course introduces pharmacologic classification of drugs utilized in the care of patients with respiratory illnesses. A survey of actions and reactions of each drug, including routes of administration and dosage is included.
184
RES
RES 106 RESPIRATORY CARE ANATOMY (2-3-3.0)This course includes a survey of human anatomy and physiology, with special emphasis placed on the cardiopul-monary system.
RES 111 PATHOPHYSIOLOGY (1-3-2.0) This course is a study of the general principles and analyses of normal and diseased states. Prerequisite(s): RES 141, RES 152 RES 121 RESPIRATORY SKILLS I (3-3-4.0) This course includes a study of basic respiratory therapy procedures and their administration. RES 123 CARDIOPULMONARY PHYSIOLOGY (3-0-3.0) This course covers cardiopulmonary physiology and related systems. Prerequisite(s): Completion of all diploma program courses RES 131 RESPIRATORY SKILLS II (3-3-4.0) This course is a study of selected respiratory care procedures and applications. Prerequisite(s): MAT 155, RES 101, RES 105, RES 106, RES 121 RES 141 RESPIRATORY SKILLS III (2-3-3.0) This course covers mechanical ventilation systems and associated monitors. Prerequisite(s): AHS 111, RES 131, RES 151 RES 142 BASIC PEDIATRIC CARE (1-3-2.0) This course includes an introduction to basic pediatric and neonatal respiratory care. Prerequisite(s): RES 141, RES 152
RES 151 CLINICAL APPLICATIONS I (0-15-5.0) This course covers the fundamental respiratory care procedures in the hospital setting. Prerequisite(s): MAT 155, RES 101, RES 105, RES 106, RES 121
RES 152 CLINICAL APPLICATIONS II (0-9-3.0) This course includes practice of respiratory care procedures in the hospital setting. Prerequisite(s): AHS 111, RES 131, RES 151
RES 204 NEONATAL/PEDIATRIC CARE (3-0-3.0) This course focuses on cardiopulmonary physiology, pathology, and management of the newborn and pediatric patient. Prerequisite(s): Completion of all diploma program courses RES 232 RESPIRATORY THERAPEUTICS (2-0-2.0) This course is a study of specialty areas in respiratory care, including rehabilitation. Prerequisite(s): RES 141, RES 152
RES 244 ADVANCED RESPIRATORY SKILLS I (3-3-4.0) This course includes an in-depth study of mechanical ventilation and considerations for management of the criti-cal care patient. Prerequisite(s): Completion of all diploma program courses RES 245 ADVANCED RESPIRATORY SKILLS II (1-3-2.0) This course includes an in-depth study of pulmonary function and other considerations for pulmonary patients. Prerequisite(s): RES 123, RES 204, RES 244, RES 275 RES 246 RESPIRATORY PHARMACOLOGY (1-3-2.0) This course includes a study of pharmacologic agents used in cardiopulmonary care. Prerequisite(s): RES 123, RES 204, RES 244, RES 275
185
SUR
RES 255 CLINICAL PRACTICE (0-15-5.0) This course includes clinical training with emphasis on intensive care. Prerequisite(s): RES 141, RES 152 RES 275 ADVANCED CLINICAL PRACTICE (0-15-5.0) This course includes clinical practice in advanced patient care procedures.Prerequisite(s): Completion of all diploma program courses
RES 276 ADVANCED CLINICAL APPLICATIONS II (0-18-6.0)This course provides practice of advanced patient care procedures.Prerequisite: RES 123, RES 204, RES 244, RES 275 SOC 101 INTRODUCTION TO SOCIOLOGY (3-0-3.0) This college transfer course emphasizes the fundamental concepts and principles of sociology, including culture, socialization, interaction, social groups and stratification, effects of population growth and technology in society, and social institutions.
SOC 220 SOCIOLOGY OF THE FAMILY (3-0-3.0)This college transfer course includes an application of theory and research related to family behaviors, roles and values with emphasis on understanding family problems.Prerequisite(s): SOC 101 SPA 101 ELEMENTARY SPANISH I (3-1-4.0) This college transfer course is a study of the four basic language skills: listening, speaking, reading, and writing, including an introduction to the Spanish culture. SPA 102 ELEMENTARY SPANISH II (3-1-4.0) This college transfer course continues development of the basic language skills and the study of the Spanish culture. Prerequisite(s): SPA 101
SPC 205 PUBLIC SPEAKING (3-0-3.0) This college transfer course is an introduction to principles of public speaking with application of speaking skills.
SUR 101 INTRODUCTION TO SURGICAL TECHNOLOGY (4-3-5.0) This course includes a study of the surgical environment, team concepts, aseptic technique, hospital organization, basic instrumentation and supplies, sterilization, principles of infection control, and wound healing. SUR 102 APPLIED SURGICAL TECHNOLOGY (2-9-5.0) This course covers the principles and application of aseptic technique, the perioperative role, and medical/legal aspects. SUR 103 SURGICAL PROCEDURES I (2-6 -4.0) This course is a study of a system to system approach to surgical procedures and relates regional anatomy, pa-thology, specialty equipment, and team responsibility. Patient safety, medical/legal aspects, and drugs used in surgery are emphasized. Prerequisite(s): SUR 101, SUR 102, SUR 108 SUR 104 SURGICAL PROCEDURES II (4-0-4.0) This course is a study of the various specialties of surgical procedures. Prerequisite(s): SUR 103, SUR 109, SUR 110 SUR 108 SURGICAL ANATOMY I (3-0-3.0) This course includes the study of the structures of the human body and the normal function of its generalized systems. Special emphasis is placed on surgical anatomy.
