aspen times weekly-4/18
DESCRIPTION
The Aspen Times Weekly reaches thousands of readers every week who are interested in Aspen, Colorado. In this edition, we check out closing day of the ski season, travel to the Front Range for a bite to eat and get a sound sampler of who's performing locally this summer.TRANSCRIPT
CLOSING DAYCULTURE
FIND IT INSIDE
GEAR | PAGE 10CULTURE/CHARACTERS/COMMENTARY
APRIL 18�24, 2013 • ASPENTIMES.COM/WEEKLY
FOOD MATTERS BIG CITY EATS 14 || LIBATIONS A TASTE OF PACO MARTINEZ 16
SEE PAGE 20
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13�
ASPENSNOWMASS.COM | 970-923-1227
ASPEN HIGHLANDS TO OPEN FOR A BONUS WEEKEND, APRIL 27-28Aspen Highlands will be open through April 21 as scheduled, as well as an additional weekend, April 27-28. The Exhibition lift will run daily from 9 am – 4 pm. Loge, Cloud Nine and Deep Temerity lifts will run until 3:30 pm, providing access to the entire mountain including the 12,392 summit of Highland Bowl. The Merry-Go-Round restaurant, Cloud Nine Alpine Bistro and Four-Mountain Sports will be open forbusiness. The Aspen Highlands Closing Day festivities will remain on Sunday, April 21.
970-923-1227 | www.aspensnowmass.com/aspen-highlands
WELCOME MAT INSIDE this EDITION
20 party on ...
The end of the ski season means many things to many people. But for local skiers and boarders, it means party time. Writer amanda Charles makes the rounds of closing day parties, past and present.
DEpartMEntS
04 THE WEEKLY CONVERSATION
08 LEgENdS & LEgACIES
10 FROm ASpEN, WITH LOVE
12 WINE INK
14 FOOd mATTERS
17 ARTS & ENTERTAINmENT
23 AROuNd ASpEN
25 LOCAL CALENdAR
34 CROSSWORd
CLOSING DAYCULTURE
FIND IT INSIDE
GEAR | PAGE 10CULTURE/CHARACTERS/COMMENTARY
APRIL 18�24, 2013 • ASPENTIMES.COM/WEEKLY
FOOD MATTERS BIG CITY EATS 14 || LIBATIONS A TASTE OF PACO MARTINEZ 16
SEE PAGE 20
on tHE CoVErPhoto by Daniel Bayer/Aspen Skiin Co.
VOLUME 2 F ISSUE NUMBER 21
General ManagerGunilla Asher
EditorJeanne McGovern
SubscriptionsDottie Wolcott
circulationMaria Wimmer
Art DirectorAfton Groepper
Arts EditorStewart Oksenhorn
Production ManagerEvan Gibbard
Contributing EditorsMary Eshbaugh Hayes
Gunilla AsherKelly HayesJohn Colson
Contributing WritersPaul AndersenHilary Stunda
Amanda CharlesAspen Times staffFrannie the dog
Contributing PartnersHigh Country News
Aspen Historical SocietyThe Ute MountaineerWriters on the Rangewww.aspentimes.com
SalesAshton HewittJeff Hoffman
David LaughrenDan Frees
Louise Walker
Read the eEditionwww.aspentimes.com/weekly
Classified Advertising(970) 925-9937
�A S P E N T I M E S . C O M / W E E K L Y
Aspen | 514 E. Hyman Ave. | 970.925.7000 Carbondale | 0290 Highway 133 | 970.963.3300 Redstone | 385 Redstone Blvd. | 970.963.1061 Glenwood Springs | 1614 Grand Ave. | 970.928.9000
thesource FB/ColdwellBankerMasonMorse TW/masonmorse LN/Coldwell Banker Mason Morse YT/MasonMorse1
Find more at masonmorse.com
ASPEN One of the best building sites in Aspen just got better with a site plan review approval for a new residence with a final maximum floor area of 11,037 sq. ft. The property is sited above the Rio Grande Trail on Willoughby Way with the Roaring Fork River in the foreground and views of Aspen Mountain front and center. CCY Architects has designed a contemporary 6 bedroom residence, yet the style and layout can easily be changed since the plans are in the schematic design process. Located just a few properties west of the Red Mountain Road and Willoughby Way intersection and within walking and biking distance to town. $8,995,000
WILLOUGHBY WAY BUILDING SITE
Carrie Wells970.920.7375
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13� V O X P O P C O M P I L E d B y j U L I A k R y S
THE WEEkLy CONVERSATION
What is your best memory from this past ski season?
VOX POP
aliSon BoyDmEmpHIS, TENN.
“We missed the ski season, but we came back because I grew up here.”
aMy panDES AuRORA, COLO.
“Getting time away with my husband.”
gaBE linEHan A SpEN
“A day at Highlands with 12 inches of powder … that was the best day.”
NoW thAt hE iS freeoftheworriesaboutre-election,PresidentBarackObamaseemstowanttoprovetoeverybodythatheisnotbeholdentoanybody,andheisactingasbadlyasGeorgeW.Busheverdid.
Andnowhereisthismoretruethaninhisapparentdeterminationtoretainthefederalgovernment’stightgriponinformationthat,inmyhumbleestimation,thepublichasarighttosee.
IntheApril15editionofTheNation,theoldestcontinuouslypublishednewsmagazineintheU.S.,thereisanarticletitled“Obama’scrackdownonwhistleblowers,”detailingthelongsagaoffourmenwhodaredtoblowthewhistleoncorruptionandwasteattheNationalSecurityAgency.
Thefourmen—ThomasDrake,WilliamBinney,J.KirkWiebeandEdwardLoomis—havebeenunderindictmentbyObama’sman,AttorneyGeneralEricHolder,fortheireffortstolettheworldknowaboutthedarkdesignsbeinghatchedatthetopechelonsoftheNSA.
TheNSA,forthosechoosingtoliveinthedark,ispossiblythemostpowerfulgovernmentagencyintheworld.Itsbudgetisunknown,itspersonnelthemostcarefullyguardedsecretforceonEarth,anditsmissionisever-changing.Itisinchargeofeavesdroppingonelectronicconversationsaroundtheworld,andwhileitwassupposedtostayoutofdomesticsurveillance,afterthe9/11terrorattacksitisgenerallybelievedtohavecrossthelineandstartedspyingonU.S.citizensasmuchasiteverspiedonforeignnationals.
Accordingtoreporter/writerTimShorrock,writinginTheNation,threeofthefourmenaskedthePentagonin2002toinvestigatetheNSAfor“wastingmillionsandmillionsofdollars”onacybersecuritysystemknownasTrailblazer,whichwasatthecenterofcorporateeffortstoprivatizeourentirecybersecuritynetwork.
Trailblazer,accordingtothisarticle,wasanuntriedandpoorlythoughtoutcybersecuritysystem,lackingdomestic-surveillanceprotectionsmeanttopreventillegalspyingonU.S.citizensathome.
ItalsowascentraltoaprivatizationschemebywhichmultinationalcorporationsweretryingtotakeoverNSA’selectroniceavesdroppingroleandearnbillionsintaxpayermoneyin
theprocess.Thiseffortwasenabledbyoneman—Gen.MichaelV.Hayden,thenthedirectoroftheNSAandcurrentlyaprivateconsultantadvisingNSAon—guesswhat—cybersecuritywork.
Trailblazer’spredecessor,asystemknownasThinThread,hadbeeninuseforashorttimein2000and2001and
wasdeemedsuccessfulanduseful.Inventedbythewhistleblowers,itdidincludedomestic-spyingprotections,andcostamere$3millioncomparedtothemultibilliondollardefensecontractthatspawnedTrailblazer
ItistellingthatHaydenandhiscorporatecroniesmanagedtokilltheThinThreadprojectinlateAugustof2001,weeksbeforethe9/11attacks.Therearethoseintheintelligencefieldwhobelievethat,hadThinThreadnotbeentakenoffline,wewouldhavehadforewarningofthe9/11attacks.
SinceTrailblazerwasnotoperationalasofSept.11,2001,wehadnowarningwhatsoever,becausetheelectronictrailofmessagesandplanswasnotanalyzedandal-Qaida’splanswerenotinterrupted.
Trailblazer,interestinglyenough,wasterminatedin2006,afterthePentagon’sOfficeoftheInspectorGeneralin2005concludeditwasawasteofmoneyandneverwouldworkright.
Buttheprivatizationanddomesticspyingcontinued,accordingtoTheNation,andcontinuestothisday,withwhoknowshowmuchwasteandfraudsiphoningbillionsintocorporatecofferswithlittleeffectiveintelligencetoshowforit.Asevidence,witnessthefactthattheU.S.securityapparatuswascaughtflat-footedanddumfoundedbytheArabSpringrevoltsof2010and2011.
Atthesametime,ObamaandHolderhaverelentlesslypursuedthefourwhistle-blowersnamedabove,indictingthemforchargesofespionageandotheractsthatultimatelywerefoundwantingwhentheentirematterwastossedoutofcourt.
WhyisObamaactingthisway?Idon’tknow,butoneoutcomeisevidentinaquotefromthearticle:
“ByusingtheNSAtospyonAmericancitizens...theUnitedStateshascreatedapolicestatewithfewparallelsinhistory.”
Stickthatinyourmetaphoricalpipeandsmokeitforawhile.
Cybersecurity privatization, domestic spying —
obama’s as bad as Bush
HIT&RUN
with JOHN COLSON
�A S P E N T I M E S . C O M / W E E K L Y
Aspen | 514 E. Hyman Ave. | 970.925.7000 Carbondale | 0290 Highway 133 | 970.963.3300 Redstone | 385 Redstone Blvd. | 970.963.1061 Glenwood Springs | 1614 Grand Ave. | 970.928.9000
thesource FB/ColdwellBankerMasonMorse TW/masonmorse LN/Coldwell Banker Mason Morse YT/MasonMorse1
Find more at masonmorse.com
CARBONDALE This awe-inspiring 3.115 acre lot is a true gem with spectacular, unencumbered views of Mt. Sopris and the adjacent mountain ranges! Property corners and building envelope marked for easy viewing! Views protected by 100 acres of dedicated open space. Enjoy the simplicity of 3+ acres yet experience the grandeur of 103 acres! $275,000 Web Id#: WN129368
Shael Johnson970.920.7384 | [email protected]
STRAIGHT SHOT OF MT. SOPRIS!
