bcb 444/544
DESCRIPTION
BCB 444/544. Lecture 11 First BLAST vs FASTA Plus some Gene Jargon Multiple Sequence Alignment (MSA) #11_Sept14. Required Reading ( before lecture). √ Mon Sept 10 - for Lecture 9/10 BLAST variations; BLAST vs FASTA, SW Chp 4 - pp 51-62 - PowerPoint PPT PresentationTRANSCRIPT
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 1
BCB 444/544
Lecture 11
First BLAST vs FASTAPlus some Gene Jargon
Multiple Sequence Alignment (MSA)
#11_Sept14
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 2
√Mon Sept 10 - for Lecture 9/10 BLAST variations; BLAST vs FASTA, SW
• Chp 4 - pp 51-62
√Wed Sept 12 - for Lecture 11 & Lab 4Multiple Sequence Alignment (MSA)
• Chp 5 - pp 63-74
Fri Sept 14 - for Lecture 12Position Specific Scoring Matrices & Profiles
• Chp 6 - pp 75-78 (but not HMMs)
• Good Additional Resource re: Sequence Alignment? • Wikipedia:
http://en.wikipedia.org/wiki/Sequence_alignment
Required Reading (before lecture)
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 3
Assignments & Announcements - #1
Revised Grading Policy has been sent via email Please review!
√Mon Sept 10 - Lab 3 Exercise due 5 PM: to: [email protected]
?Thu Sept 13 - Graded Labs 2 & 3 will be returned at beginning of
Lab 4 Fri Sept 14 - HW#2 due by 5 PM (106 MBB)
Study Guide for Exam 1 will be posted by 5
PM
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 4
Review: Gene Jargon #1 (for HW2, 1c)
Exons = "protein-encoding" (or "kept" parts) of eukaryotic genes vs Introns = "intervening sequences"
= segments of eukaryotic genes that "interrupt" exons
• Introns are transcribed into pre-RNA• but are later removed by RNA processing • & do not appear in mature mRNA • so are not translated into protein
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 5
Assignments & Announcements - #2
Mon Sept 17 - Answers to HW#2 will be posted by 5 PM
Thu Sept 20 - Lab = Optional Review Session for Exam
Fri Sept 21 - Exam 1 - Will cover:• Lectures 2-12 (thru Mon Sept 17)• Labs 1-4• HW2• All assigned reading:
Chps 2-6 (but not HMMs) Eddy: What is Dynamic Programming
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 6
Chp 4- Database Similarity Searching
SECTION II SEQUENCE ALIGNMENT
Xiong: Chp 4
Database Similarity Searching
• √Unique Requirements of Database Searching• √Heuristic Database Searching• √Basic Local Alignment Search Tool (BLAST)• FASTA• Comparison of FASTA and BLAST• Database Searching with Smith-Waterman
Method
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 7
Why search a database?
• Given a newly discovered gene,• Does it occur in other species?• Is its function known in another species?
• Given a newly sequenced genome, which regions align with genomes of other organisms?• Identification of potential genes• Identification of other functional parts of
chromosomes
• Find members of a multigene family
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 8
FASTA and BLAST
• FASTA • user defines value for k = word length• Slower, but more sensitive than BLAST at lower values of k,
(preferred for searches involving a very short query sequence)
• BLAST family • Family of different algorithms optimized for particular types of
queries, such as searching for distantly related sequence matches
• BLAST was developed to provide a faster alternative to FASTA without sacrificing much accuracy
•Both FASTA, BLAST are based on heuristics •Tradeoff: Sensitivity vs Speed•DP is slower, but more sensitive
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 9
BLAST algorithms can generate both "global" and "local" alignments
Global alignment
Local alignment
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 10
BLAST - a Family of Programs:Different BLAST "flavors"
• BLASTP - protein sequence query against protein DB
• BLASTN - DNA/RNA seq query against DNA DB (GenBank)
• BLASTX - 6-frame translated DNA seq query against protein DB
• TBLASTN - protein query against 6-frame DNA translation
• TBLASTX - 6-frame DNA query to 6-frame DNA translation
• PSI-BLAST - protein "profile" query against protein DB
• PHI-BLAST - protein pattern against protein DB
• Newest: MEGA-BLAST - optimized for highly similar sequences
http://www.ncbi.nlm.nih.gov/blast/producttable.shtml
Which tool should you use?