186
SUR
SUR 109 SURGICAL ANATOMY II (3-0-3.0) This course includes the study of the structures of the human body and the normal function of its specialized systems. Special emphasis is placed on surgical anatomy. Prerequisite(s): SUR 101, SUR 102, SUR 108 SUR 110 INTRODUCTION TO SURGICAL PRACTICUM (0-15-5.0) This course is an introduction to the application of surgical technique by assisting in the perioperative roles in various clinical affiliations. Prerequisite(s): SUR 101, SUR 102, SUR 108 SUR 113 ADVANCED SURGICAL PRACTICUM (0-18-6.0) This course includes a supervised progression of surgical team responsibilities and duties of the perioperative role in various clinical affiliations. Prerequisite(s): SUR 103, SUR 109, SUR 110
SUR 120 SURGICAL SEMINAR (2-0-2.0) This course includes the comprehensive correlation of theory and practice in the perioperative role. Prerequisite(s): SUR 103, SUR 109, SUR 110
TEX 101 FUNDAMENTALS OF TEXTILES (3-0-3.0) This course covers the fundamentals of textiles, including nomenclature of machinery and processes from opening through finished product. Emphasis is placed on description and formation of polymers, fibers, yarns and fabrics; dyeing, finishing, chemistry and physics of textile fibers and polymers; and testing and marketing of products. TEX 111 TEXTILE PROCESS-FIBER/SPIN (1-3-2.0) This course is a survey of machinery and processes of textile manufacturing from fiber formation through the spinning operation. This course will also include a study of available technology in the areas of weaving, dyeing, printing, finishing and garment manufacturing. Workplace interpersonal and problem solving skills will be emphasized. TEX 115 MANAGEMENT SAFETY (3-0-3.0) This course is a study of the managerial safety fundamentals and the relationship to the economics of accident prevention. Promotion of safe practices include mechanical safeguards, fire preventive housekeeping, occupational devices, first aid, safety organization protection equipment, and the analysis of accident causes.
TEX 121 TEXTILE ENGINEERING (3-3-4.0) This course involves the application of time study, standard data development and formula construction, work sampling principles, and studies. The history and techniques of analyzing, and then measuring and applying normal time values to textile operations to develop a “questioning attitude” are also studied.
TEX 201 TEXTILE MANUFACTURING (4-0-4.0) This course is an outline of the manufacturing process, including basic raw materials and the physical and chemical properties of synthetic and natural fibers. The handling of both staple and filament type synthetic fibers in blends with other synthetic fibers or with natural fibers is covered. TEX 202 TEXTILE TECHNOLOGY (4-0-4.0) This course is a study of the fabric formation techniques and is designed to explore the principles and theories of modern technology, including evaluation and analysis of weaving, knitting and nonwoven fabrication of textile structures. WLD 102 INTRODUCTION TO WELDING (1-3-2.0)This course covers the principles of welding, cutting, and basic procedures for safety in using welding equip-ment.
WLD 103 PRINT READING I (1-0-1.0) This is a basic course which includes the fundamentals of print reading, the meaning of lines, views, dimensions, notes, specifications, and structural shapes. Welding symbols and assembly drawings as used in fabrication work are also covered. WLD 105 PRINT READING II (1-0-1.0)
187
This course includes print reading, including welding symbols and their applications to pipe fabrication. Basic sketching of piping symbols, single line and double line pipe drawings, material estimating, template layout and how templates are used in pipe layouts are included. Prerequisite(s): WLD 103
WLD 106 GAS AND ARC WELDING (2-6-4.0)This course covers the basic principles and practices of oxyacetylene welding, cutting, and electric arc welding. Emphasis is placed on practice in fundamental position welding and safety procedures. WLD 113 ARC WELDING II (2-6-4.0)This course is a study of arc welding of ferrous and/or nonferrous metals. WLD 115 ARC WELDING III (2-6-4.0)This course covers the techniques used in preparation for structural plate testing according to appropriate stan-dards. WLD 117 SPECIALIZED ARC WELDING (2-6-4.0)This course covers arc welding processes for industrial purposes.
WLD 132 INERT GAS WELDING FERROUS (2-6-4.0) This course covers set up and adjustment of equipment and fundamental techniques for welding ferrous metals.
WLD 136 ADVANCED INERT GAS WELDING (0-6-2.0) This course covers the techniques for all positions of welding ferrous and nonferrous metals.
WLD 154 PIPE FITTING & WELDING (3-3-4.0)This is a basic course in fitting and welding pipe joints, either ferrous or nonferrous, using standard processes.
WLD
188
Course Descriptions
Notes
189
Facu
lty a
nd S
taff
Listi
ng
190
Faculty and Staff Listing
ABRAMS, MARGARET W., Writing Center Director/Instructor, Transitional Studies (B.A., English, St. Andrews Presbyterian College; M.A.T., Education, Northwestern University) ADAIR, A. JUDY, Administrative Specialist, Health Sciences Division ALEXANDER, CYNTHIA J., Department Head, Health Sciences Certificate, Multiskilled Technology (R.N.; B.S.N., Berea College, Kentucky) ANDERSON-HUCKS, CHERYL M., Associate Director of Marketing, Development Office (B.A., Journalism and Mass Communications, University of South Carolina) BACKMAN, JON M., Instructor, Accounting (B.B.A., Evangel College; M.B.A., Southwest Missouri State University) BARBER, DAVID W., Trades Specialist, Physical Plant BAUSS, CELIA N., Job Training Partnership Act (JTPA), Counselor (B.A., Sociology/Eng-lish, Clemson University) BEACH, KATHY C., Payroll Technician, Human Resources BELLWOOD, SHARON F., Director of Student Disabilities Services, Student Services (B.A., Religion, B.S., Sociology, Presbyterian College) BENSON, BARRY C., Program Director, IBT/Continuing Education (B.A., English/Sociol-ogy, Wofford College) BERNOCK, CHRISTINE E., Instructor, Radiologic Technology (R.T.(R)(QM); A.A.S., Radiologic Technology, Spartanburg Technical College; B.A., Psychology, University of Michigan) BHATTI, AMJAD M., Instructor, Chemistry (B.S., Physical Sciences, Panjab University, Chandigarh, India; M.S., Organic Chemistry, Punjabi University, Patiala, India; Ph.D., Chemistry, Punjabi University, Patiala, India) BISHOP, LISA D., Advertising and Public Relations Coordinator, Development Office (B.A., Journalism and Mass Communications, University of South Carolina) BLACKWELL, JO ANN, Administrative Specialist, Development Office BOURGEOIS, JACK R., Director of Research (B.A., Business, Furman University; M.B.A., Clemson University) BOYTER, SANDRA L., Instructor, Transitional Studies (B.S., Physical Education, Lander College; M.Ed., Secondary Education - Mathematics, Converse College) BRACKETT, DOUGLAS C., Job Training Partnership Act (JTPA) Coordinator (B.A., Social Science, Allen University; M.Ed., Education, University of South Carolina) BRANNEY, KELLIE JO, Instructor, Practical Nursing (B.S.N., University of South Carolina - Spartanburg; M.N., University of South Carolina)
BRANNON, JEAN T., Program Director, IBT/Continuing Education (B.A., Sociology,
191
Faculty and Staff Listing
Winthrop College) BRIDGES, ROBIN M., Media Specialist, Distance Learning BRYANT, KATHY G., Administrative Specialist, Health Sciences Division BUCHANAN, DONNA I., Program Director, Medical Assisting, (A.A.S., Applied Science, Western Piedmont Community College) BULMAN, THOMAS F., Director of Physical Plant BURROUGHS, DONNA M., Accounting Technician, Business Office BYRD, FRIEDA E., Instructor, Medical Laboratory Technology (Registered Medical Tech-nologist; B.A., Biology, Converse College) CAMP, TERRI L., Computer Training Specialist, IBT/Continuing Education CANN, J. ALISON, Job Training Partnership Act (JTPA), Counselor (B.S., Psychology, Presbyterian College; M.Ed., Special Education, Converse College) CANNON, J. BRUCE, Software Support Technician, Information Technologies (A.A.S., Electronics Engineering Technology, Spartanburg Technical College) CANNON, DOROTHY H., Administrative Specialist, Information Technologies CANTRELL, AMY P., Accounting Technician, Business Office (B.S., Accounting, Clemson University) CANTRELL, JO ELLEN, Director, Planning and Development (B.S., Business Administra-tion, Winthrop College; M.B.A., Clemson and Furman Universities) CANTRELL, LAURA J., Student Aid/Veterans Specialist, Student Financial Aid CASE, S. JAYNE, Instructor, Practical Nursing (B.S.N., University of South Carolina) CASH, BETTY S., Instructor, Transitional Studies (B.S., Secondary Education, University of South Carolina - Spartanburg) CASH, KELLIE B., Administrative Specialist, Industrial & Engineering Technologies Divi-sion CHAMPION, CYNTHIA K., Accounting Technician, Business Office CHASTAIN, SUSAN H., Human Resources/Payroll Technician, Human Resources CLARKSON, MARILYN M., Instructor, Transitional Studies (B.A., English/French, Win-throp College; M.A., English, University of Tennessee) CLEMENTS, MARLENE C., Administrative Specialist, Transitional Studies and Arts &