BASALT Sunny 2 bedroom/2 bath/2 story townhome featuring upgraded bathrooms, laminate wood flooring, upgraded lighting, fenced patio area & extra owner storage. This is a great end-unit townhome with one of the best locations in Oak Grove Complex next to the grassy, common area. Conveniently located near Willits Dining, Shopping & Whole Foods and only 1 block from the Roaring Fork River. $245,000 Web Id#: WN129303
Christy Clettenberg970.920.7398 | [email protected]
GREAT VALUE IN BASALT
ASPEN This very private residence in Five Trees represents classic European style. In addition to the property’s main residence of four bedrooms and four and half baths, a separate one bedroom, one bath artist studio/cottage is just steps away. Impeccable appointments include vaulted ceilings, gourmet chef’s kitchen with sitting area, separate casual dining and formal dining area, spacious living room that opens out to private waterfall/pond, stone patios and manicured gardens. Master bedroom is on main level with elevator access for easy living. Ski in/ski out access, backs up to open space. $6,450,000 Web Id#: WN123643
Brian Hazen970.920.7395 | [email protected]
PRIVATE VIEW ESTATE … IN PRESTIGIOUS FIVE TREES
NEW LISTING
NEW LISTING
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13�
by STEWarT OkSENHOrNTHE WEEkLy CONVERSATION
C L O C k W I S E f R O M T O P ; P H O T O B y j E R E M y S W A N S O N / A S P E N S k I I N g C O . ; P H O T O B y A T S U S H I N I S H I j I M A ; P H O T O B y P A T S U d M E I E R
COMPLETE LOCAL LISTINgS ON PAgE 25
Aspen Highlands will be open for skiing through April 21 and again the weekend of April 27-28 (at least).
it’S MiD-SPRiNG,andthebig-nameactsarelookingforaudienceselsewhere.Timeforthevalley’syouthtostartblossomingonlocalstages.TheTheatreAspenSchoolpresentsitsspringyouthproductionof“The Little Mermaid, Jr.”(ThursdaythroughSaturday,April18-20),basedontheDisneytaleofyoungAriel,wholongstoliveabovethesea.Asisits35-yeartradition,theentireAspenCountryDaySchoolrelocatesintotheWheelerOperaHousetopresentanoriginalmusical:“OnceUponaTwist”(April26-27),anoriginaltale,writtenbytheeighthgrade,abouttwoyounggirlsdiscoveringadifferentnotionof“realityTV.”OnMay11,localmusicinstructorRussellCattaneoushershis45students,ages5to16,fromtheRockandRollAcademyforsomehead-bangingfun.AlloftheabovearetheWheeler.Downvalleykidsgetthespotlight,too.SoLTheatreCo.presents“JamesandtheGiantPeach”atCarbondaleMiddleSchoolFridaythroughSunday,April19-21andApril26-28.
ColoRADo NAtivEandformerCU,BoulderfilmstudentDerekCianfrancearrivedasafullyformedauteurwith2010’s“BlueValentine.”Thefilmtookadaringtoneforitsstoryofsex,violenceandregret,andaboldnarrativestyle,withtheactioncross-cuttingbetweentimeperiods.ButtherealmarkofthefilmwasCianfrance’stouchwithactorsMichelleWilliams,whoearnedanOscarnomination,andRyanGosling.CianfranceteamsagainwithGoslinginanothergrittyone,“The Place Beyond the Pines.”Thefocusisonamotorcyclestuntriderentangledwithaneagerrookiecopandacorruptpolicedepartment.Co-starringEvaMendes,BradleyCooperandRayLiotta,thefilmopensFriday,April19,inAspenandElJebel.
fILM
kIdS’ STUff
CurrENTEVENTS
Thinkbackafewmonths—say,toNov.22.ThatwasThanksgivingDayandIrememberwalkingoffthefeastbystrollingintodowntownAspenwithfriends,dressedinT-shirtsandsandals.Therewasnosnowandlittlepromiseofanytocomeandwewerestaringinthefaceanotherskiseasonlikethepreviousone:anuninspiringbummer.Fastforwardtorightaboutnow,andwhatI’vegotaresatisfyingmemoriesofpowderdays,aseasonthatkeptgettingbetterandbetterintomid-April,andthesortofappreciationthatcomesonlywiththetotallyunexpected.Andit’snotover:lookingahead,there’satleasttwomoreweekends(thescheduledclosingonSunday,April21,andtheannouncedextension,SaturdayandSunday,April27-28)onASPEN hiGhlANDSthatarealmostcertaintobewonderful.Ineverwouldhaveimagined,headingintotheendofApril,thattheproblemwiththe2012-’13seasonwouldbeanover-abundanceofoptimism.
dOWNHILL
Ryan Gosling stars in Derek Cianfrance’s “ The Place Beyond the Pines,” opening Friday, April 19, in local theaters.
The Rock and Roll Academy has its annual spring concert in May at the Wheeler Opera House.
�A S P E N T I M E S . C O M / W E E K L Y
BRIAN HAZEN PRESENTS...
Brian Hazen, CRS
vice president/broker associate970.379.1270 cell970.920.7395 [email protected]
Coldwell BankerMason Morse Real Estate
www.masonmorse.com
FB/Brian-Hazen-Presents TW/@BrianHazenAspen LN/Brian Hazen
EAST ASPEN COUNTRY ESTATE• Just minutes East of downtown Aspen towards
Independence Pass• The ideal setting for the outdoor enthusiast. • bed/. bath country home built with hand-hewn logs
from Aspen Mountain
• On private fenced acres and overlooks a stocked trout pond, large manicured lawn, the Roaring Fork River and lush elk meadows.
Price Reduced
,, PRICE REDUCED - ,,
SNOWMASS CANYON RANCH…ON THE ROARING FORK• acre property with two acre tracts of land, each
with a building right of square feet (with purchase of a TDR)
• The historic Wheatley Ranch was homesteaded in
• Almost mile of “Gold Medal” Roaring Fork River frontage, spring-fed ponds, senior water rights
• historic log cabins, farm house and outbuilding.
,,
New Price
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13�
CLaSSIC aSPENLEgENdS & LEgACIES by TIM WILLOuGHBY
P H O T O C O U R T E S y B . B I S H O P / W I L L O U g H B y C O L L E C T I O N
CoAl MiNES MAy CoNtAiN carbonmonoxidegasthatcanbuildtoalevelthatistoxictohumans.Canaries,bysickeningfromthegasbeforeminerscoulddetectit,warnedofimpendingdoom.MineralminessuchasthoseinAspenexperiencedgasproblems,butnotcommonly.
InAspen’sminestheinhalationoftoxicgaseswasnotsomuchofaproblemaswasthelackofavitalgas—oxygen.Minerscouldenteratunnelsectionthathad“dead”gas:alackofoxygen.Inashortamountoftimeanexposedminerwouldblackout,andunlesssomeonepulledhimfromthearea,hewoulddie.
Deathfromgasesorlackthereofwasextremelyrare,buttheoccasionalincidentsparkedstories—aspowerfulawarningasadeadcanaryinacoalmine,especiallyfortheyounganduninitiated.Onesuchstorytoldhowanon-minerlosthislifeinthetunnels.
Inthe1930stheHopeMineintheCastleCreekvalleywasstilloperating,albeitonasmallscale,whenapartyofteenagerschoseitasthevenueforanundergrounddate.HowardDeMaris,thesonofan
Aspenundertaker,andTedCooperdrovetheirdatestothemineatnight,aftertheminecrewhadleftfortheday.Notintendingtostayinsidethetunnelforlong,theylefttheircarlightson.
Thenextmorningtheminecooknoticedthecarlightsswitchonandthebatterydeadandwhenhesawthatthecarwasunoccupied,hebeganasearch.Hefoundthefour
inthetunnel,overcomebythe“gas.”DeMariscouldnotberevived,buttheotherswererescued.
DeMaris’deathwasnottheresultofdeadair.Hiswastheresultofsomethingaminer
wouldhaveavoided:trappedtoxicgasesfromtheexplosivesusedinmining.Duringmineoperation,ventilationsystemspushedoutsideairtothebackofthetunnels.Afterdetonatingexplosives,minersdidnotre-enteranareauntilventilationdilutedandmovedtheresultingtoxicgasesaway.Usuallydetonationswerescheduledfortheendoftheday,withminers
notreturninguntilthefollowingmorning.
DeMarisandhispartyenteredtheareanotlongafteradetonation.
Myfatherexperiencednearfatalgasexposureonlyacoupleoftimesduringhis30yearsunderground,andonlyonceinAspen.Aspenminersweremindfulofthepossibility,butrarelyworkedaloneandsensedproblemslongbeforeafatalityoccurred.Lifeseemedsimplerthen:althoughtheremayhavebeenmorehazards,peoplehadtheresourcestodetectandrespondtothemintime.
Tim Willoughby’s family story parallels Aspen’s. He began sharing folklore while teaching for Aspen Country Day School and Colorado Mountain College. Now a tourist in his native town, he views it with historical perspective. Reach him at [email protected].
“canary in the coal mine” is a frequently used metaphor today, but the phrase originated with a mining life survival reality. Although Aspen’s mines did not employ canaries, they would have been useful in at least one instance.
CaNarY IN THE MINE: NOT SIMPLY a METaPHOr
IN THE 1930S THE HOPE MINE IN THE CASTLE CREEk VALLEy WAS STILL OPERATINg, ALBEIT ON A SMALL SCALE, WHEN A PARTy Of TEENAgERS CHOSE IT AS THE VENUE fOR AN UNdERgROUNd dATE.
Aspen youth of the 1920s on a date in the Smuggler Mine seemed unaware of underground dangers.
�A S P E N T I M E S . C O M / W E E K L Y
FrOM the VauLTLEgENdS & LEgACIES compiled by THE aSPEN HISTOrICaL SOCIETY
P H O T O C O U R T E S y O f T H E A S P E N H I S T O R I C A L S O C I E T y
Pa r T Y T I M E
1975CLOSING DaY aT GrETL’S
“lookiNG foR oNE MoRE GooD tiME,” proclaimedTheAspenTimesonApril10,1975,“celebratingwhateveritwasthatwasover.Winter,skiing,working,freezing,orjusttheweekend.Whatever.Goodtimes,ofcourse,arewhereveryoufindthem.Anditwasthekindofdaywhenyoucouldfindthemjustaboutanywhere.Andre’spartywasone.Outontheslopeswasanother.Andsowasjustwalkingdownthesidewalk,orsittingontheporch.Oreven,ifitcamerightdowntoit,workingbyanopenwindow.Winterwillreturn,italwaysdoes,blowingacoldspellthoughthevalley.Butitwasstillanicedayforaparty.”
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 1310
GEar of the WEEkfROM ASPEN, WITH LOVE
P H O T O C O U R T E S y O f U T E M O U N T A I N E E R
Springtime in the Rockies means the door opens wide on a range of sports, but it also means variable weather. Be prepared
with the Mammut women’s Keiko jacket — a lightweight jacket with structured outer material that makes it perfect for a wide
range of activities. From late-winter hiking and offseason travel to multipitch rock climbing and mountain biking, the Keiko’s
small packing volume makes it the ideal companion on all tours. — Ute Mountaineer staff
MaMMuT WOMEN’S kEIkO JaCkET
• Adjustable hem drawstring• Fixed, adjustable hood• 2 front pockets with bonded, watertight zippers• Pre-shaped sleeves with Velcro cuffs• Zippered underarm ventilation system
NEEd TO kNOW
$1��
11A S P E N T I M E S . C O M / W E E K L Y
www.luckydayrescue.org
LUCKY DAY ANIMAL RESCUE OF COLORADO
OGD THEWEEK
Lucky Day has a love story of our own. Meet Margaret and Hickory a delightful bonded pair that must be adopted together. Margaret is a 55 pound lab/ chow mix and Hickory is a 45 pound Basset Hound. Both dogs are 6 years old, calm and mellow. Margaret loves to cuddle and Hickory loves to lounge. They are both great on a leash and enjoy long, slow walks. It is especially endearing to see Hickory frequently look over his shoulder to make sure Margaret is close behind. They both are well mannered inside and are both housebroken. Margaret and Hickory enjoy the company of people, other dogs and even cats. They have each other, now all they need is their forever home. Margaret and Hickory are spayed/neutered, micro chipped and current on their vaccinations. If you are interested, please visit our website at www.luckydayrescue.org and complete and application, or for questions contact Stephanie at 303-478-0662.