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 11
Detailed Steps in BLAST algorithm
1. Remove low-complexity regions (LCRs)
2. Make a list (dictionary): all words of length 3aa or 11 nt
3. Augment list to include similar words
4. Store list in a search tree (data structure)
5. Scan database for occurrences of words in search tree
6. Connect nearby occurrences
7. Extend matches (words) in both directions
8. Prune list of matches using a score threshold
9. Evaluate significance of each remaining match
10. Perform Smith-Waterman to get alignment
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 12
1: Filter low-complexity regions (LCRs)
⎟⎟⎟
⎠
⎞
⎜⎜⎜
⎝
⎛=
∏i
iN n
L
LK
!
!log1
Window length (usually 12)
Alphabet size (4 or 20)
Frequency of ith letter in the window
• Low complexity regions, transmembrane regions and coiled-coil regions often display significant similarity without homology.
• Low complexity sequences can yield false positives.
• Screen them out of your query sequences! When appropriate!
K = computational complexity; varies from 0 (very low complexity)to 1 (high complexity)
e.g., for GGGG:L! = 4!=4x3x2x1= 24nG=4 nT=nA=nC=0 ni! = 4!x0!x0!x0! = 24K=1/4 log4 (24/24) = 0
For CGTA: K=1/4 log4(24/1) = 0.57
This slide has been changed!
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 13
2: List all words in query
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQYGG GGF GFM FMT MTS TSE SEK …
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 14
3: Augment word list
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQYGG GGF GFM FMT MTS TSE SEK …
AAAAABAAC
…
YYY
203 = 8000possible matches
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 15
3: Augment word list
G G FA A A0 + 0 + -2 = -2
BLOSUM62 scores Non-match
G G FG G Y6 + 6 + 3 = 15
Match
A user-specified threshold, T, determines which 3-letter words are considered matches and non-matches
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 16
3: Augment word list
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQYGG GGF GFM FMT MTS TSE SEK …
GGIGGLGGMGGFGGWGGY…
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 17
3: Augment word list
Observation:
Selecting only words with score > T greatly reduces number of possible matches
otherwise, 203 for 3-letter words from amino acid sequences!
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 18
Example
A R N D C Q E G H I L K M F P S T W Y VA 4 -1 -2 -2 0 -1 -1 0 -2 -1 -1 -1 -1 -2 -1 1 0 -3 -2 0R -1 5 0 -2 -3 1 0 -2 0 -3 -2 2 -1 -3 -2 -1 -1 -3 -2 -3N -2 0 6 1 -3 0 0 0 1 -3 -3 0 -2 -3 -2 1 0 -4 -2 -3D -2 -2 1 6 -3 0 2 -1 -1 -3 -4 -1 -3 -3 -1 0 -1 -4 -3 -3C 0 -3 -3 -3 9 -3 -4 -3 -3 -1 -1 -3 -1 -2 -3 -1 -1 -2 -2 -1Q -1 1 0 0 -3 5 2 -2 0 -3 -2 1 0 -3 -1 0 -1 -2 -1 -2E -1 0 0 2 -4 2 5 -2 0 -3 -3 1 -2 -3 -1 0 -1 -3 -2 -2G 0 -2 0 -1 -3 -2 -2 6 -2 -4 -4 -2 -3 -3 -2 0 -2 -2 -3 -3H -2 0 1 -1 -3 0 0 -2 8 -3 -3 -1 -2 -1 -2 -1 -2 -2 2 -3I -1 -3 -3 -3 -1 -3 -3 -4 -3 4 2 -3 1 0 -3 -2 -1 -3 -1 3L -1 -2 -3 -4 -1 -2 -3 -4 -3 2 4 -2 2 0 -3 -2 -1 -2 -1 1K -1 2 0 -1 -3 1 1 -2 -1 -3 -2 5 -1 -3 -1 0 -1 -3 -2 -2M -1 -1 -2 -3 -1 0 -2 -3 -2 1 2 -1 5 0 -2 -1 -1 -1 -1 1F -2 -3 -3 -3 -2 -3 -3 -3 -1 0 0 -3 0 6 -4 -2 -2 1 3 -1P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4 7 -1 -1 -4 -3 -2S 1 -1 1 0 -1 0 0 0 -1 -2 -2 0 -1 -2 -1 4 1 -3 -2 -2T 0 -1 0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1 1 5 -2 -2 0W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1 1 -4 -3 -2 11 2 -3Y -2 -2 -2 -3 -2 -1 -2 -3 2 -1 -1 -2 -1 3 -3 -2 -2 2 7 -1V 0 -3 -3 -3 -1 -2 -2 -3 -3 3 1 -2 1 -1 -2 -2 0 -3 -1 4
Find all words that match EAM with a score greater than or equal to 11
EAM 5 + 4 + 5 = 14DAM 2 + 4 + 5 = 11 QAM 2 + 4 + 5 = 11ESM 5 + 1 + 5 = 11EAL 5 + 4 + 2 = 11
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 19
4: Store words in search tree
Search tree
Augmented list of query words
“Does this query contain GGF?”