192
Faculty and Staff Listing
Sciences Divisions COCHRAN, ROBIN R., Administrative Assistant, Business Affairs COCHRUM, LOU, Instructor, Machine Tool Technology (Experience: Industry, 11 Years; Teaching, 10 Years) COFFER, JAY T., Instructor, Industrial Electronics Technology/Automated Manufacturing Technology (A.A.S., Industrial Electronics Technology; A.O.T., Vocational Technical Educa-tion, Spartanburg Technical College; Experience: Industry, 5 Years; Teaching, 9 Years) COHEN, SHIRLEY G., Administrative Specialist, Business Division COLEY, JUDY C., Administrative Specialist, Student Services COLLINS, JENNIFER, Administrative Specialist, IBT/Continuing Education CRAWFORD, DIANNE D., Administrative Specialist, Special Schools CROCKER, SUSAN H., Human Resources Specialist, Human Resources DALE, LYNN F., Department Head, Business Administration (A.A.S., Accounting, Spar-tanburg Technical College; B.G.S., University of South Carolina; M.B.A., Clemson Univer-sity) DANIEL, SALLY P., Administrative Assistant to the President DANIELS, BARBARA M., Telecommunications Operator, Administrative Services DAUGHERTY, SHANNON, Computer Technician, Information Technologies (A.A.S., Computer Electronics Technology, Greenville Technical College) DAVIS, RUTH F., Instructor and Clinical Coordinator, Medical Laboratory Technology (Registered Medical Technologist; B.S., Medical Technology; B.S.Ed., Biology and Social Studies, Western Carolina University) DICKERSON, AMELIA H., Department Head, Medical Laboratory Technology (Regis-tered Medical Technologist; B.S., Biology, Limestone College; M.H.S., Health Sciences, Medical University of South Carolina) DILL, VICKIE L., Instructor, Transitional Studies (B.A., English, Limestone College; M.Ed., Reading, University of South Carolina) DILLARD, JOHN W., Instructor, Industrial Electronics Technology (B.S.E.E., University of South Carolina; M.S.E.E., Stephens Institute of Technology; Industry: 30 Years; Teaching: 5 Years) DILLENBECK, BRUCE L., Instructor - History/Government (B.A., American Studies/History, University of South Florida; M.A., American History, University of South Florida; Ph.D., History, Florida State University) DIVVER, W. THOMAS, Instructor - Physics/Mathematics (B.S., Physics, Wofford College; M.S., Physics, University of Georgia; Ed.D., Curriculum and Instruction, University of
193
Faculty and Staff Listing
South Carolina) DRAKE, PHYLLIS G., Department Head, English Composition, Literature & Speech (B.A., Elementary Education, Limestone College; M.A.T., English, Converse College) DUNCAN, CYNTHIA B., Administrative Specialist, Student Services (A.A.S., Marketing, Spartanburg Technical College; B.S., Marketing, Limestone College) DUNN, DAVID K., Computer Training Specialist, IBT/Continuing Education (B.S., Busi-ness Administration, University of South Carolina) DURHAM, KATHY F., Administrative Assistant to the President (A.A.S., Secretarial Sci-ence, Rockingham Community College; Certified Professional Secretary) EAKER, REGINA J., Director of Human Resources (B.S., Management, Limestone College) EDWARDS, NANCY C., Administrative Specialist, Student Services (A.A.S., Office Sys-tems Technology, Spartanburg Technical College) EDWARDS, NATALIA F., Instructor, Medical Secretary/Health Unit Coordinating (Certifi-cate, Ward Secretary, Spartanburg Technical College) ELLIS, C. LINDA, Administrative Specialist, Student Services FAULKNER, RANDALL K. Registrar (B.A., Psychology/Sociology; M. Ed., Personnel Services, Clemson University)
FAULKNER, STEVEN W., Dean, Business Division (B.S., Industrial Engineering, Clemson University; M.Ed., Secondary Education - Mathematics, Converse College) FLOYD, ROBERT, Instructor, Welding (Certificate, Diesel Mechanics, Greenville Technical College; Certificate, Plumber-Steamfitter, United States Department of Labor; Experience: Industry, 17 Years; Teaching, 3 Years) FOSTER, FELICIA C., Administrative Specialist, Auxiliary Services (Diploma, Automated Office, Spartanburg Technical College) FOWLER, ANGELA P., Administrative Specialist, Student Financial Aid (A.A.S., Office Systems Technology, Spartanburg Technical College) GALLEN, PETE C., Director of Information Technologies (B.S., Computer Science/Sys-tems Analysis, Appalachian State University) GARMROTH, NANCY T., Director, Student Financial Aid (M.B.A., Winthrop University; B.S., Business Administration, Francis Marion University) GARRETT, SHEILA O., Dean, Arts and Sciences Division (B.A., English, Winthrop Col-lege; M.Ed., Secondary Education, English, University of South Carolina) GILES, HENRY C., Jr., Senior Vice President, Business Affairs (B.A., Mathematics, Wofford College; M.A.T., Mathematics, Converse College)
194
Faculty and Staff Listing
GILLIAM, ELIZABETH L., Administrative Specialist, Career Planning & Placement GLENN, BETTY J., Records Technician, Information Technologies (Diploma, Data Process-ing Operations, Spartanburg Technical College) GOFORTH, HERBERT F., Instructor, Heating, Ventilation & Air Conditioning (Diploma, Climate Control Technology; A.A.S., General Technology; A.O.T., Vocational Technical Education, Spartanburg Technical College; Experience: Indus-try, 1 Year; Teaching, 9 Years) GOSSETT, CAROLYN B., Assistant Director of Financial Aid (B.S., Business Administra-tion/Management Science, Limestone College) GOWAN, NANCY C., Accounting Technician, Business Office GRAHAM, SUSAN A., Vice President for Academic Affairs (B.S., Dietetics/Biology & Chemistry, Western Michigan University; M.P.H., Health Administration, University of North Carolina - Chapel Hill; Ph.D., Educational Administration, University of South Carolina) GRAY, VICKIE, Library Assistant GREEN, MARGARET, Library Director (B.A., History/International Affairs, University of North Carolina - Greensboro; M.S., Library Science, Simmons College) GREGORY, SHEILA K., Administrative Specialist, IBT/Continuing Education (A.A.S., Of-fice Systems Technology, Spartanburg Technical College) GRIZZLE, JIM M., Master Craftsman, Physical Plant GUERRANT, JAMES W., Instructor, Mathematics (B.S., Education; M.S., Education, North-ern State University) HAGAN, PAM V., Director of Admissions and Counseling (B.S., Psychology, College of Charleston; M.Ed., Secondary School Guidance/Counseling, University of South Carolina; National Certified Counselor) HALL, BOBBIE U., Success Network Counselor (B.S., Psychology, Lander College; M.Ed., Guidance/Counseling, Clemson University) HATCHELL, STEPHANIE S., Administrative Specialist, Curriculum Development (B.A., English/Education, Converse College; M.A., English Literature, University of South Caro-lina) HAYES, LINDA E., Department Head, Practical Nursing/Health Unit Coordinating/Medical Secretary/Medial Assisting (B.S., Nursing, University of South Carolina - Spar-tanburg; M.N., University of South Carolina) HENDERSON, DEBBIE R., Administrative Assistant, Student Services HENDRICKSON, JANIS R., Learning Disabilities Specialist/Tutor Coordinator, Success Network (B.A., History/Education, Mars Hill
195
Faculty and Staff Listing
College; M.A., Education, Furman University) HENSLEY, BOYCE B., Department Head, Computer Technology (B.S., Business Education and Computer Science, Gardner-Webb College; M.A., Business and Economics, Appala-chian State University) HERREN, FRED P., Dean, Industry and Business Training/Continuing Education (B.S., Physical Education, R.T. Chattanooga; M.Ed., Secondary Education, U.T. Chattanooga) HOBSON, CHRISTY D., Community Liaison, President’s Office (B.A., Speech Communi-cation, University of North Carolina - Chapel Hill)
