bakpia kulit pisang

Download bakpia kulit pisang

Post on 28-Nov-2015

53 views

Category:

Documents

3 download

Embed Size (px)

TRANSCRIPT

PROGRAMKREATIVITASMAHASISWA

BAKPIAISIKULITPISANGSEBAGAIINOVASIPELUANG

USAHABARU

JenisKegiatan:ProgramKreativitasMahasiswaKewirausahaan(PKMK)

Diusulkanoleh:KetuaKelompok:CharinaAmelia(6450406009)/2006AnggotaKelompok:1.OcbrivianitaMU(6450406013)/20062.WinaPrayaesti(6450406015)/20063.YessitaYuniararasari(6450408042)/20084.Rizkamala(4350406508)/2006

UNIVERSITASNEGERISEMARANG

2008

HALAMANPENGESAHANPROGRAMKREATIVITASMAHASISWA

1.JudulKegiatan:BakpiaIsiKulitPisangsebagaiInovasiPeluangUsahaBaru

2.BidangKegiatan:PKMKewirausahaan3.BidangIlmu:Kesehatan4.KetuaPelaksanaKegiatana.NamaLengkap:CharinaAmeliab.NIM:6450406009c.Jurusan:IlmuKesehatanMasyarakatd.PerguruanTinggi:UniversitasNegeriSemarange.AlamatRumah:Jl.AmbonNo.401RT03/RW08LimbanganWetanBrebesf.NoTelp/HP:085642500946g.Email:lia_charina@yahoo.co.id5.AnggotaPelaksanaKegiatan/Penulis:4orang6.DosenPendampinga.NamaLengkap:IrwanBudiono,SKM,M.Kesb.NIP:132308392c.AlamatRumah:TambakrejoRT/RW02/01No.45Purworejod.NoTelp/HP:089855698807.BiayaKegiatanTotal:Rp.3.581.000,008.JangkaWaktuPelaksanaan:4jam/minggu

Semarang,24September2008DosenPembimbingKetuaPelaksanaKegiatan

IrwanBudiono,SKM,M.KesCharinaAmeliaNIP.132308392NIM.6450406009

Menyetujui,

PembantuRektorKetuaJurusanIlmuKesehatanBidangKemahasiswaanUNNESMasyarakat

Drs.Masrukhi,M.Pddr.H.MahalulAzam,M.KesNIP.131764049NIP.132297151

USULANPROGRAMKREATIVITASMAHASISWAKEWIRAUSAHAAN(PKMK)

AJUDULPROGRAM

JudulprogramyangdiusulkanadalahBakpiaIsiKulitPisangsebagaiInovasiPeluangUsahaBaru.

BLATARBELAKANG

TumbuhanpisangadalahsuatutumbuhanyangdapattumbuhsecarapotensialdiIndonesia.Tumbuhanpisangdapattumbuhdidaerahpantaimaupundidaerahpegunungan.HampirsemuawilayahyangadadiIndonesiadapatditumbuhitanamanpisang.Selamainimasyarakatselalumengkonsumsibuahdaritumbuhanpisang,konsumenpadaumumnyasetelahmemakanbuahpisanglalumembuangkulitnyakarenadianggapsampah(limbahdaripisang).

Buahpisangbanyakmengandungkarbohidratbaikisimaupunkulitnya.Olehkarenaitukulitbuahpisangdapatdiolahmenjadimakanantertentu.Hasilanalisiskimiamenunjukkanbahwakomposisikulitpisangbanyakmengandungairyaitu68,90%danjugakarbohidratyaitusebesar18,50%.MenurutpenelitiandariIPBkulitpisangbanyakmengandungkarbohidrat,kalsium,proteindanjugalemakyangcukup.PenelitianmahasiswaD3TataBogaUNESAyangmengujikankulitpisangdilaboratoriumITSmenunjukkanbahwakulitpisangbanyaksekalimengandungvitamindanjugafosfor.

Manfaatbuahpisangsudahdiketahui,baikkelezatannyamaupunkandungangizinya.Namun,tentangkhasiatdanmanfaatkulitpisangmasihbanyakorangyangbelumtahu.HasilpenelitiantimUniversitasTaichungChungShan,Taiwanmemperlihatkanbahwaekstrakkulitpisangternyataberpotensimengurangigejaladepresidanmenjagakesehatanretinamata.SelainkayavitaminB6,kulitpisangjugaternyatabanyakmengandungserotoninyangsangatvitaluntukmenyeimbangkanmood.

Daripaparandiatas,kamikelompokdariIKMUNNESmencobamenawarkanidekami,yaitumenciptakanpeluangbisnisbarudanmeningkatkannilaiekonomiskulitpisangdenganmembuatbakpiaisikulitpisang.Alasankamimembuatolahankulitpisangdalambentukbakpiakarenaselainmudahdibuat,harganyamurah,enakdantahanlama.BakpiaisikulitpisanginiakandipasarkandidaerahSekaran,GunungPati.Banyakmasyarakatgemarmengkonsumsibakpia.Denganadanyaprodukinidiharapkanmasyarakatakanmembelibakpiaisikulitpisangkarenaadanyainovasibaruyangbelumpernahadasebelumnya.