“Yes, at position 2.”
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 20
Search tree
G
G
L MF W Y
GGFGGLGGMGGWGGY
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 21
Example
Put this word list into a search tree
DAMQAMEAMKAMECMEGMESMETMEVMEAIEALEAV
D Q E K
A A A G S T V AC
M M M M M M MM
LM
I V
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 22
5: Scan the database sequences
Database sequence
Que
ry s
eque
nce
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 23
Example
Scan this "database" for occurrences of your words
MKFLILLFNILCLDAMLAADNHGVGPQGASGVDPITFDINSNQTGPAFLTAVEAIGVKYLQVQHGSNVNIHRLVEGNVKAMENAE AMPQLSVDA M
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 24
6: Connect nearby occurences(diagonal matches in Gapped
BLAST)
Database sequence
Qu
ery
seq
uen
ce
Two dots are connected IFF if they are less than A letters apart & are on diagonal
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 25
7: Extend matches in both directions
DB
Scan
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 26
7: Extend matches, calculating score at each step
• Each match is extended to left & right until a negative BLOSUM62 score is encountered• Extension step typically accounts for > 90% of
execution time
L P P Q G L L Query sequenceM P P E G L L Database sequence <word> 7 2 6 BLOSUM62 scores word score = 15<--- --->2 7 7 2 6 4 4 HSP SCORE = 32
(High Scoring Pair)
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 27
8: Prune matches
• Discard all matches that score below defined threshold
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 28
9: Evaluate significance
• BLAST uses an analytical statistical significance calculation
RECALL:1. E-value: E = m x n x P
m = total number of residues in databasen = number of residues in query sequenceP = probability that an HSP is result of random chance
lower E-value, less likely to result from random chance,
thus higher significance
• Bit Score: S' =
normalized score, to account for differences in size of database (m) & sequence length(n); Note (below) that bit score is linearly related to raw alignment score, so: higher S' means alignment has higher significance
This slide has been changed!
S'= ( X S - ln K)/ln2 where: = Gumble distribution constant S = raw alignment score
K = constant associated with scoring matrixFor more details - see text & BLAST tutorial
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 29
10: Use Smith-Waterman algorithm (DP) to generate alignment
• ONLY significant matches are re-analyzed using Smith-Waterman DP algorithm.• Alignments reported by BLAST are produced by
dynamic programming
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 30
BLAST: What is a "Hit"?
• A hit is a w-length word in database that aligns with a word from query sequence with score > T
• BLAST looks for hits instead of exact matches • Allows word size to be kept larger for speed, without
sacrificing sensitivity
• Typically, w = 3-5 for amino acids, w = 11-12 for DNA
• T is the most critical parameter:• ↑T ↓ “background” hits (faster)• ↓T ↑ ability to detect more distant relationships
(at cost of increased noise)
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 31
Tips for BLAST Similarity Searches
• If you don’t know, use default parameters first• Try several programs & several parameter settings• If possible, search on protein sequence level
• Scoring matrices:PAM1 / BLOSUM80: if expect/want less divergent proteinsPAM120 / BLOSUM62: "average" proteinsPAM250 / BLOSUM45: if need to find more divergent
proteins
• Proteins: >25-30% identity (and >100aa) -> likely related15-25% identity -> twilight zone<15% identity -> likely unrelated
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 32
Practical Issues
Searching on DNA or protein level? In general,
protein-encoding DNA should be translated!