HOOKER, CAROLYN W., Instructor, English (M.A., English, University of South Carolina; B.S., Education, University of South Carolina) HOWARD, J. TIM, Counselor/Special Projects Coordinator (B.S., Psychology; M.Ed., Stu-dent Personnel Services, University of South Carolina; National Certified Counselor) HOWER, FLOYD V., Associate Director of Grants Development (B.S., Agriculture, Rutgers University; M.A., Counseling, Ball State University; Ph.D., Higher Education, Michigan State University) HUNT, JEFF H., Department Head, Ford ASSET (A.A.S., Industrial/Auto Technology, Tri-County Technical College; B.S., Industrial Education, Clemson University; Experience: Industry, 8 Years; Teaching, 12 Years) HUNT, LADELLE L., Instructor, Commercial Graphics (B.S., Education, Georgia Southern University; Experience: Industry, 4 Years; Teaching, 5 Years) ISENHOWER, ROBERT W., JR., Dean, Transitional Studies (B.A., Economics; M.Ed., Guid-ance and Counseling, University of North Carolina, Chapel Hill; M.Ed., Secondary Educa-tion - Mathematics, Converse College) JACKSON, SUSAN B., Instructor, English (B.A., English, Converse College; M.Ed., Eng-lish, Converse College) JACOBS, JENNIFER L., Counselor, Women’s Center (B.S., Social Work, Florida State Uni-versity) JAMES, ALFREDA C., Data/User Coordinator, Information Technologies (A.A.S., Com-puter Technology, Spartanburg Technical College) JENNINGS, DEBORAH B., Instructor, Radiologic Technology (R.T.(R); B.S., Radiologic Technology, Medical University of South Carolina) JENNINGS, STEPHEN L., Department Head, Heating, Ventilation, and Air Conditioning Technology (Diploma, Air Conditioning/Refrigeration; A.O.T., Vocational Technical Edu-cation, Spartanburg Technical College; Experience: Industry, 10 Years; Teaching, 19 Years) JONES, BOBBY E., Department Head, Textile Management Technology (B.S., Textiles, North Carolina State University)
196
Faculty and Staff Listing
JONES, SHARON, Instructor, Industrial Electronics Technology (A.S., Electrical Engi-neering Technology, Spartanburg Technical College; B.S., Health and Physical Education, Western Carolina University; Experience: Industry, 11 Years; Teaching, 3 Years) KEESLER, GREGORY D., Computer Programmer, Information Technologies (B.A., Ger-man, Furman University; A.A.S., Computer Programming, Spartanburg Technical College) KERR, F. ANDRE, Public Safety Officer (A.A., Criminal Justice, Spartanburg Methodist College; SLED Certified Level III Security Instructor) KERR, LESLIE M., Recruiter, Student Services (B.A., Interdisciplinary Studies, University of South Carolina) KINION, ROBBIE D., Instructor, Ford ASSET (Certificate, Maintenance Technology, Green-ville Technical College; A.A.S., Occupational Technology, Spartanburg Technical College; Experience: Industry, 20 Years; Teaching, 9 Years) KISER, DOROTHY A., Department Head, Radiologic Technology/Respiratory Care (R.T.(R)(QM(M); Lima Memorial School of Radiologic Technologists; A.A.S., Radiologic Technology, Spartanburg Technical College; B.S., Interdisciplinary Studies, University of South Carolina; M.H.S., Health Sciences, Medical University of South Carolina) KNIGHT, CYNTHIA B., Media Consultant, Distance Learning (A.A.S., Marketing, Spartanburg Technical College) LAKE, WILLIE H., Instructor, Office Systems Technology (B.S., Business Administration, South Carolina State College) LAMBRIGHT, THOMAS D., Instructor, Machine Tool Technology (Diploma, Machine Shop; A.O.T., Vocational Technical Education, Spartanburg Technical College; Experience: Industry, 10 Years; Teaching, 16 Years) LASHLEY, EDWIN R., Instructor, Engineering Graphics Technology (B.A., Architecture, Clemson University; Registered Architect) LATHAM, DOUGLAS E., Instructor, Civil Engineering Technology (B.S., Civil Engineer-ing, Clemson University; Registered Professional Engineer) LIGON, REBA C., Administrative Specialist, IBT/Continuing Education LISTER, CYNTHIA L., Women’s Center Director (B.A., Journalism/English; M.Ed., Com-munity and Occupational Programs in Education, University of South Carolina) LOCKE, KATHY E., Instructor, Office Systems Technology (B.S., Business Education, California State University - Long Beach; M.S. Business Administration, California State Polytechnic University - Pomona) MAHAFFEY, KATHRYN E., Instructor, Transitional Studies (A.S., Greenville Technical College; B.S., Business Administration, University of South Carolina - Spartanburg; M.Ed., Secondary Education - Mathematics, Converse College) MARTIN, PEGGY, Administrative Specialist, Physical Plant
197
Faculty and Staff Listing
MATHIS, GEORGE E., Instructor, Industrial Electronics Technology (A.O.T., Vocational Technical Education, Spartanburg Technical College; Experience: Industry, 16 Years; Teaching, 25 Years) MAYNARD, BETSY F., Instructor, Transitional Studies (B.S., Mathematics Education, Uni-versity of South Carolina; MAT, Mathematics, University of South Carolina) MCABEE, DOUGLAS L., Instructor, Horticulture (A.A.S., Horticulture, Spartanburg Tech-nical College; B.A. Horticulture/AG Education, Clemson University) MCBRIDE, TIMOTHY R., Instructor, Mathematics (B.A., Math, Wofford College; M.S., Math, Clemson University) MCCLAIN, HAROLD D., Dean of Student Services (B.A., Sociology, Claflin College; M.Ed., Personnel Services, Clemson University) MCDUFFIE, TANIA M., Instructor, Mathematics (B.A., Economics, Converse College; M.Ed., Math, Converse College) MCKINNEY, JAMES S., Department Head, Civil and Electronics Engineering Technolo-gies (B.S., Civil Engineering, Clemson University; M.Ed., Community and Occupational Programs in Education; Professional Development Initiative Certificate, Higher Education Leadership; Ed.S., Higher Education Administration, University of South Carolina; Regis-tered Professional Engineer) MCKINZIE, KATHY, Director of Career Planning and Placement (B.A., English/History, Murray State University, M.A., Education, Tusculum College) MEADOWS, CASSANDRA L., Director of Auxiliary Services (B.S., Business Management, University of South Carolina) METCALF, PATRICIA C., Library Assistant METZ, WENDY L., Continuing Education Training Specialist, Evening College (B.B.A., Management, Freed-Hardeman College) MILLER, GLENN L., Master Craftsman, Physical Plant NEALE, GEORGE D., Instructor, Electronics Engineering Technology (B.S., Engineering Technology; M.S., Materials Engineering, Clemson University; Registered Professional Engineer) O’SHIELDS, LARRY K., Instructor, Industrial Electronics Technology (A.A.S., Computer Programming, Cecil’s Business College; A.A.S., Industrial Electronics Technology, A.O.T., Vocational Technical Education, Spartanburg Technical College; Experience: Industry, 6 Years; Teaching, 16 Years) OWENS, SARA J., Administrative Specialist, IBT/Continuing Education (B.A., Elementary Education, University of South Carolina - Spartanburg) OWINGS, CARROLL H., Instructor, Machine Tool Technology (Diploma, Machine Tool Technology, A.O.T., Vocational Technical Education, Spartanburg Technical College; Expe-
198
Faculty and Staff Listing
rience: Industry, 3 Years; Teaching, 22 Years) PAINTER, JAMES W., Department Head, Horticulture (B.S., Agriculture Education, Clem-son University; M.S., Horticulture, Clemson University) PARHAM, SAVTRI A., Printing Specialist, Distance Learning PARRIS, GINA C., Counselor/Student Activities Coordinator (B.A., Guidance & Coun-seling/Psychology, Limestone College; M.A.Ed., School Counseling, Western Carolina University) PAYNE, KATHERINE J., Administrative Specialist, Student Services (Diploma, Technical Secretary; A.A.S., Degree, Secretarial Science; A.A.S., Management, Spartanburg Technical College) PELLATT, ROSE F., Administrative Assistant, Development Office (A.A.S., Business Administration, Isothermal Community College; B.S., Interdisciplinary Studies, Univer-sity of South Carolina - Spartanburg; M.P.A., Public Administration, University of South Carolina) PERRY, L. FAYE, Administrative Specialist, Arts & Sciences Division PETROSKI, W. JIM, Department Head, Industrial Maintenance Mechanics/Nuclear Ser-vice Technology (A.S., E.E.T., SpartanburgTechnical College; B.S., Industrial Management, Michigan State University; M.S., Industrial Management, Central Michigan University; Experience: Industry, 4 Years; Teaching, 18 Years) PINKER, PATSY D., Computer Technician, Information Technologies POSS, SUSAN H., Instructor, Mathematics (B.A., Religion/Math, Wake Forest University; M.Ed., Math, Clemson University) POWELL, BILLY L., Director of Administrative Services POWELL, SANDRA W., Instructor, Biology (A.B., Educational Science, Duke University; M.A.T., Biology, Converse College; M.Ed., Elementary Education, Converse College) POWELL-BAKER, ANDRENA, Program Director, IBT/Continuing Education (B.S., Busi-ness/Office Administration, Winthrop College) RAVAN, KAREN W., Instructor, Computer Technology (A.A.S., Computer Programming, Spartanburg Technical College; B.S.N., M.B.A., Clemson University) REEDER, WILLIAM A., Department Head, Welding (Certified Welding Certificate, Purdue University; A.O.T., Vocational Technical Education, Spartanburg Technical College; Experi-ence: Industry, 19 Years; Teaching, 9 Years) REID, TINA S., Manager of Computer Services (A.A., Business Management, Spartanburg Technical College; B.S., Computer Science, University of South Carolina - Spartanburg) REIHL, JENNIFER B., Administrative Specialist, Human Resources (A.A.S., Business, Spartanburg Methodist College)