CPERUMUSANMASALAH

Kulitpisangmerupakanlimbahdaripisangyangtidakbernilaiekonomisdanseringdiabaikan,padahalkulitpisangbanyakgizinya.SelainkayaakanvitaminB6,jugabanyakmengandungkarbohidrat,kalsium,protein,danjugalemakyangcukup.Namun,kulitpisangbelumbanyakdimanfaatkankarenadianggapsebagaisampah.Permasalahanyangakandibahasdalamprograminiantaralain:

1.Bagaimanacaramemanfaatkankulitpisang?

2.Bagaimanacaramengolahkulitpisangmenjadimakananyangdigemariolehmasyarakat?

3.Bagaimanacaramemasarkanprodukbakpiaisikulitpisang?

DTUJUANPROGRAM

Tujuanyangingindicapaidaripembuatanbakpiaisikulitpisangadalahsebagaiberikut:1.Agarmasyarakatdapatmembeliprodukbakpiaisikulitpisang.2.Untukmeningkatkannilaiekonomikulitpisang.3.Menawarkanprodukmakananbaru.4.Membentuksebuahusahayangmenguntungkanmasyarakat.

ELUARANYANGDIHARAPKAN

Luaran(output)diharapkandaripembuatanbakpaoisikulitpisangadalahsebagaiberikut:1.Hasilolahan,yaituberupabakpiaisikulitpisang.Hasilolahaniniadalahpengolahankulitpisangmenjadimakananyangbernilaiekonomidanbergizitinggi.2.Peningkatanminatmasyarakatterhadapkonsumsikulitpisang.

FKEGUNAANPROGRAM

Kegunaanprogramini,antaralain:1.Menjadisalahsatupenerapanteknologipangandalambidangpengolahankulitpisangdalambentukbakpiayangenakdansehat.2.Meningkatkannilaiekonomikulitpisang.

GGAMBARANUMUMRENCANAUSAHA

Hampirsetiaprumahterdapatpohonpisang,biasanyahasilpanenpisangdijualkepadapedagangataudikonsumsisendiri.Pisangtersebutbelumdimanfaatkansecaramaksimal,padahalbiladiolahakanmenghasilkannilaiekonomisyangtinggi.Buahpisangbanyakmengandungkarbohidratbaikisimaupunkulitnya.Olehkarenaitukulitbuahpisangdapatdiolahmenjadimakanantertentu.NamundidaerahSekarankulitpisangdibuangbegitusajadandigunakansebagaimakananternak.Olehkarenaitukamimencobamemanfaatkankulitpisangtersebutmenjadisebuahprodukmakananyangbergizitinggi.Dengandemikiankulitpisangtersebutdapatdimanfaatkandandapatmeningkatkanpendapatanpendudukdesatersebut.

HMETODEPELAKSANAANPROGRAM

Adapunmetodepelaksanaanprograminiadalah:1.Mengumpulkanbahan-bahandanalat-alatyangakandiperlukandalampembuatanbakpiaisikulitpisangini.Pengambilanbahanbaku(kulit

pisang)langsungdidapatdaripetani,danbahanlainnyaberupa:terigu,minyaksayur,garam,danvanilidibelidaripasar/tokosekitar.2.Memulaipembuatanbakpiaisikulitpisangtersebut.Carapembuatanbakpiaisikulitpisangtersebutadalah:Bahan-Bahan:

BahanA:

250grterigu75ccminyaksayur150ccairsdtgaram

BahanB:

250grterigu150ccminyak

BahanIsi:

KulitPisang150grAirGulaPasirAsamsitratNatriumbenzoat

CaraMembuatIsi:

Tahapawal:pilihkulitpisangyangmasihsegardantidakrusakdankerokbagiandalamkulitpisangdenganmenggunakansendokstainlessdantaruhdalamwadah.Tahapkedua:haluskanbahankulitpisangtersebutdenganbahanpenggerusatausendokdantambahkanairdenganperbandingan1banding1.

Tahapketiga:Tambahkangulapasir,asamsitratdannatriumbenzoat.Masaksemuabahandenganapiyangstabilsambildiadukterussampaikental.Setelahkentalangkatselaidanmasukkankedalambotolselaidantutuprapat.