Margaretand
Hickory
www.luckydayrescue.org
LUCKY DAY ANIMAL RESCUE OF COLORADO
OGD THEWEEK
Gracie is a sweet & loving purebred “Scott-type” American Bulldog. She is just stunning in person - She looks like a small Great Dane! Her foster Dad thinks she is best dog he has had. She loves to go on walks but she is known to be a couch potato... and thinks of herself as a lap dog. Also, she is MORE than happy to join you in bed if invited. Gracie is low energy when she needs to be but loves to get out to walk. She lived in a loving home but they could not keep her because of the baby’s allergies. She is a little white around the eyes, but she is only 6 years old. Gracie ignores other dogs, walks well on the leash and is obedience trained. She also does not mind cats and children - although she would prefer to live with kids 7 and older. This sweetheart will make a loving companion & a life long best friend! Gracie is spayed, up-to-date on shots and microchipped. Please fi ll out an application at www.luckydayrescue.org then call 303-478-0662.
Gracie
Your BEST FRIEND is waiting for YOU!
OPEN 7am-6pmEVERY DAY
970.544.0206Aspen/Pitkin Animal Shelter
101 Animal Shelter Road ◆◆◆◆◆ www.dogsaspen.com
CALIGentle, soft-spoken,3-year-old Pit Bull
mix. Gets along wellwith people + other
dogs. Shy withstrangers, but bondstightly with people
once she knows them.Has separation
anxiety, so she will dobest in a patient,
knowledgeable home.
SAMStrong, energetic,
black/white 5-year-old female BostonTerrier mix with asplash of Pit Bull—larger than a typical
Boston. Outgoingand very friendly.Loves people. Best
as only pet.
CLEOBeautiful, friendly,
soft-spoken9-year-old Husky
mix female. She is aretired sled dog
looking for a lovinghome. Outgoing
with people.
ALLIE4-year-old gorgeous
Lab/Pit Bull mixfemale. Such a sweetgirl. Allie is happy,
friendly, affectionateand energetic.
Turned in becauseof housing.
PUFFYBeautiful, 2-year-
old, black andbrown-colored,
long-haired Tabbywho gets along well
with people andother pets. She has athick, healthy coat
and looks like aMaine Coon Cat.LOTS OF GREAT
CATS—COME VISIT!
JACKIEBeautiful, friendly,
11-year-old AmericanFoxhound/Husky mixwho gets along well
with people and otherdogs. Jackie is a
retired sled dog whocame to the shelterwith her brothers.
ROXYLarge 7-year-old
black/tan Sharpei/Rottweiler mix
female. Must be theonly pet. Has
guarding issues w/toys and food. Needs
an owner with thetime and patience to
work with her.Loving once she gets
to know you!
BUCKMellow, friendly
11-year-oldAmerican
Foxhound/Huskymix who gets along
well with people andother dogs. Buck is aretired sled dog whocame to the shelter
with his siblings.
DERMAGorgeous Siberian
Husky female,approximately 4
years old. Athletic,with lots of good
energy, andaffectionate with
everyone. Would dobest in a home with
an ownerknowledgeable
about Huskies.This isa very sweet dog!
HUNTER3-year-old medium-
size Chow mix,found wandering
around Aspen. Waryof strangers, butfriendly once heknows you and
trusts you. Lovestreats. Will need aresponsible owner.
JIMOutgoing, energetic,
11-year-old American
Foxhound/Husky mixmale. Gets along
well with people andother dogs. A retired
sled dog. Sohandsome!
LUCYGentle, friendly,
affectionate,3-year-old Pit Bull
female foundwandering thestreets of LA.
Hardest dog tophotograph to show
how sweet she is.Please visit her!
ICE13-year-old Husky mix
female. Tall +gorgeous. Best withmale dogs. Enjoys
hikes. Greatpersonality + very
sociable. Loves people.Has been at the shelter
for a long time butwould really enjoy aloving home with her
very own family.
TIMBERSoft-spoken, sleek,friendly, 9-year oldHusky mix who gets
along well withpeople and other
dogs. She is a retiredsled dog who
deserves acomfortable,loving home.
RODEORodeo is an eight-year-old Australian
Cattle Dog mix malewho gets along well
with people andother dogs. He is
sweet and friendly.Rodeo has come tothe shelter, throughno fault of his own,
due to housing.
Happy Anniversary to Jim Hayes from Mary Eshbaugh Hayes
Today, April 18th, 2013 would have been our 60th anniversary
We were married April 18th, 1953 in the AspenCommunity Church and spent the next almost 60 years
in our little house across the way on Bleeker St.
Here we are in 2005 working together in Jim’s Silversmithing Shop
WWW.ASPENTIMES.COM | 970-923-3414
It is getting warmer, snow is melting…
time to think about Summer!
Please contact your local advertising representative to reserve your space in Summer in Aspen today!
Aspen’s only ART exclusive publication
Please contact a sales manager today to book your ad!
970.925.3414
www.aspentimes.comwww.aspentimes.com/artinaspen
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 131�
“thE bESt PlACEtodrinkaglassofwineistheplacethatyoucurrentlyoccupy.”
Sogoesthejoke.Andwhileitmaybetrue,someplacesarebetterthanothersforenjoyingyourfavoritegrapes.Thewine-tastingexperiencemaybeenhancedbyotherworldly
views,impeccableserviceandmostimportantlybythecompanyyoukeep.
OverthepastfewyearsIhave,well,consumedmorethanmyfairshareofvino.Thisisnotbragging,mindyou.RatheritissimplyanhonestassessmentoftheburdenIbearhappilyintheprocessofwriting
thiscolumnonaweeklybasis.Perhapsmymostuniquewine-
tastingexperiencetookplacethispastyearat8a.m.onaMondayinSeptember.ThevenuewasaPilatus,asingle-engineSwiss-madegemofanairplanethatservesasthe“bus”forKendall-Jacksonwinemakersastheyvisittheirfar-flungvineyardsupanddownthecoastofCalifornia.MytastingcompanionswereLaCremaWinery’swinemakerElizabethGrant-Douglas,herassociatewinemakerEricJohannsen,andthewinery’sassistantwinemaker,KiwiCraigMcCallister.
ThetriowasontheirwaytovisitvineyardsinMonterreyCounty,andIwasalongfortheride.Notwantingtowastetheopportunity,ElizabethbroughtalongaselectionofLaCrema’scurrentreleasesforanearlymorningtasting.AswetookofffromtheSantaRosaairport,thevineyardsofSonomaCountywerevisibleasthefogliftedbelow.Whilecoffeeismynormalbeverageofchoiceatthathour,the2011LaCremaChardonnay,SonomaCoast,wasabeautifulaccompanimenttothescenicflight.Itseemedsuchan…appropriate…waytostartthisweekjustbeforetheharvest.AndIassureyou,wineataltitudedoestastebetter.AtleastitdidonthisSeptemberday.
Anotherhigh-altitudelocationwhereIlovetositandtastewineisdownstateinourfellowresortofTelluride.Loominghighabovetown,adjacenttotheTelluridegondolastopat10,551feet(justshyof2mileshigh),isAllred’sRestaurant.Whileitisone
offourrestaurantsinTelluridetohavebeenhonoredwiththeWineSpectatorAwardofExcellenceforitswinelist,itistheviewthatmakesthisplacestandout.TheremaybeamorebeautifulplacetosipaglassofPinotNoirinColorado,butIdon’tknowwhereitwouldbe.
Outtheenormousglasswindows,onegazesatthestatelymountainpeaksthatformtheboxcanyonprotectingTelluridefromtherestoftheoutsideworld.Atdusk,astheskyturnspink,thenorange,explodingwithflamingcolors,thelightsofthesmallminingtowntwinklebelow.Theeffectisintoxicating,especiallywhenyouget,say,twoglassesintoyourbottle.
WhiletheremaynotbeaviewtocompetewiththatofAllred’s,averydifferentbutequallyelevatedwineexperiencecanbefoundrighthereinAspenattheElement47restaurantintheTheLittleNellhotel.Perhapsnowhereinthecountrywillyoufindsomanygreatwinesandsomanyeducatedsommelierswithwhomtodrinkthem.ThiscolumnhaschronicledmanyexperiencesandpersonalitiesfromTheNellovertheyears,butsufficeittosaythatitmaybethesinglebestplacetoaskforawinelistinAmerica.
Butbeyondthoselocations,allofwhichIwouldbehappytodrinkwineatanytime,thebestplaceinmyopiniontodrinkwineisinthevineyard.Theveryplacethatgavebirthtothewine.Thereissomethingsoprimal,soorganic,sospecialaboutgoingtoavineyardsite,especiallywithawinemakerwhohadahandintheproductionofthewine,andopeningabottle,pouringaglassandtakingasipintheintheshadeofthevinesthatoriginallybequeathedit.
PerhapsmyfavoritetastingofthepastyeartookplaceonthesametripastheLaCremaflight,withRandyUllom,headwinemakerforKendall-Jackson.PartofJessJackson’samazingacquisitionofCaliforniavineyardspriortohisdeathin2011includesaplotoflandinSonomaCounty’sKnightsValley.ThisvastvineyardishometoanenormouspatchofCabernetSauvignonfromwhichUllommakeslimitededitionreleasesundertheKendall-JacksonVineyardEstatesSeriesmoniker.
Thatday,wecrestedthehillandsurveyedthevineyardsfarbelow.Randyreachedforabottle,twisted
thecorkandpouredaglassforeachofus.Hethenshowedmethebottle,andthereonthelabelwasasketchthatcorrespondedperfectlytothevistabeyondhim.Thebottleof2005Kendall-Jackson’sHighlandEstates“TraceRidgeVineyard”KnightsValleyCabernetSauvignonwasillustratedwithanexactdepictionofMountSt.Helena.Andthere,justbehindus,wasthemountainitself.
Weliterallydrankthelandscape.
Kelly J. Hayes lives in the soon-to-be-designated appellation of Old Snowmass with his wife, Linda, and a black Lab named Vino. He can be reached at [email protected].
WOrDS to DrINk BY
IN THE VINEYarD: THE BEST PLaCE TO DrINk a GLaSS OF WINE
KElly J.HayES
P H O T O S B y k E L L y j . H A y E S ; B O T T O M P H O T O , O P P O S I T E P A g E : P H O T O C O U R T E S y O f T H E L I T T L E N E L L
WINEINk
LEFT: Winemaker Elizabeth Grant-Douglas sips a glass of La Crema on a flight to vineyards in Monterrey County.
BELOW: The Trace Ridge label perfectly depicts the surrounding landscape.
1�A S P E N T I M E S . C O M / W E E K L Y
by kELLY J. HaYES
Kendall-Jackson: www.kj.com
Element 47: www.element47aspen.com
Allred’s Restaurant: www.allredsrestaurant.com
k.j.’S SUggESTION
TOP: There is no better place to taste the grapes than where they come from.
LEFT: Element 47 at The Little Nell boasts one of the state’s top wine lists, making it a perfect place to enjoy a glass.
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 131�
fROM ASPEN, WITH LOVE FOOD MaTTErS
NoW thAt thEoffseasonhasallbutarrivedandmanyrestaurantsaretakingawell-deservedoffseasonbreak,thereisnobettertimeforexploringsomeofthestandout
diningoptionsontheFrontRange.DenverandBoulderhaveemergedoverthelastfewyearsasasceneforvariedcuisinewithcontinuedhomerunsbyahandfulofprovenprofessionals,andsomeyoung,experimentalchefs.Rightnow,taking
thefamilytoDenveronaculinaryadventuremaybejustwhattheoffseasondoctorordered.