199
Faculty and Staff Listing
RHODES, STEVEN, Computer Programmer, Information Technologies (A.A.S., Account-ing, Spartanburg Technical College; B.S., Geology; B.S., Computer Science, University of South Carolina) RICHARDS, JOE A., Instructor, Welding (Diploma, Welding, Spartanburg Technical Col-lege; A.O.T., Vocational Technical Education, Spartanburg Technical College; Experience: Industry, 13 Years; Teaching, 7 Years) RICHARDS, MARTY G., Director of Foundation (B.A., Government, Wofford College; M.A., Political Science, Ohio State University) RICHARDSON, ANN, Instructor, Surgical Technology (Diploma, Surgical Technology, A.O.T., Vocational Education, Spartanburg Technical College; B.S., Management of Human Resources, Southern Wesleyan University) RICHARDSON, DARLENE M., Instructor, Psychology/IDS (B.A., Psychology, Winthrop College; M.Ed., Educational Administration/Psychology, University of South Carolina) ROGERS, EMILY W., Department Head, Surgical Technology (R.N.; A.S.T.N., University of South Carolina - Spartanburg; B.S., Management of Human Resources, Southern Wesleyan University; Certified Surgical Technologist; Certified Operating Room Nurse) ROGERS, PAMELA T., Instructor, Math (B.S. Ed., Mathematics, Western Carolina Univer-sity; M.A. Ed., Mathematics, Western Carolina University) ROGERS, PHYLLIS T., Counselor/Pre-Health & Health Sciences Coordinator (B.A., Sociol-ogy, Winthrop College; M.Ed., Personnel Services, Clemson University) ROSEVEARE, MARK A., Technical Services Librarian (B.A., English/History; M.A., Li-brary & Information Science, University of South Carolina) SANTANIELLO, JOSEPH A., Program Coordinator, Electronics Engineering Technology (B.E.E., Manhattan College; M.S.E.E., Syracuse University) SCHENCK, MARCIA L., Department Head, Systems Support Technician (B.S., Applied Science, Miami University of Ohio; M.B.A., Clemson University) SHAW, CHARLES W., Department Head, Machine Tool Technology (A.A.S., Tool and Die, Florence-Darlington Technical College; A.O.T., Vocational Technical Education, Spartan-burg Technical College; Experience: Industry, 4 Years; Teaching, 25 Years) SHEALY, ANDREW W., Trades Specialist, Physical Plant SHEALY, ROBERT, Instructor, Anatomy and Physiology (B.S., Biology, Clemson Univer-sity; M.S., Zoology, Clemson University; Ph.D., Auburn University) SHEARER, ANN H., Public Services Librarian (B.A., History, Presbyterian College; M.A., Library and Information Science, University of South Carolina) SIEG, JUDY K., Instructor, English (B.A., English, Converse College; M.Ed., Gifted Ed/Humanities, Converse College)
200
Faculty and Staff Listing
SIGMON, KEMP I., Dean, Industrial & Engineering Technologies Division (B.S., Industrial Arts; M.A., Industrial Arts; Ed.S., Higher Education, Appalachian State University) SILTZER, RONALD A., Instructor, Economics/Government (B.A., Economics, Wofford College; M.A.T., Social Sciences, Converse College) SIMPSON, CARL L., Supply Specialist, Auxiliary Services SLAPAK, FRANCES A., Instructor, Mathematics (B.A., English/Math, Bradley University; M.A.T., Math, Winthrop University) SMITH, EVA M., Instructor, Management (B.A., Government, Wofford College) SMITH, MARILYN J., Administrative Specialist, Job Training Partnership Act SMITH, MYRA H., Director of Finance (A.A.S., Business Administration, Spartanburg Technical College) SMITH, NANCY B. (Bunny), Instructor, Practical Nursing (A.D.N., Nursing; B.S.N., Uni-versity of South Carolina) SPLAWN, JAMES W., Instructor, Respiratory Care (B.S., Science, Bob Jones University; A.A.S., Respiratory Therapy, Greenville Technical College) STEED, TAMI A., Administrative Specialist, Administrative Services
STOKEM, ROBERT J., Instructor, Speech, (B.A., Rhetoric & Communication, M.A., Com-munication, University of New York - Albany) STOKLEY, SUE E., Department Head, Math & Sciences (B.S., Mathematics, Longwood College; M.S., Mathematics, Radford University; Ed.D., Curriculum and Instruction, Uni-versity of South Carolina) STONE, JAMES L., Equipment Inventory Specialist, Administrative Services STONE, PETER L., Instructor, Marketing (B.S., Business Administration/Management, Baptist College at Charleston; M.B.A., Clemson University) STRICKLAND, DONNA S., Administrative Specialist, Student Services SUTTLES, BARBARA C., Accounting Technician, Business Office (A.A.S., Accounting, Spartanburg Technical College) TERHUNE, DAN L., President (B.S., Mathematics, Defiance College; Master’s of Educa-tion, Wright State University; Ed.D., Higher Education Administration, University of Florida) THARPE, BRENDA W., Assistant Department Head, Office Systems Technology (B.A., Commerce, Limestone College) THOMPSON, JO ELLA, Administrative Specialist, Success Network (Diploma, Automat-ed Office; A.A.S., Office Systems Technology; Certificate, Word Processing, Spartanburg
201
Faculty and Staff Listing
Technical College) TOWERY, RONALD D., Department Head, Industrial Electronics Technology/Automated Manufacturing Technology (A.A.S., Industrial Electronics, A.O.T., Vocational Technical Education, Spartanburg Technical College; B.S., Human Resources, Central Wesleyan Col-lege; Experience: Industry, 7 Years; Teaching, 13 Years) TURNER, PAUL E., Instructor, Industrial Maintenance Mechanics (A.A.S., Mechanical En-gineering Technology, Spartanburg Technical College; Journeyman Millwright, Edinboro State College, University of Pittsburgh; Experience: Industry, 20 Years; Teaching, 6 Years) VAUGHN, SHERRILL H., Dean, Health Sciences Division (R.N.; B.S.N, Clemson Univer-sity; M.N., University of South Carolina) VAUGHN, STEVEN L., Manager of Systems Services (B.A., Business Administration, Ohio University) VICK, MELANIE M., Success Network Coordinator (B.A., Secondary Education; M.Ed., Student Personnel Services, University of South Carolina) VOELKER, PATRICIA H., Department Head, Early Childhood Development (B.S., Recre-ation and Psychology, North Carolina State University; M.Ed., Early Childhood Education, University of South Carolina) WALKER, LYNN H., Department Head, Dental Assisting (A.A., Liberal Arts, Spartanburg Methodist College; B.S., Management of Human Resources, Southern Weslyan Univer-sity; Dental Assisting, University of North Carolina; Certified Dental Assistant; Certified Dental Practice Management Assistant) WARNER, SUSAN M., Director of Media and Distance Learning (B.A., International Studies, Virginia Wesleyan College; M.S., Instructional Technology, Rochester Institute of Technology) WATTS, JOHN R., Department Head, Mechanical Engineering Technology and Engineer-ing Graphics Technology (B.S., Mechanical Engineering, Clemson University) WEBB, R. FAYE, Continuing Education Training Specialist, IBT/Continuing Education (B.S., Management of Human Resources, Southern Wesleyan University) WEBSTER, KENNETH B., Instructor, Engineering Graphics Technology (B.S., Biology, Pennsylvania State College; B.S., Industrial Management, University of Pennsylvania) WEEKS, RITA B., Instructor, English (B.S., English, Illinois State University; M.S., Library & Information Studies, Florida State University) WEST, JUNE M., Instructor, Systems Support Technician (B.S., Information Processing Sys-tems, University of Cincinnati; M.B.A., Clemson University) WILBURN, REGINALD F., Coordinator of Recruiting Services (B.A., Business Administra-tion, Furman University) WILLIAMS, DAVID K., Department Head, Social Sciences (B.A., Psychology, Clemson
202
Faculty and Staff Listing