CaraMembuatBakpia:a)AdukseluruhbahanAsehinggameratab)AdukseluruhbahanBsehinggameratac)Tipiskan/pipihkanadonanAd)TipiskanataupipihkansetengahdariadonanB.TaruhdiatasadonanAyangsudahdipipihkane)Lipat.f)Tipiskan/pipihkansisaadonanB.g)LetakkanadonanBdiatasadonanyangtelahdilipat.h)Gulungdandibagidua.i)Potong-potongtiapbagianmelintang1cm.j)Tipiskantiappotonganadonan,isidenganadonanisi.k)Bulatkanhinggarapil)Taruhdiatasloyang,semirdengankuningtelurm)Panggangdalamovenpanasselama30menithinggakuningkeemasan.Angkatdandinginkan.3.MempromosikankepadamasyarakatSekarankhususnyaanak-anakyaitumelaluikegiatanPosyandu,ibu-iburumahtanggapadaarisanPKK.4.Mendistribusikanprodukinikerumah-rumahataukewarungatautokoyangbiasadidatangiolehibu-iburumahtanggadananak-anak.5.Mempromosikanprodukkepadamahasiswayangtinggaldikosdengancaramenitipkanprodukdikos.

No.KegiatanMingguKeIIIIIIIVV1.Pembuatanproposal2.Pengumpulanalatdanbahan3.Pembuatanbakpiaisikulitpisang4.Promosikepadamasyarakatsetempat5.DistribusiprodukbakpiaIJADWALKEGIATANPROGRAM

JNAMADANBIODATAKETUADANANGGOTAKELOMPOK

1.KetuaPelaksanaKegiatana.NamaLengkap:CharinaAmeliab.NIM:6450406009c.Fak/ProgramStudi:FIK/IKMd.PerguruanTinggi:UniversitasNegeriSemarange.Waktuuntukkegiatan:4jam/minggu2.AnggotaPelaksanaKegiatan1a.NamaLengkap:OcbrivianitaMUb.NIM:6450406013c.Fak/ProgramStudi:FIK/IKMd.PerguruanTinggi:UniversitasNegeriSemarange.Waktuuntukkegiatan:4jam/minggu3.AnggotaPelaksanaKegiatan2a.NamaLengkap:WinaPrayaestib.NIM:6450406015c.Fak/ProgramStudi:FIK/IKMd.PerguruanTinggi:UniversitasNegeriSemarang

e.Waktuuntukkegiatan:4jam/minggu4.AnggotaPelaksanaKegiatan3a.NamaLengkap:YessitaYuniararasarib.NIM:6450408042c.Fak/ProgramStudi:FIK/IKMd.PerguruanTinggi:UniversitasNegeriSemarange.Waktuuntukkegiatan:4jam/minggu5.AnggotaPelaksanaKegiatan4a.NamaLengkap:Rizkamalab.NIM:4350406508c.Fak/ProgramStudi:FMIPA/KIMIAd.PerguruanTinggi:UniversitasNegeriSemarange.Waktuuntukkegiatan:4jam/minggu

KNAMADANBIODATADOSENPENDAMPING

1.NamaLengkap:IrwanBudiono,SKM,M.Kes2.NIP:1323083923.Pangkat/Jabatan:AsistenAhliMadya/IIIA4.Fakultas/ProgramStudi:FakultasIlmuKeolahragaan5.PerguruanTinggi:UniversitasNegeriSemarang6.BidangKeahlian:Gizi7.Waktuuntukkegiatan:4jam/minggu

LBIAYA1.PengurusanproposalRp.200.000,002.Peralatana.PanicEmailRp300.000,00b.PengadukRp20.000,00c.Komporgas+tabunggasRp517.000,00d.TimbanganRp.350.000,00e.Wadah2buahRp.80.000,00

f.Sendok2buahRp.5.000,00g.OvenRp.500.000,00h.LoyangRp.100.000,00Rp.1.872.000,003.Bahan-bahana.KulitPisangRaja_b.Gulapasir2kgRp.16.000,00c.AsamSitratRp.10.000,00d.NatriumBenzoatRp.10.000,00e.Terigu2kgRp.12.000,00f.MinyakSayur2kgRp.10.000,00g.GaramRp.1.000,00h.Air-Rp.59.000,004.TransportasiRp.350.000,005.FotocopyRp.150.000,006.PengetikanRp.75.000,007.PenjilidanRp.65.000,008.PengemasanBakpiaa.KemasanuntukbakpiaRp.300.000,00b.StaplesRp.5.000,00c.SelotipRp.2.000,00d.PlastikRp.3.000,009.BiayatakterdugaRp.500.000,00TotalbiayaRp.3.581.000,00

KETERANGANKERJASAMA

Denganhormat,SehubungandenganadanyaPKMyangberjudulBakpiaIsiKulitPisangSebagaiInovasiPeluangUsahaBarudalambidangKewirausahaansayayangbertandatangandibawahini:Nama:CharinaAmeliaNIM:6450406009Jurusan:IlmuKesehatanMasyarakatMemintakerjasamadalambentukpemasaranprodukkamiyaituBakpiaIsiKulitPisangpadaTokosaudaradidesaSekaran.Ataskesediaankerjasamanyasayaucapkanterimakasih.

Semarang,24September2008

PemilikTok