OStERiA MARcO 1453 LARiMER, DEnVERSetinahistoricbuilding,thereisnobettersettingonaspringorsummereveningthanthepatioofOsteriaMarco.I’veeatenhereseveraltimes—withandwithoutkids—andhaveneverbeendisappointed.Thesettingisonlysecondtothemenu:delightfulItalianclassics,burrattawithgrilledItalianbread,bisteccawithgrilledasparagus,andthebestrabbitdishIhaveeverhad,servedoveraParmesancarrotbrood(broth).Bestseatinthehouse:OnthepatioorinthewindowseatsoverlookingLarimer.
EucLiD HALL BAR & KitcHEn 1317 14tH St. At LARiMERWitharousingbarsceneandexceptionallycraftedfare,EuclidHallisacausaleaterywithelevatedpubfood,thinkfreshhand-crankedsausage,poutineandbeefmarrowbones.LedbycelebratedchefJenniferJasinski(alsoofnearbyRiojaandBistroVendome),Euclidpresentsthefreshestingredientswithinnovativepreparations,incrediblecocktailsandbeerlist,anditsdailyspecialisalwaysworthatry.Greatportions,laid-backatmosphere.
NeedImentionagainhowamazingthebeerlistis?
tHE KitcHEn (uPStAiRS)1039 PEARL St., BOuLDERTheKitchenhasbecomeaFrontRangediningjuggernaut.Withtwofinedininglocations–oneinBoulder,whichalsoincludes“Upstairs”(thelounge)and“NextDoor”(thepub),andanotherlocationinDenverat153016thSt.(theentranceisonWazeeStreet),thiswasmyfavoritediningexperienceofallonarecenttriptothebigcities.Everythingonthemenuisnew,freshandexciting—andmadeinsmallplatestoshare.Yes,theytoohaveamazingwine,beerandcocktailselectionswhichisn’tallthatsurprising,buttheserversknowledgeofbothfoodanddrinkmakesyouwanttopullupabarstoolandjuststartdiscussing.ThereisavibeofexcitementinthechiccommunityspaceatUpstairs,butitisn’tstuff.WithmytwokidsIsatatthecommunitytable.Imetseverallocalswhogaveusgreatrecommendationsandenticedmychildrentotryanarrayofpickledvegetables,flatbreadwithlaquerciaprosciuttoandburrata(whocanresistmorecheese!)andfreshlymadetomatosoupamongotherbites.Icouldhavespenttheentirenightnibbling,clinkingandtalkingaway.WithlargewindowsthatoverlookthebustleofPearlitwastheperfectdoseofcitylifethatthismountaingirlwasseeking.
tHE GREEn RuSSELL 1422 LARiMER, DEnVERReadyforacocktail?ThisundergroundjointandanotherofFrankBonanno’sempiriclocations,isaboutascoolastheycome.WhenIwalkedinJazzwasbeingplayed,vestedandmustacioedattendantsscrambledbehindthebarastheytradedfreshlysqueezedjuicesand
classiccocktailglasseslinedthebar.It’sunderground,it’sexperimental,andwhileitcouldusealittlemorecreativityinthespiritselectionitself(it’snoJusticeSnow’sintermsoforiginality)theambianceisanythingbutboring.Agreatspottomeetfriendsandactlikerealgrown-ups.
Amiee White Beazley writes about dining, restaurants and food-related travel for the Aspen Times Weekly. She also works at Woody Creek Distillers in Basalt. Follow her on Twitter @awbeazley1, or email awb@awbeazley.
ESSENTIaL FOOD aND DrINk dESTINATIONS ON THE fRONT RANgE
aMiEE wHitE BEazlEy
P H O T O S C O U R T E S y O f T H E k I T C H E N C A f E
Above: A selection of “nibbles” entices diners of all types.
Right: The community table sets the vibe for the Kitchen’s collection of restaurants.
1�A S P E N T I M E S . C O M / W E E K L Y
by aMIEE WHITE BrEazLEY
rECIPEMuSSELS StEAMED witH GARLic CouRteSy oF the KitChen (upStaiRS)SeRveS aBout 4
inGREDiEntS1 tablespoon extra-virgin olive oil2 cloves garlic, sliced1 tablespoon fresh thyme leaves (removed from stems)1 cup dry white wine2 pounds fresh live mussels, cleaned1 tablespoon finely chopped Fresno chili pepper1/2 cup heavy cream Salt and pepper, to tasteExtra-virgin olive oil, for drizzling
PROcESSplace a large pot over medium heat and add olive oil, chili, garlic and thyme. Reduce heat to low and sauté for 10 minutes, stirring occasionally. Add wine and bring to a boil. Add mussels. Cover and steam until mussels open, about 3-5 minutes.
Add cream. Taste and adjust seasoning with salt and pepper. put mussels into bowls, generously pouring over the sauce and drizzle lightly with olive oil.
nOtESA delicious, easy and elegant appetizer. Serve with fresh or grilled bread.
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 131�
fROM ASPEN, WITH LOVE GuNNEr’S LIBaTIONS
P H O T O C O U R T E S y O f j I M M y ’ S
2 ounces Suerte reposado
1/4 ounce luxardo maraschino liquor
1/4 ounce antica carpano sweet vermouth
Dash of orange bitters
Mix and serve in a double rocks glass over ice and an orange peel.
NEEd TO kNOW
THE PaCO MarTINEz
Jonesing for the beach, now that it’s offseason in
Aspen? we are. But since our travel plans won’t have
us sipping margaritas in Mexico any time soon, we’ve
found the next best thing right here at home. Yes, we’ll
be bellying up to the bar at Jimmy’s, where the selection
of fine tequila can’t be beat — nor can the creative
ways the bartenders have found to serve it up. case in
point: the Paco Martinez, a tequila-centric version of the
classic gin Martinez. created by Jimmy’s Jacob Hatty,
this strong but refreshing cocktail, with a small twist of
bitter and orange, is sure to get you in the mood for the
summer season ahead.
Gunilla Asher is taking a break from the bar scene, so we’re
turning this page over to you. Email jmcgovern@aspentimes.
com with what cocktails you’re mixing, what libations
you’re drinking, what tastes have tempted your tastebuds
and we’ll share them with our readers. Cheers!
1�A S P E N T I M E S . C O M / W E E K L Y
ARTS&ENTERTAINMENT MuSIC/arT/FILM/LITEraTurE
Simone Dinnerstein & Tift Merritt, “Night” (Sony Classical)“tRAvEliNG AloNE,”TiftMerritt’sexcellent2012album,earnedthecountry-folkishsinger-songwritercomparisonstoEmmylouHarris.Justafewmonthslater,andMerrittisaddingJoniMitchellandBillieHolidaytothelistofsingersshedeservesbeingmentionedalongsideof.Thougheventhatundersellshowboldanduniquethisprojectis.
Merritt’sequalpartnerhereisSimoneDinnerstein,apianistwhomadehernamewithadistinctive2007recordingofBach’sGoldbergVariations,andwhohasmadeseveralappearancesattheAspenMusicFestival.On“Night,”bothmusiciansstretchintoanewfieldofclassical/folk,where
thereisroomfortunesbySchubert,LeonardCohenandjazzpianistBradMehldau,aswellasacoverof“ICanSeeClearlyNow,”andwherepiano,harmonicaandacousticguitarmingleharmoniously.Arealstretchandarealachievement.
Dinnerstein & Merritt perform July 16 at the Aspen Music Festival.
Black Rebel Motorcycle Club, “Specter at the Feast,” produced by Black Rebel Motorcycle Club (Abstract Dragon)SAN fRANCiSCo’S BlackRebelMotorcycleClubestablishedintheearly’00sthatitsfoundationwasheavyrock,influencedlargelybythegarage.Overtimethetriohasshownadesiretoexpanditsreach;“Howl,”from2005,incorporatedAmericanaandgospelintothesound.“SpecterattheFeast,”theirseventhalbum,findsB.R.M.C.backinloudermode,withguitaristPeterHayescrankingthevolumeon“TeenageDisease”and“SellIt,”anddrummerLeahShapiroinpoundingmode.Eveninthefewslowermoments,theheavinessremains.Butthegroupleavesplentyofroomforpsychedelicflourishesandhintsofblues,and“SpecterattheFeast”soundsinventive.On“Returning,”IeventhinkIheardanacousticguitarunderallthatsludge.
Black Rebel Motorcycle Club makes its local debut May 21 at Belly Up.
Ben Harper & Charlie Musselwhite, “Get Up!” (Stax)bEN hARPER(43,California-bred,rockstarguitarist)andCharlieMusselwhite(69,Mississippinative,harmonicaplayer)bothhavesomenativeAmericanbloodinthem.Muchmoretothepointthoughon“GetUp!”—theirfirstalbumtogether—isthebluesthatrunsintheirveins.ThetworunthroughZeppelinesqueblues-rock(“IDon’tBelieveaWordYouSay”),front-porchacousticpicking(“YouFoundAnotherLover(ILostAnotherFriend)”),anunusualDeltagospel-waltz(“WeCan’tEndThisWay”),andothervariationsontheblueswithouteverstrayingfromabluesfoundation.Harperwroteallthesongsanddoesallthesinging;Musselwhitegetsplentyofroomforhisharmonica.
Harper & Musselwhite play June 22 at the Jazz Aspen Snowmass June Festival.
SOuND SaMPLEr
by STEWarT OkSENHOrN
WHO’S PLAyINg IN ASPEN/SNOWMASS ANd THE SOUNdS THEy’RE BRINgINg
P H O T O B y L I S A - M A R I E M A z z U C C O
Bombino, “Nomad,” produced by Dan Auerbach (Nonesuch)A MEMbER of Africa’snomadicTuaregtribe,Omara“Bombino”MoctargrewupinNiger,wheretheTuaregweresometimesbannedfromplayingguitar,andspenthisteenyearsinLibyaandAlgeria.Still,hedevelopedafascinationwiththeelectricguitar,andstudiedEricClaptonandMarkKnopflerbywatchingvideos.The33-year-oldstepsclosertoWesternmusicwithhissecondalbum,“Nomad,”whichwasrecordedinNashville,producedbyDanAuerbachoftheBlackKeys,andincludessomeAmericanmusicians.Bombino’sstyleremainsgroundedinWestAfrica,butwithintriguingshadesofbluesandcountry.
Bombino makes his local debut May 29 at Belly Up.
Devendra Banhart, “Mala,” produced by Banhart and Noah Georgeson (Nonesuch)oN “GolDEN GiRlS,”theopeningsongon“Mala,”DevendraBanharturgeslistenersto“Getonthedancefloor.”Despitetherepeatedcommand,IdoubtthatBanhart’smusicwillfilladancefloorwithgyratingbodies;apartfromthat,Banhart’smusicfillsmostofthepurposesyou’dwantmusicto.