University; M.A., School Psychology, University of South Carolina) WILSON, BARBARA J., Administrative Assistant, Academic Affairs (Diploma, Technical Secretary; A.A.S., Secretarial Science, Spartanburg Technical College) WILSON, KATHY L., Administrative Specialist, Auxiliary Services (A.A.S., Accounting, Spartanburg Technical College) WILSON, TED B., Director, Occupational Development and Evening College (B.A., Eng-lish, Clemson University; M.Ed., University of South Carolina)
WINKLER, SANDRA J., Director of Curriculum Development (B.S., Economics and Busi-ness; M.A., Student Personnel, Appalachian State University)
203
Inde
x
204
Index
Academics ...................................................................................................................................................... 43-50 Academic Calendar ..........................................................................................................................2 Academic Standards of Progress........................................................................................44-45 Accounting Lab ........................................................................................................................29-30 Add/Drop Period ............................................................................................................................ 45 Advising ............................................................................................................................................ 44 Auditing a Course .......................................................................................................................... 45 Awarding Multiple Degree, Diploma, Certificate ............................................................... 45 Class Attendance .....................................................................................................................45-46 Course Overload ............................................................................................................................ 46 Dean's List ........................................................................................................................................ 46 Exemption Policy .....................................................................................................................46-47 Grades ..........................................................................................................................................47-48 Graduation Ceremony ................................................................................................................. 48 Graduation Policy .......................................................................................................................... 48 Math Lab .....................................................................................................................................29-30 Release of Student Information................................................................................................ 28 Satisfactory Academic Progress .........................................................................................35-36 Semester System............................................................................................................................ 48 Sources of Finanicial Aid ............................................................................................................. 37 Testing Lab .................................................................................................................................29-30 Transferring Credits .................................................................................................................17-18 Transient Students ........................................................................................................................ 24 Transitional Studies ............................................................................................................ 7, 48-49 Tutorial Learning Center .......................................................................................................29-30 -Writing Lab, Math Lab, Accounting Lab, Testing Lab Withdrawal from the College .................................................................................................... 49 Writing Lab .................................................................................................................................29-30Accreditations .............................................................................................................................................7Admission Information ...................................................................................................................15-24 Admission of Special Applicants .............................................................................................. 22 Admissions Policies ....................................................................................................................... 16 Admissions Procedures .........................................................................................................16-18 Early Admission .............................................................................................................................. 22 Foreign Students, Admissions ................................................................................................... 24 G-E-D ............................................................................................................................................16-17 Health Sciences Technology ................................................................................................22-23 Orientation ....................................................................................................................................... 24 Re-admission ................................................................................................................................... 23 Skills Assessment ........................................................................................................................... 17
205
Index
Special Admission Procedures ............................................................................................22-24 Student Status ................................................................................................................................ 17 Technical Scholars ......................................................................................................................... 38 Transfer in Public Two Year Institutions ...........................................................................18-21 Transfer Students ........................................................................................................................... 24Application Deadline ............................................................................................................................................ 16 Financial Aid ..............................................................................................................................37-39Continuing Education/IBT ...............................................................................................................7, 12 Community Interest ...................................................................................................................... 12 Contract Training ........................................................................................................................... 12 Occupational Advancement ...................................................................................................... 12 Job Training Partnership Act ..................................................................................................... 13Course Descriptions ...................................................................................................................145-188Curriculum Programs ....................................................................................................................51-144 Accounting ............................................................................................................................ 5, 61-62 Advanced Child Care Management Program ........................................................... 6, 82-83 Air Conditioning and Refrigeration .................................................................................. 6, 126 Architectural Computer Aided Drafting ......................................................................... 