• DNA yields more random matches:• 25% for DNA vs. 5% for proteins
• DNA databases are larger and grow faster• Selection (generally) acts on protein level
• Synonymous mutations are usually neutral • DNA sequence similarity decays faster
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 33
BLAST vs FASTA
• Seeding: • BLAST integrates scoring matrix into first phase• FASTA requires exact matches (uses hashing)
• BLAST increases search speed by finding fewer, but better, words during initial screening phase
• FASTA uses shorter word sizes - so can be more sensitive
• Results: • BLAST can return multiple best scoring alignments• FASTA returns only one final alignment
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 34
BLAST & FASTA References
• FASTA - developed first
• Pearson & Lipman (1988) Improved Tools for Biological Sequence Comparison.PNAS 85:2444- 2448
• BLAST• Altschul, Gish, Miller, Myers, Lipman, J. Mol. Biol. 215
(1990)• Altschul, Madden, Schaffer, Zhang, Zhang, Miller,
Lipman (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25:3389-402
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 35
BLAST Notes - & DP Alternatives
• BLAST uses heuristics: it may miss some good matches • But, it’s fast: 50 - 100X faster than Smith-Waterman (SW) DP• Large impact:
• NCBI’s BLAST server handles more than 100,000 queries/day
• Most used bioinformatics program in the world! But - Xiong says: "It has been estimated that for some families of
protein sequences BLAST can miss 30% of truly significant matches."
• Increased availability of parallel processing has made
DP-based approaches feasible:
• 2 DP-based web servers: both more sensitive than BLAST• Scan Protein Sequence:
http://www.ebi.ac.uk/scanps/index.htmlImplements modified SW optimized for parallel processing
• ParAlign www.paralign.org - parallel SW or heuristics
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 36
NCBI - BLAST ProgramsGlossary & Tutorials
• http://www.ncbi.nlm.nih.gov/BLAST/
• http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/glossary2.html
• http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html
BLAST
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 37
Chp 5- Multiple Sequence Alignment
SECTION II SEQUENCE ALIGNMENT
Xiong: Chp 5
Multiple Sequence Alignment
• Scoring Function• Exhaustive Algorithms• Heuristic Algorithms• Practical Issues
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 38
Multiple Sequence Alignments
Credits for slides: Caragea & Brown, 2007; Fernandez-Baca, Heber &Hunter
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 39
Overview
1. What is a multiple sequence alignment (MSA)?
2. Where/why do we need MSA?
3. What is a good MSA?
4. Algorithms to compute a MSA
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 40
Multiple Sequence Alignment
• Generalize pairwise alignment of sequences to include > 2 homologous sequences
• Analyzing more than 2 sequences gives us much more information:
• Which amino acids are required? Correlated? • Evolutionary/phylogenetic relationships
• Similar to PSI-BLAST idea (not yet covered in lecture): use a set of homologous sequences to
provide more "sensitivity"
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 41
What is a MSA?
ATTTG-ATTTGCAT-TGC
ATTTGATTTGCATT-GC
ATTT-G-ATTT-GCAT-T-GC
MSA Not a MSANot a MSA
Why?
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 42
Definition: MSA
Given a set of sequences, a multiple sequence alignment is an assignment of gap characters, such that
• resulting sequences have same length• no column contains only gaps
ATTTG-ATTTGCAT-TGC
ATTTGATTTGCATT-GC
ATTT-G-ATTT-GCAT-T-GC
YES NONO
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 43
Displaying MSAs: using CLUSTAL W
* entirely conserved column
: all residues have ~ same size AND hydropathy
. all residues have ~ same size OR hydropathy
RED: AVFPMILW (small)
BLUE: DE (acidic, negative chg)
MAGENTA: RHK (basic, positive chg)
GREEN: STYHCNGQ (hydroxyl + amine + basic)
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 44
A single sequence that represents most common residue of each column in a MSA
Example:
What is a Consensus Sequence?
FGGHL-GFF-GHLPGFFGGHP-FG
FGGHL-GF
Steiner consensus seqence: Given sequences s1,…, sk, find a sequence s* that maximizes Σi S(s*,si)
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 45
Applications of MSA
• Building phylogenetic trees• Finding conserved patterns, e.g.:
• Regulatory motifs (TF binding sites)• Splice sites• Protein domains
• Identifying and characterizing protein families• Find out which protein domains have same function
• Finding SNPs (single nucleotide polymorphisms) & mRNA isoforms (alternatively spliced forms)• DNA fragment assembly (in genomic sequencing)
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 46
Application: Recover Phylogenetic Tree
NYLS
NYLS NFLS
What was series of events that led to current species?
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 47
Application: Discover Conserved Patterns
Rationale: if they are homologous (derived from a common ancestor), they may be structurally equivalent
TATA box = transcriptional promoter element
Is there a conserved cis-acting regulatory sequence?
9/14/07BCB 444/544 F07 ISU Dobbs #11 - Multiple Sequence Alignment 48
Goal: Characterize Protein Families
Which parts of globin sequences are most highly conserved?