On“Mala,”the31-year-oldVenezuelan-American’seighthalbum,themusicmystifieswithoddballreferences(onesongisaddressedtothe12th-centuryGermanwriterSt.HildegardvonBingen;anothertothelateprofessionalskateboarderKeenanMilton),themovingaboutfromSpanishlyricstoEnglish,theappearance,againstafolk-ish
background,ofdiscobeatsandbossanovarhythms.ButBanhart’smusic,despitethevarietyofcomponents,iscomfortingandintegrated,hishushedvoiceservingasawarminvitationinsidehisunusualworld.(Onetuneistitled“Won’tYouComeOver,”anotheris“Won’tYouComeHome.”)Andthereisalsoadarkedge;thefinaltrack,“Taurobolium”—thetitlereferstoanimalsacrificeinancientbull-fighting—repeatedthephrase,“Ican’tkeepmyselffromevil.”
Strangeheregetsturnedintosublime,andyoucanseewhytheterm“freakfolk”wasinvented.
Devendra Banhart makes his local debut May 4 at Belly Up.
JJ Grey & Mofro, “This River,” produced by Dan Prothero and Grey (Alligator)thE NoRthERN floRiDAbandMofrohashardlylefttheswamp.Butwithitsseventhalbum,“ThisRiver,”thegroupinchescloserto,say,Memphis.BandleaderJJGrey’svoiceslipsintofull-onsoulshoutingon“YourLady,She’sShady,”andthealbumfeaturesorganandsmoothhornarrangements,reminiscentoftheiconicMemphislabelStax,on“TameaWildOne.”
JJ Grey & Mofro performs June 7 at the Snowmass Mammoth Festival.
The duo of Tift Merritt, left, and Simone Dinnerstein have released their first album, “Night,” and will perform in July at the Aspen Music Festival and School.
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 131�
Aspen | 970.925.6060 Snowmass | 970.923.2006 Basalt | 970.927.8080 Carbondale | 970.963.4536
AspenSnowmassSIR.comA rtfully uniting extraordinary homes with extraordinary lives.
4 bedrooms, 4 baths, 5,812 sq ftRedlands Mesa - Grand Junction, COSpectacular Colorado National Monument views, outdoor pool, hot tub$1,900,000Sharon Hall | 970.618.4957
Spectacular Redlands Mesa Home
3 bedrooms, 2 baths, 976 sq ft3 blocks from gondola next to parkHead on views of Aspen MountainLow HOA dues, pets allowed$1,195,000Wendy Wogan Williams | 970.948.8948
Remodeled Downtown Aspen Gem5 bedrooms+guest house, 5.5 baths, 6,263 sq ftOutstanding views on 3.5 acres, elevatorPrivate, yet only minutes to AspenAdjacent parcel available for $295,000$2,300,000Tory Thomas | 970.948.1341
Grand Dame of Basalt4 bedrooms, 3.5 baths, 2,500 sq ftLarge patio/deck, mature landscapingPrivacy & views a short drive from town!Additional FAR available, no transfer tax$3,500,000 $2,150,000Jeff Pogliano | 970.379.3383
Great Mountain Valley Home
Two spectacular, private homesitesBetween 10th green & 11th tee of Maroon Creek Golf CourseGorgeous views of Aspen HighlandsLot 2 – $3,250,000Lot 3 – $2,500,000Craig Morris | 970.379.9795
Premier Golf Course Lots
Desirable River Cove neighborhood4 bedrooms, 4.5 baths, 2,745 sq ftEnjoy sounds of the Frying Pan RiverStroll to downtown Basalt via swinging bridge$1,250,000Ted Borchelt | 970.309.3626Jana Dillard | 970.948.9731
Downtown Basalt’s Finest
2.76 acres to play!5 bedrooms, 4.5 baths, 4,819 sq ftTakes advantage of acres of open spaceConvenient, yet in a protected community$3,200,000 $2,800,000Karen Toth | 970.379.5252
Red Rock Ranch Estate
Comfortable farmhouse on 35.5 acres4 bedrooms, 4.5 baths, 3,600 sq ftBordered on one side by BLM with viewsEnjoy as is or remodel to your liking!$1,495,000 $1,395,000Jana Dillard | 970.948.9731Ted Borchelt | 970.309.3626
Sopris Mountain Ranch Views...
Beautiful English Tudor home4 bedrooms, 3.5 baths, 3,853 sq ftMeditation studio with yoga wallLarge deck overlooks Frying Pan River$1,699,000Carter Budwell | 970.309.0991
River Serenity
New Listing
Access to Black Canyon National Monument3 bedroom, 2 bath, 2,346 sq ft homeHouse on 35 acres - $1,200,000House on 1,000 acres - $1,900,000(includes 2 addt’l 35 acre building sites)Carol Dopkin | 970.618.0187
Sunrise Ranch...Colorado Paradise!4 bedrooms, 3.5 baths, 2,674 sq ftUnique corner lot offers endless possibilitiesEasy access to skiing, within walking distance of Aspen School District$2,875,000Holly Goldstein | 970.948.4824
Meadowood Home
New Listing
Beautiful homesite with stunning viewsStream adjacent the building envelopeExcellent ski access to Adams AvenueSeller financing available$2,295,000Terry Rogers | 970.379.2443
Woodrun Homesite with Ski Access
Central Core Condo on River’s EdgeNewly refurbished, clean and sleek
directly on the Roaring Fork RiverNewly remodeled exterior with elevator2 bedrooms, 2 baths, 965 sq ft
and the Gondola
$1,359,000 Furnished
Mark Haldeman | 970.379.3372
Castle Creek Hideaway
almost 50 acres
with 1,000 sq ft of unfinished space
allowed
Fingers”, and the Conundrum Valley
$1,595,000Rick Head | 970.274.2627
1�A S P E N T I M E S . C O M / W E E K L Y
Aspen | 970.925.6060 Snowmass | 970.923.2006 Basalt | 970.927.8080 Carbondale | 970.963.4536
AspenSnowmassSIR.comA rtfully uniting extraordinary homes with extraordinary lives.
4 bedrooms, 4 baths, 5,812 sq ftRedlands Mesa - Grand Junction, COSpectacular Colorado National Monument views, outdoor pool, hot tub$1,900,000Sharon Hall | 970.618.4957
Spectacular Redlands Mesa Home
3 bedrooms, 2 baths, 976 sq ft3 blocks from gondola next to parkHead on views of Aspen MountainLow HOA dues, pets allowed$1,195,000Wendy Wogan Williams | 970.948.8948
Remodeled Downtown Aspen Gem5 bedrooms+guest house, 5.5 baths, 6,263 sq ftOutstanding views on 3.5 acres, elevatorPrivate, yet only minutes to AspenAdjacent parcel available for $295,000$2,300,000Tory Thomas | 970.948.1341
Grand Dame of Basalt4 bedrooms, 3.5 baths, 2,500 sq ftLarge patio/deck, mature landscapingPrivacy & views a short drive from town!Additional FAR available, no transfer tax$3,500,000 $2,150,000Jeff Pogliano | 970.379.3383
Great Mountain Valley Home
Two spectacular, private homesitesBetween 10th green & 11th tee of Maroon Creek Golf CourseGorgeous views of Aspen HighlandsLot 2 – $3,250,000Lot 3 – $2,500,000Craig Morris | 970.379.9795
Premier Golf Course Lots
Desirable River Cove neighborhood4 bedrooms, 4.5 baths, 2,745 sq ftEnjoy sounds of the Frying Pan RiverStroll to downtown Basalt via swinging bridge$1,250,000Ted Borchelt | 970.309.3626Jana Dillard | 970.948.9731
Downtown Basalt’s Finest
2.76 acres to play!5 bedrooms, 4.5 baths, 4,819 sq ftTakes advantage of acres of open spaceConvenient, yet in a protected community$3,200,000 $2,800,000Karen Toth | 970.379.5252
Red Rock Ranch Estate
Comfortable farmhouse on 35.5 acres4 bedrooms, 4.5 baths, 3,600 sq ftBordered on one side by BLM with viewsEnjoy as is or remodel to your liking!$1,495,000 $1,395,000Jana Dillard | 970.948.9731Ted Borchelt | 970.309.3626
Sopris Mountain Ranch Views...
Beautiful English Tudor home4 bedrooms, 3.5 baths, 3,853 sq ftMeditation studio with yoga wallLarge deck overlooks Frying Pan River$1,699,000Carter Budwell | 970.309.0991
River Serenity
New Listing
Access to Black Canyon National Monument3 bedroom, 2 bath, 2,346 sq ft homeHouse on 35 acres - $1,200,000House on 1,000 acres - $1,900,000(includes 2 addt’l 35 acre building sites)Carol Dopkin | 970.618.0187
Sunrise Ranch...Colorado Paradise!4 bedrooms, 3.5 baths, 2,674 sq ftUnique corner lot offers endless possibilitiesEasy access to skiing, within walking distance of Aspen School District$2,875,000Holly Goldstein | 970.948.4824
Meadowood Home
New Listing
Beautiful homesite with stunning viewsStream adjacent the building envelopeExcellent ski access to Adams AvenueSeller financing available$2,295,000Terry Rogers | 970.379.2443
Woodrun Homesite with Ski Access
Central Core Condo on River’s EdgeNewly refurbished, clean and sleek
directly on the Roaring Fork RiverNewly remodeled exterior with elevator2 bedrooms, 2 baths, 965 sq ft
and the Gondola
$1,359,000 Furnished
Mark Haldeman | 970.379.3372
Castle Creek Hideaway
almost 50 acres
with 1,000 sq ft of unfinished space
allowed
Fingers”, and the Conundrum Valley
$1,595,000Rick Head | 970.274.2627
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13�0
CLOSING DaYS arE GLOrY DaYS
by aMaNDa CHarLES
you just came off the hillafterwhatmayhavebeenyourlastrunoftheseason.Itwassickupthere—almost11inchesoffreshpowderovernight—andyou’resmilingbecauseyouknowthatforthelastfivemonths,youchasedthesnowlikeacopchasescrime:determined,flashyandaggressiveonallfronts.
you ARE StokED;notjustbecauseyoucameouttoexploretheAspenfantasylifeofpicturesandmovies,butbecauseyoufinallygettobeapartoftheeventallyourfriendshaveampedyouupfor—anoccasioneveryonecountsdowntofromtheirveryfirstturnoftheseason,andanexperienceyouknowwillremaininyourmemoryformonths,perhapsevenyearstocome.
YouchangeoutofyourgearandintothecostumeyoucraftedoutofanoldT-shirt,jeans,painterstapeandablueandredstripedhat.Fromthestreetyoucanheartheoverflowofpeoplecheering—energeticandloudagainsttherepetitivethumpofabasswompinginandoutbetweenopendoors,andforamomenttheanticipationovercomesyou.
Themanatthedoorgreetsyouwithawristbandbeforesteppingasidetowelcomeyouthrough.Almostimmediatelyyouspotyourfavoritebartenders,slingingdrinksinfullcostumeandtossingbottlesbetweenoneanotherlikeplayersonaballfield.Upongettingadrink,youlooktoyourrighttoseeamandressedinaWinniethePoohonesie,andtotherightofhimamandonningacowsuit.
Atlast,youthinktoyourself,youarehome.Weavinginandoutbetweencrowdsofanimals,gapers,Stoligirlsand
agrandsupplyofWaldocharactersdressedtomatchtheparty’s“Where’sWaldo,Bro?”theme,youmeetupwithyourfriendsjustintimetohearDJDylanandspecialguestJesseSeelyofChicagoduelingitoutontheboardswithasuper-sweetmatchup.