6, 111 Associate Degree in Agricultural Technology .......................................................... 5, 56-57 Associate Degree in Arts .................................................................................................. 5, 53-54 Associate Degree in Business Technology .......................................5, 61-62, 66-78, 93-94 Associate Degree in Computer Technology .............................................................. 5, 66-67 Associate Degree in Engineering Technology......................................................5, 106-117 Associate Degree in Health Sciences ......................................................... 5, 90-92, 102-106 Associate Degree in Industrial Technology ... 5, 112-123, 127-128, 130-132, 133-137 Associate Degree in Occupational Technology ...................................................5, 130-132 Associate Degree in Public Service ....................................................................................... 5, 55-56 Associate Degree in Science ........................................................................................... 5, 53-55 Automated Office ............................................................................................................... 6, 63-64 Automotive Technology (Ford ASSET) ....................................................................5, 127-128 Basic Electronics ..............................................................................................................6, 128-129 Civil Engineering Technology .....................................................................................5, 112-113 Computer Numerical Control Operator ..................................................................6, 128-129 Computer Technology ...................................................................................................... 5, 66-67 Dental Assisting................................................................................................................... 6, 83-85 Early Childhood Development (certificate)............................................................... 6, 85-87 Early Childhood Development (diploma) .................................................................. 6, 85-86 Electronics Engineering Technology .......................................................................5, 114-115 Engineering Graphics Technology - Architectural Drafting ............................5, 116-117 Engineering Graphics Technology - Mechanical Drafting ...............................5, 118-119 General Engineering Technology .............................................................................5, 120-121
206
Index
General Technology .......................................................................................................6, 130-132 Graphic Preparation Technology ..............................................................................6, 132-133 Health Sciences (certificate) ........................................................................................... 6, 87-88 Health Unit Coordinating ................................................................................................ 6, 88-89 Heating, Ventilation and Air Conditioning Technology ....................................5, 133-134 Horticulture Technology .................................................................................................. 5, 56-57 Industrial Electronics Technology - Automated Manufacturing ...................5, 136-137 Industrial Electronics Technology .............................................................................5, 134-136 Industrial Mechanics ..............................................................................................................6, 137-138 Interpreter Training ............................................................................................................ 5, 55-56 Landscape Management ........................................................................................................6, 58 Machine Tool Technology ............................................................................................5, 139-140 Management - Fire Service Elective ............................................................................. 5, 68-69 Management - Hospitality Elective .............................................................................. 5, 69-71 Management - Marketing Elective ............................................................................... 5, 71-72 Management - Information Technology Elective ................................................... 5, 73-74 Management - Textile Management Elective ........................................................... 5, 75-76 Mechanical Computer Aided Drafting ............................................................................ 6, 123 Mechanical Engineering Technology ......................................................................5, 121-123 Medical Assisting ................................................................................................................ 6, 89-90 Medical Laboratory Technology .................................................................................... 5, 90-92 Multi-Skilled Health Technology ................................................................................... 6, 90-92 Office Systems Technology ............................................................................................. 5, 76-78 Office Systems Technology - Medical Option ........................................................... 5, 93-94 Practical Nursing ................................................................................................................. 6, 94-95 Pre-Dental Hygiene ............................................................................................................ 6, 96-97 Pre-Health Information Management ........................................................................ 6, 97-99 Pre-Occupational Therapy Assistant ..........................................................................6, 99-100 Pre-Physical Therapist Assistant ................................................................................6, 100-102 Printing Technology ............................................................................................................... 6, 141 Radiologic Technology .................................................................................................5, 102-104 Respiratory Care ..............................................................................................................5, 104-106 System Support Technician ............................................................................................. 6, 64-65 Surgical Technology ...............................................................................................................6, 106-108 University Transfer ...................................................................................................................53-55 Welding (certificate) ......................................................................................................6, 142-143 Welding (diploma) ..........................................................................................................6, 142-143Degrees Listed (by Divisions) ............................................................................................................5-6 Arts and Sciences .....................................................................................................................51-58 Business Technology ..............................................................................................................59-78 Health Sciences Technology .......................................................................................................79-108 Industrial and Engineering Technologies ..................................................................109-144
207
Index