Knowingthatitcouldn’tpossiblygetanybetterthanthis,youturntofaceyourbudsandthrowyourdrinkintheair.Justasthebeatdropsabody-shakingvibration,youyelloutascreamtotoastthefinaldayoftheseason;onecelebratedbyendlessdaysofshreddin’thegnar,unforgettabletimeswithfriendsandlivingoutanadventurethatcouldn’tbereplicatedanywhereelse.
Thisisclosingday;thedaywhenallthekookscomeouttotaketheirfinalruns,danceinexpressionoftheirdesiresandgetweirduntilhoursaftersunset.It’satimewheneveryonesaystheirgoodbyesbeforetravelingback
TALES fROM LOCALS WHO WRITE THEIR OWN ‘ASPEN EXTREME’
P H O T O B y d A N I E L B A y E R / A S P E N S k I I N g C O .
Highlands closing day — the grandaddy of all closing day parties.
�1A S P E N T I M E S . C O M / W E E K L YT O P P H O T O S B y j E R E M y S W A N S O N / A S P E N S k I I N g C O . ; R I g H T - H A N d P H O T O B y A M A N d A C H A R L E S ; A S P E N T I M E S f I L E P H O T O
hometoseethefamily,orboardsaplanetotakeavacationacrossthecountry.It’sacelebrationofpassionbeyondresponsibility,successesormaterialgains,andatimewhenlocalsacknowledgemorethananyotherdayintheyearthesignificanceofthelineweallknowverbatim:“ThisisAspen.Thingsarealwaysdifferent.”
Theevolutionofclosingday“oNE of thE MoStdefiningcharacteristicsofclosingdaysinAspenisthatforthemostpart,theyareundefined,”saidDylanRegan,longtimelocalandDJonthesceneattheSky’sclosingpartyonApril14.
AccordingtoDylan,whogothisDJstartbackinthelate’90sbythrowinghousepartiesinSnowmassandsellingmixedtapestobarsaroundtown,closingdayshavegenerally
beennotoriousforchaoticandover-the-topcelebrations,yettraditionallyunorganizedasawhole.
Intheeventofaclosingdayparty,herecalls,planningisusuallyleftinthehandsofthemerchantswhorunthevenuesatthebase.Butwhenitcomestooutlandishcostumesandpeopleskiddingonpondswithhandcraftedboats,therealparty,hesays,isleftinthehandsofthepartygoersthemselves.
Suchisthecasewiththetown’smostsought-afterclosingdayparty,AspenHighlands,wherepeoplefromfarandwidecometoexperiencethemayhemfirsthand.
Buthowexactlydidtheclosingdaypartyevolvefromgangsofskiersgatheringtotoastaseason’sendtoaweek-longaffairshapedbythemeparties,pondskimming,neon-crazy,’70sretro-costume-wearingdebauchery?
ForDylan,whowasaskedbylocalradiostationKSPN10yearsagotoDJapromotionalpartyatthebaseofHighlandsonclosingday,thecelebrationbeganwithhumblebeginningsandhassincegrownlargerwitheachpassingyear.
“TherewasaguybythenameofJeffPicassowhoranthebasespotatHighlands,anditwashimwhohadtheideatoelevatethepartyandreallybrainstormsomethingbig,”Dylansaid.“Peoplehavetypicallyalwaysworn’70soutfitstotheparty,butoverthelastfiveyearsitreallyblewup,withthousandsofpeoplewearingcostumesanddancingaroundonarubberdeck,thefloorboardsbouncingupanddownlikeatrampolineandsendingpeopleandspeakersflyingallovertheplace.”
Thus,Dylanbelieves,thebirthofHighlandsclosingcametobe,andbeforelongothermountainvenues—
likeAjax,SnowmassandButtermilk—begantailoringtheirclosingdayeventstoparallelthesomewhataccidentaltraditiontheHighlandspartyevolvedinto.
Now,closingdayeventshavebecomeastapleofourcommunity,invitingcelebrationslikeBaconAppreciationDayatButtermilk,whereeventplannershostbartendingcompetitionsandserveupdrinkandfoodwitheverythingbacontoskiersandsnowboarders;theSnowmassBaseBashwiththeSchneetagcompetition,whereparticipantsbuildfloatsandthenattempttoskimoverastandingpond;andthelatestattheSky,whereathemepartyarrangedbyagroupofpartyplannersfromChicagospecificallygavethankstoallthepeopleinthehospitalityindustrywhoputintheirhardworktomaketheseasonanothermemorableone.
Clockwise from top left: Hiking the Highland Bowl on closing day; Schneetag at Snowmass; closing party at the Sky; pond-skimming at Highlands.
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13��
AllBAMatSkyHotel“i’vE bEEN CoMiNGtoAspenthepastfiveyearsjustforHighlandsclosingdayalone,”saidJoeQuade,creativedirectorofLunaticsofBaminChicagoandforerunnerforthisyear’sAjaxclosingpartyattheSkyHoteltitled,“Where’sWaldo,Bro?”“Highlandsisalwaysawildparty,butafterlastyear’slackofsnowfallandendingdecisiontomoveclosingdayupaweek,notasmanypeopleshowedupanditkindofthrewoffthevibe.”
QuadeteamedupwithhiscollegebuddyWesKubica,afulltime
bartenderat39Degrees,torevivetheclosingdayexcitementandpindownadestinationthatwouldelevatetheatmosphereandmakeforalastingmemoryforthosewholeavetownatseason’send.Heclaimstheideatobeavehicleforlocalstohavefuninthebiggestwayimaginable.
“WewantedtodoitinawaythatwouldamplifythepartysceneinAspentosomethingyoumightfindinaclubindowntownChicago,withacostumetheme,sponsors,casesofCO2,videographers,DJsspinningtables,partyfavors,satellitebarsand
tonsofenergy,”hesaid.Andthematictoalldegreesitwas,
ashundredsofWaldolookalikesshowedupafteradayskiingAjaxtogetlooseatwhatendedupbeingoneofthebiggestpartiesoftheyear.
“OnthefirstdayoftheseasonI’malreadygettingexcitedforthelastdayoftheseason,”saidKubica,“andifthereeverwasapartythatwasorganizedtothecore—onethatscreamedfunandallowedpeopletobetheirgoofyselves—theWaldopartywasit,andwearealreadylookingforwardtogoingbiggernextyear.”
when was the first-ever closing day celebration? is there a year that stands out as the best ever? How has the closing day culture changed?
Many newcomers, myself included, hold nostalgic curiosities for what skiing was like back in the day; the free-spirited hippies, the drug-influenced Beatniks and the ski-gang scoundrels who made Aspen the place it is today. we tend to wonder, do we dress up because we want the old days back, or do we dress up because in some ways, the old days never really left?
if there is one person who beholds the truth to these newcomer curiosities, Klaus Obermeyer — the 94-year-old ski pioneer and spirited yodeler — is the man with all the answers.
Aspen Times Weekly: when was the first closing day party you can remember? what was it like?klAus Obermeyer: the first closing day party i remember was in the spring of 1948 — that was before grooming was brought to Aspen. we had a lot of fun in spring snow and had a few drinks on the bottom of the Little nell lift. closing day is always nice to catch up with friends, get some final turns in, laugh out loud and have fun.
ATW: in your opinion, what is the origin of the closing party? which mountain was the first to have a celebration?kO: it was Aspen Mountain naturally because it was the first mountain that had lifts! Everyone who worked and skied there were always excited to have an end of the season celebration.
ATW: How has the culture of the closing parties changed or evolved over the years? Have people always worn retro clothing and funny-looking costumes?kO: the culture hasn’t changed a whole lot – we celebrate with friends the wonderful winter and enjoyed our last day on the mountain. it used to be that you wore what you always wore skiing, perhaps a little less clothing because of the beautiful spring sunshine. And then it came you would spot a few costumes, such as a bear outfit, which was funny. nowadays, it’s quite a spectacle to see all the creative and different outfits people are putting together to celebrate this day. i say, go for it!
ATW: which year would you pick to be the best closing day of your skiing career? what made it so memorable?kO: For me, it is an equal celebration each and every year to put in the last run to close the season. Each season is special for different reasons, but i must tell you, i am thankful for every day i am out skiing in our wonderful mountains of Aspen — remember, every day you don’t ski you don’t get back.
PARTINg WORdS fROM AN ASPEN LEgENd
Clockwise from top: Snowmass, circa 1970; Aspen Highlands, 1998; Schneetag at Snowmass, 2013; Aspen Mountain, 1969.
T O P T H R E E P H O T O S C O U R T E S y O f T H E A S P E N H I S T O R I C A L S O C I E T y , L I N d E R C O L L E C T I O N ; B O T T O M P H O T O B y j E R E M y S W A N S O N / A S P E N S k I I N g C O .
��A S P E N T I M E S . C O M / W E E K L Y
BALLBrian Speck and his mother, Karin Speck.
fILM Kip Hubbard and Bryant Mattieson of Aspen Film welcome guests to the Academy Awards party.
The SOCIaL SIDE of TOWNAROUNdASPEN The SOCIaL SIDE of TOWNAROUNdASPEN
WINTEr MEMOrIES
i thiNk WiNtER iS ovER,soIwillputthelasttwowinterpartiesinthisweek’scolumnandhopeto
seespringcolumnsstartingnextweek!
AspenFilmhelditssixthannualfundraisingpartytocelebratetheAcademyAwardsrecentlyattheCaribouClub.Theeventwasco-chairedbyAspenFilmboardmemberandeventplannerEsther
Pearlstone andCaribouClubco-ownerBilly Stolz.TheglamorousfestivitiesincludedawalkdowntheredcarpetinCaribouAlleyandacranberry-raspberrymargaritacreatedbySnowmass-basedStrippedMixers,dinner,andalivetelecastofthe85thannualAcademyAwards.
Earlierinthewinter,agroupofAspenitesheldtheir37thannualShitkickersBallwhereeveryoneworetheirbestWesterngarbandenjoyeddinneranddancing.UsuallyheldattheHotelJerome,itwasattheSt.MoritzthisyearastheJeromewasbeingremodeled.
HostsincludedKyle Boyd, Bobbie Brazzell and Roger Nicholson, Michael Buysse, Sandra and Jim Dukas, Jamie and Maurice Emmer, Melinda Fouts, Nell Graham, Helen Klanderud, Tita and Dan McCarty, Pat and Ed Peterson, Joan and Kent Shodeen, Dick Stahura, Kathy and Dick Stephenson, Jackie Van Woerkom and Lun Woodward.
Undercurrent...I’mbeginningtothinkthat“protectingAspen’scharacter”isjustabunchofrhetoric.Whyelsedoesthecityallowgiganticlarge-scalehomestobebuiltlot-linetolot-lineinsmall-scaleVictorianneighborhoods?
Mary ESHBaugH
HayES
B A L L P H O T O S B y M A R y E S H B A U g H H A y E S ; f I L M P H O T O S C O N T R I B U T E d B y A S P E N f I L M
fILMParty emcee Oliver Sharpe, Aspen Film board president Howard Gross, Aspen Film executive director Kip Hubbard and his wife, Robin Hubbard.
by MarY ESHBauGH HaYES
fILMParty co-chairs Esther Pearlstone and Billy Stolz.
fILMAlex Halperin, publisher of Aspen Peak, Laura Thielen, creative director of Aspen, Film, and Erin Lentz, editor of Aspen Peak.
PARTINg WORdS fROM AN ASPEN LEgENd
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13��
fILMMarcy and Howard Gross and Joyce Shenk.
fILMChi Chi Villaloz and Torre.
BALLLinda Desoto and John Werning.
BALLJohanna and Wayne Payne.
fILMTables were decorated with award-shaped cookies.
BALLJohn Pennington and Janis Nark.
B A L L P H O T O S B y M A R y E S H B A U g H H A y E S ; f I L M P H O T O S C O N T R I B U T E d B y A S P E N f I L M
BALLMary Doyle and Disco Dan are seated and Larry MacIntyre is standing.
BALLHeidi Hoffmann and Tom Grifffith.
fILMKip Hubbard watches Torre interview Lee and Steve Ritvo on the red carpet.
��A S P E N T I M E S . C O M / W E E K L Y
liVE EntErtainMEntThursdAy, April 18The Soul Rebels 9:30 p.m., Belly Up Aspen, 450 S. Galena St., Aspen. The Rebels’ music celebrates life in the New Orleans style. Call 970-544-9800.
FridAy, April 19Mord Fustang 9:30 p.m., Belly Up, 450 S. Galena St, Aspen. Beatport Music awards’ breakthrough artist of the year in 2012. Call 970-544-9800.
The Shack Nasites featuring Nate Biro 9:30 p.m., Aspen Brewing Company, 304 E. Hopkins Ave., Aspen. No cover. Call 970-920-2739.
sATurdAy, April 20Jes Grew and Pegi Young & The Survivors 9 p.m., Belly Up, 450 S Galena St., Aspen. Call 970-544-9800.
sundAy, April 21Alt-J with Wildcat! Wildcat! 8:30 - 11 p.m., Belly Up, 450 S. Galena St., Aspen. Call 970-544-9800.
WednesdAy, April 24DJ Muggs with Nas-Ja 9:30 p.m., Belly Up Aspen, 450 S. Galena St., Aspen. DJ Muggs incorporates elements of various electronic-music genres, including glitch and dubstep, with hip-hop. Call 970-544-9800.
tHE artSThursdAy, April 18Booksigning and discussion — “The Great Deformation: The Corruption of Capitalism in America” 5:30 - 6 p.m., Explore Booksellers, 221 E. Main St., Aspen. Call 970-925-5336.
Theatre Aspen’s “The Little Mermaid Jr” 7 - 8:30 p.m., Wheeler Opera House, downtown Aspen. Tickets: $15 for adults, $10 for students. Visit www.aspenshowtix.com or call 970-920-5770.
Train Dreams Book Club 5:30 - 6:30 p.m., Pitkin County Library. We’ll discuss “HHhH” by Laurent Binet. Sign up for next month’s read, and get a free book on a first-come, first-served basis. Call 970-429-1900.
FridAy, April 19Art Opening: Kathy Chamberlin, “ViSuaL KoMBat” 6 - 8 p.m., Woody Creek Community Center. The show will feature sculptural works with printed paper, masks and multimedia photography. Show runs through May 15. Call 970-922-2342.
Sara Ransford: The Eloquent Edge 9 a.m. - 5 p.m., Wyly Community Art Center, 99 Midland Spur, Basalt. An exhibition of contemporary ceramic wall pieces by Sara Ransford. Free and open to the public. Call 970-927-4123.
Theatre Aspen’s “The Little Mermaid Jr” 7 - 8:30 p.m., Wheeler Opera House, downtown Aspen. Tickets: $15 for adults, $10 for students. Visit www.aspenshowtix.com or call 970-920-5770.
sATurdAy, April 20Aspen Community Dance 6:30 - 10 p.m., Rio Grande Commons, 455 Galena St., Aspen. Open dancing with music by Disco Dan, featuring West Coast swing, country western and disco. Free pizza and drink with discounted beer. No partner required. $15 for single and $25 for couple. Call 970-925-8536.
Theatre Aspen’s “The Little Mermaid Jr” 7 - 8:30 p.m., Wheeler Opera House, downtown Aspen. Tickets: $15 for adults, $10 for students. Visit www.aspenshowtix.com or call 970-920-5770.
Freaker Prom Party Benefit for PAC3 8 - 11 p.m., PAC3, Carbondale. Dress in traditional prom attire, but show your freak flag — the freakier the better. DJ Harry will perform. Photo booth, spiked punch, appetizers and more. Doors open at 7:30 p.m. For more information and tickets, visit www.pac3carbondale.com, Dos Gringos, Thunder River Market or Deja Brew Coffee. Call 970-618-8032.
sundAy, April 21Aspen Art Museum Family Workshop 3:30 - 5 p.m., Aspen Art Museum, 590 N. Mill St., Aspen. To register, please call or email [email protected]. Call 970-925-8050 (ext. 24).
Local author reading 4 - 5 p.m., The Red Onion, 420 E. Cooper Ave., Aspen. Former general manager of The Red Onion, Tom Elder, will be reading from his novel, “It’s All About the Timing.” Copies will be available for signing. Call 970-618-9584.
Literature Out Loud 3 - 4 p.m., Pitkin County Library. This month’s theme, “Younger Voices,” features literature read by young readers. Aspen High School senior Luke Seamans and 2011 graduate Erin Daniel will read from Steven Millhauser and Margaret Atwood. Call 970-429-1900.
TuesdAy, April 23World Book Night 5 - 7 p.m., Aspen Middle School library. Readers of all ages are invited. Light refreshments will be served, and books will be given away. Call 970-925-3760, ext. 2367.
Latin dance 7 - 10 p.m., Aspen Red Brick Dance Studio. Learn the spicy partner moves of salsa, merenge bachata and the circular salsa line dance called salsa rueda. Instruction by Heather Morrow. Email [email protected] to register. Call 970-948-3963.
WednesdAy, April 24Argentine tango 6:30 - 10 p.m., Aspen Red Brick Dance Studio. Learn to follow and/or lead the culturally iconic ballroom dance of the heart. No partner necessary. Instruction by Heather Morrow. Email [email protected] to register. Beginning close-embrace: 6:30 to 7:30 p.m. Intermediate mixing salon/milongero: 7:30 to 8:30 p.m. Practilonga: 8:30 to 10 p.m. Call 970-948-3963.
aPrIL 18 - 24, 2013THELISTINgS
heAr The soul rebels, a brass band from new Orleans, plays Thursday, April 18 at belly up.
P H O T O B y S T E W A R T O k S E N H O R N
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13��
BMW X3 Xdrv 2008
22,000 OBO9703190878
GMC Denali Yukon XL 2006
$17,800970-618-0960
Subaru Outback 2005
SOLD!!!
CagivaGran Canyon 2000
4,500970-274-0109
Jeep Patriot 2008
$9500970-987-2851
Subaru Outback LL Bean 2002
SOLD!!
Chevy Custom Deluxe 20 - 1977
Skidoo Summit Rev XP - 2008
2006 Voyager Trailer Ride
$6000 for everything OBO.970-376-2290
Suzuki Aerio 2003
$3500 OBO970-456-7534
CHEVY SEDAN 1934 HOT ROD
SWEET RIDE!!!
$24,000 970-456-3291 (Rifle)Serious Inquiries only
Subaru Outback 1997
$5000970-379-3238
VW TDI Wagon 2002
$9500. OBO970-309-1004
Dodge Dakota 2006
$11,500970-309-9528
Subaru Outback 1999
$4,500 obo970-963-7411
YamahaWR 450 2008
$4800.00970-274-4134
CUSTOM BUILDERS
No job too small ortoo big!
Call Joe 303-587-2549
AVALANCHEAUTOMOTIVE LLC
98 Subaru Forester,
Avalancheautosales.com
(720)346-4443
Energy Efficient Lighting
COMPUTER SUPPORT
Toyota Tundra 2007
$18,800970-948-3592
Ford Fusion 2007
65k miles. Passed Dealerships.
$8500 OBO970-309-6924
LocaL Marketplaceplace aN aD >> aspenTimes.com/pLacead | (970) 925-9937 | fax (970) 925-5647 | [email protected] | More at aspeNtiMes.coM
925-9937 • www.aspentimes.com/placead
AutoPhoto Ads
Work!Thousands of others have proven this by selling their
vehicle in this section.4 Sale
More than 165 million people
read a newspaper in print or online in a typical week.
Feel the power. 80 percent of
adults in house-holds earning
$100,000 or more read a newspaper in print or online
each week.Can you fix just about anything?
Advertise your handyman
business in theService [email protected].
Did you know more people read a newspaper on a
typical Sunday than watched the 2011
Super Bowl?
Please Recycle
��A S P E N T I M E S . C O M / W E E K L Y
VINTAGE SLED$50 obo.
call: 970 404 1701
RON"THE GOLD GUY "
ronthegoldguy.com
Records Wanted
2007 S-WorksEnduro
$1500970.306.9544
$ 5.000 ...R E W A R D
RAFTS
Women's RideSnowboard andBindings - $285
White Goose EstateSales is holding HUGECharity Estate Sale.
0062 County Rd. 113.
Quality TeamMembers
“SOLD”“SOLD” No other
advertising vehicle has the reach of
newspapers.
Nationally, 104 million adults read a newspaper on an
average weekday and more than 115 million
on an average Sunday.
To place your Classified ad
– in print and online- please call
866-850-9937 or e-mail
Please Recycle
Try a border for just
five bucks!
New Unfired AR-15 Rifles
ServiceDirectory.
Always in print, always online
and always affordable.
Our Classified Advertising staff
is ready to schedule your
Service Directory ad.Call
866-850-9937or e-mail
[email protected] Recycle
Gosh, thanks. More than 71
percent of adults read a newspaper in print or online
each week.
Hoarders be gone.Advertise your clean-
ing business in the Service Directory.
Always in print and online. Classifieds@
cmnm.org.
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13��
restaurant opening!
Please apply in person Tuesday-Friday between 11 a.m.-3 p.m.
At the Limelight Hotel at 355 S. Monarch Street or call 602-553-2113 to schedule an interview.
Email resumes to:[email protected]
Sous Chef
AviationHangar Space
Available Rifle Airport
Mid-Valley Offices
Office 135 W. Main,Aspen $600/mo. Call 970-379-3715
Photographer
news photog-rapher
experiencewith programs such asAdobe PhotoShop andAdobe Illustrator. Skillas a videographer is aplus.
Interested candidatesshould send resumewith cover letter tell-ing us why you are thetop candidate for thej o b t [email protected].
3 B D / 3 . 5 B A . LANDSCAPE EXPERT
First Month 1/2 Off!3BD/2.5BA,
Townhome, 1 cargar,
$975/month970-618-6237
970-319-4463
HUNTER CREEKPROPERTIES INC.
VILLAGE GREENTOWNHOMES!
STAFF HOUSING
Summer housingavailable now in
Snowmass Village$550 per room
Call Leasing Office970-922-9001 or
www.aspensnowmass.com/housing
Visitor ServicesAssistant/Reception
Please email resumew / c o v e r l e t t e r t [email protected]
6 BD 5 BA 1 Partial baths
Aspen Family gem!
Realtors: Do you have a “retreat”
for sale?
84 percent of vaca-tion-home buyers said the primary reason for buying
a second home was to use the property for vacations or as a family retreat. To place a Real Estate Photo Ad in print
and online -
call 866-850-9937 or e-mail
Please Recycle
Please Recycle
Color makesyour classified ad
stand out.
SOLD... GUARANTEED!
Auto Photo Ads work.Please Recycle
Sell your vehicle,guaranteed,
when you place an auto photo ad
for a month!