Transitional Studies ............................................................................................................ 7, 48-49Engineering Technology ...........................................................................................................110-124Faculty and Staff Listing ............................................................................................................189-202Financial Information ......................................................................................................................31-42 College Costs ................................................................................................................................... 32 Fees and Expenses ........................................................................................................................ 32 Financial Aid Eligibility ................................................................................................................. 34 Financial Assistance ...................................................................................................................... 34 Financial Need, Determination ................................................................................................. 34 How to Pay .................................................................................................................................33-39 Overpayment .................................................................................................................................. 40 Payment Methods ......................................................................................................................... 33 Refund Policy and Procedures .................................................................................................. 39 Residency ...................................................................................................................................32-33 Returned Checks ............................................................................................................................ 33 Sources of Financial Aid .............................................................................................................. 37 Tuition ................................................................................................................................................ 32 Veterans Assistance ................................................................................................................38-39Foundation, STC ...................................................................................................................................... 41Introduction ......................................................................................................................................... 3-14 Academic Calendar for 1998-1999 .............................................................................................2 Accreditations ....................................................................................................................................7 Administration ...................................................................................................................................4 Career Programs ............................................................................................................................5-6 Commission Members ....................................................................................................................4 Facility Services at STC ................................................................................................................. 12 Historical Overview .................................................................................................................10-11 Map of the College ........................................................................................................................ 13 Map of the Duncan Center ......................................................................................................... 14 Mission .................................................................................................................................................6 Role and Scope ..................................................................................................................................7 State Board Members ......................................................................................................................4 Student Outcomes ...........................................................................................................................9 Values ................................................................................................................................................8-9Industrial Technology ................................................................................................................125-144 Services for Students.......................................................................................................................25-30 Bookstore .......................................................................................................................................... 26 Cafeteria ............................................................................................................................................ 26 Campus Safety and Security ...................................................................................................... 26 Career Planning and Placement ............................................................................................... 26 Cooperative Program for the Deaf and the Blind ........................................................28-29 Counseling and Career Development ..............................................................................27-28 Early Registration ........................................................................................................................... 27
208
Evening Services ............................................................................................................................ 27 Health Services ............................................................................................................................... 27 Housing Information .................................................................................................................... 27 Identification Cards ....................................................................................................................... 27 Insurance .......................................................................................................................................... 27 Library ..........................................................................................................................................27-28 Orientation ....................................................................................................................................... 24 Parking ............................................................................................................................................... 28 Services to Students with Disabilities ..............................................................................28-29 Student Activities .......................................................................................................................... 29 Student Council .............................................................................................................................. 29 Student Development Services ...................................................................................................7 Student Disabilities Services Center .................................................................................28-29 Student Due Process .................................................................................................................... 29 Success Network ............................................................................................................................ 29 Transitional Studies .................................................................................................................29-30 Tutorial Learning Center .......................................................................................................29-30 -Writing Lab, Math Lab, Accounting Lab, Testing LabSTC Foundation ....................................................................................................................................... 41
209
Index
Notes
210
Index
Notes
rSpartanburg Technical College
P.O. Box 4386Spartanburg, s.c. 29305
864· 591 • 3600
Non-Profit Org.U.S. Postage
PAIDPermit No. 84
Spartanburg, s.c.29306