Color makesyour classified ad
stand out.
No rain, or snow, on this parade.
Advertise your roofing company in
the Service Directory. [email protected].
Try a border for just
five bucks! Caught Ya Lookin’
… Yellow really
does stand out!
Sell your vehicle,guaranteed,
when you place an auto photo ad
for a month!
��A S P E N T I M E S . C O M / W E E K L Y
Close A Loan In Thirty Days?No Problem!!!
At Mountain Mortgage, we don’t believe that it should take forever and a day to get your loan approved and closed.
While others promise, we perform!
225 North Mill Street, Suite 202, Aspen, CO 81611(970) 925-5490 [email protected]
Marilyn Foss, President NMLS #267478
Aspen - $3,200,000
ASPEN CORE 1/2 DUPLEX
Mary Ellen Sheridan
Aspen - $3,200,000
!!! BEST CORE ASPEN MT VIEW LOT !!!
Mary Ellen Sheridan
Aspen - $44,995
BEST DEAL IN TOWN!
Scott Lupow
Aspen - $525,000
SOUTHFACING VIEWS OF ASPENMOUNTAIN
Mary Ellen Sheridan
Commercial Eagle - $65,000
PRICE REDUCED!!!Want to own Eagle County?
MOBILE
Ginny Cassano
Eagle Ranch - $415,000
Kim Bradley
El Jebel - $335,000
Mid Valley Location!
Mike Kennedy
Florida - $55,000,000
Mansions in the Sky
Ryan & Matt Podskoch
Glenwood Springs - $249,000
Cute and Cozy
Amy Luetke
New Castle - $395,000
Nestled on the 12th hole
Amy Luetke
New Castle - $449,000
Don't compromise, this home has it all!
Amy Luetke
Silt - $319,000
ROOM TO ROAM!!!
Mike Kennedy
Glenwood Springs - $389,000
TIP-TOP-SHAPE
Michelle James
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13�0
�1A S P E N T I M E S . C O M / W E E K L Y
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13��
DISTRICT COURT, WATER DIVISION NO. 2, COLORADO
TO: ALL INTERESTED PARTIES
Pursuant to C.R.S. 37-92-302, you are hereby notified that the following case is a portion of the resume of applications and amendments ordered published during the month of March 2013, in Water Division No. 2. The Water Judge ordered this case be published in The Eagle Valley Enterprise in Eagle County, Colorado.
The name(s) and address(es) of applicant(s), description of water rights or conditional water rights and description of ruling sought as reflected by said application, or amendment, are as follows.------------------------------------------------------------------------------------------------------------CASE NO. 2013CW20; Previous Case Nos. 84CW202, 93CW35 and 02CW71 – CITY OF COLORADO SPRINGS, Acting Through Colorado Springs Utilities, c/o M. Patrick Wells, P.E., P. O. Box 1103, Mail Code 930, Colorado Springs, CO 80947-0930 (Please address all correspondence to: Michael J. Gustafson, City Attorney’s Office – Utilities Division, 30 South Nevada Avenue, Suite 501, Mail Code 510, Colorado Springs, Colorado 80903 (719) 385-5909)Application for Sexennial Finding of Reasonable Diligence and to Make Partially Absolute Conditional Water Rights in the Arkansas River and its TributariesIN TELLER AND EL PASO COUNTIES, COLORADO2. Conditional Water Right and Structures Involved: Colorado Springs’ Local Exchange Plan, involving the structures described in Paragraph 3.F below. 3. Describe conditional water right, including the following information from the Referee’s Ruling and Judgment and Decree: A. General: This Application involves Applicant’s appropriative rights of exchange and reuse originally decreed on June 16, 1987, in Case No. 84CW202 (the “Local Exchange Plan”). The water for the Local Exchange Plan is derived from transmountain sources flowing into Fountain Creek from Applicant’s wastewater treatment facilities. The decree for the Local Exchange Plan entered by the Court on June 16, 1987, in Case No. 84CW202 excluded all issues and claims of use, reuse and successive use by exchange of water derived from Applicant’s transmountain sources from the irrigation of lawns, gardens, parks, landscaping and all other similar uses within the areas served by Applicant, accruing to Fountain Creek and its tributaries (“Non-Sewered Return Flows”). The Non-Sewered Return Flows were the subject of a separate decree entered by this Court on July 17, 1991, in Consolidated Cases No. 84CW202, 84CW203, 86CW118(B) and 89CW36. B. Date of Original Decree: June 16, 1987, Case No. 84CW202, District Court, Water Division No. 2. C. Subsequent Decree Awarding Findings of Diligence: Case No. 02CW71 District Court, Water Division No. 2, entered March 6, 2007; and Case No. 93CW35 District Court, Water Division No. 2, entered May 15, 1996. D. Appropriation Date: April 30, 1975. E. Decreed Use: All beneficial uses for which the water to be exchanged and reused are decreed, including those set forth in the Decree in Case No. 84CW202. F. Decreed Legal Description and PLSS Description (structures involved in exchange): i. StructuresUsed for the Delivery of Reusable Sewered Return Flows: a. Las Vegas Street Wastewater Treatment Facility Outfall, located on Fountain Creek in the SE¼ SW¼ of Section 20, Township 14 South, Range 66 West of the 6th Principal Meridian in El Paso County. PLSS: In the SE¼ of the SW¼ of Section 20, T. 14 S., R. 66 W. of the 6th P. M. at a point 583 feet from the South Section line and 2176 feet from the West Section line. b. Air Force Academy Wastewater Treatment Facility Outfall, located on Monument Creek in the SW¼ SW¼ of Section 19, Township 12 South, Range 66 West of the 6th Principal Meridian in El Paso County. PLSS: In the SW¼ of the SW¼ of Section 19, T. 12S., R. 66W. of the 6th P. M. at a point 10 feet from the South Section line and 775 feet from the West Section line. c. Any other supplemental or replacement wastewater treatment facility outfall located within the drainages of Fountain Creek or the Arkansas River above its confluence with Fountain Creek and hereafter utilized by Applicant, including any terminal storage facilities hereafter constructed and located to receive Applicant’s wastewater facility discharges. ii. Structures Used to Divert, Store, and/or Subsequently Release Exchanged Reusable Sewered Return Flows: a. Ruxton Creek System. 1. Sheep Creek Intake: A point on the South bank of Sheep Creek whence the Southwest corner of Section 11, Township 14 South, Range 68 West of the 6th Principal Meridian bears South 21° West a distance of 600 feet. PLSS: In the SW¼ of the SW¼ of Section 11, T. 14S., R. 68W. of the 6th P. M. at a point 205 feet from the West Section line and 573 feet from the South Section line. 2. South Ruxton Creek Intake No. 1: A point on the West bank of South Ruxton Creek whence the Northwest corner of Section 14, Township 14 South, Range 68 West of the 6th Principal Meridian bears North 49° West a distance of 2,555 feet. PLSS: In the SE¼ of the NW¼ of Section 14, T 14S., R. 68W. of the 6th P. M. at a point 1938 feet from the West Section line and 1557 feet from the North Section line. 3. South Ruxton Creek Intake No. 2: A point on the West bank of South Ruxton Creek whence the Northwest corner of Section 14, Township 14 South, Range 68 West of the 6th Principal Meridian bears North 51° 40’ West a distance of 2,385 feet. PLSS: In the SE¼ of the NW¼ of Section 14, T.14S., R. 68W. of the 6th P. M. at a point 1880 feet from the West Section line and 1363 feet from the North Section line. 4. Cabin Creek Intake: A point on the North bank of Cabin Creek whence the Southwest corner of Section 11, Township 14 South, Range 68 West of the 6th Principal Meridian bears South 7° 55’ West a distance of 3,020 feet. PLSS:In the SW¼ of the NW¼ of Section 11, T. 14S., R. 68W. of the 6th P. M. at a point 421 feet from the West Section line and 1919 feet from the North Section line. 5. Ruxton Creek Intake at Lake Moraine: A point on the East bank of Ruxton Creek at Lake Moraine Reservoir whence the Southwest corner of Section 22, Township 14 South, Range 68 West of the 6th Principal Meridian bears South 27° 10’ West a distance of 1,070 feet. PLSS: In the SW¼ of the SW¼ of Section 22, T. 14S., R. 68W. of the 6th P. M. at a point 954 feet from the South Section line and 495 feet from the West Section line. 6. Dark Canyon Intake: A point on South Ruxton Creek whence the Northwest corner of Section 14, Township 14 South, Range 68 West of the 6th Principal Meridian bears North 23° 50’ West a distance of 4,330 feet. PLSS: In the SE¼ of the SW¼ of Section 14, T. 14S., R. 68W. of the 6th P. M. at a point 1776 feet from the West Section line and 1214 feet from the South Section line. 7. Lion Creek Intake: A point at the junction of Ruxton and Lion Creeks whence the Northeast corner of Section 15, Township 14 South, Range 68 West of the 6th Principal Meridian bears North 9° 50’ East a distance of 1,600 feet. PLSS: In the SE¼ of the NE¼ of Section 15, T. 14S., R. 68W. of the 6th P. M. at a point 264 feet from the East Section line and 1595 feet from the North Section line. 8. Lake Moraine Reservoir: Located in the Southeast quarter of Section 21 and the Southwest quarter of Section 22, the Northwest quarter of Section 27, and the Northeast quarter of Section 28, Township 14 South, Range 68 West of the 6th Principal Meridian. 9. Big Tooth Reservoir: Located in the Southwest quarter of Section 14 and the Northwest quarter of Section 23, Township 14 South, Range 68 West of the 6th Principal Meridian. b. North Slope System (Fountain Creek). 1. French Creek Intake: A point on French Creek whence the Southeast corner of Section 26, Township 13 South, Range 68 West of the 6th Principal Meridian bears South 80° 43’ East a distance of 1,953 feet. PLSS: In the SE¼ of the SE¼ of Section 26, T. 13S., R. 68W. of the 6th P. M. at a point 140 feet from the South Section line and 1948 feet from the East Section line. 2. Cascade Creek Intake: A point on Cascade Creek whence the Northwest corner of Section 27, Township 13 South, Range 68 West of the 6th Principal Meridian bears North 70° 11’ West a distance of 1,322 feet. PLSS: In the NE¼ of the NW¼ of Section 27, T. 13S., R. 68W. of the 6th P. M. at a point 412 feet from the North Section line and 1279 feet from the West Section line. 3. Crystal Creek Intake: A point on Crystal Creek whence the Northwest corner of Section 17, Township 13 South, Range 68 West of the 6th Principal Meridian bears North 23° 12’ West a distance of 2,735 feet. PLSS: In the SW¼ of the NW¼ of Section 17, T. 13S., R. 68W. of the 6th P. M. at a point 2549 feet from the North Section line and 1148 feet from the West Section line. 4. South Catamount Creek Intake: A point on South Catamount Creek whence the Southeast corner of Section 12, Township 13 South, Range 69 West of the 6th Principal Meridian bears South 37° East a distance of 645 feet. PLSS: In the SE¼ of the SE¼ of Section 12, T. 13S., R. 68W. of the 6th P. M. at a point 387 feet from the East Section line and 480 feet from the South Section line. 5. North Catamount Creek Intake: A point on North Catamount Creek whence the South quarter corner of Section 12, Township 13 South, Range 69 West of the 6th Principal Meridian bears South 47° 45’ West a distance of 1,535 feet. PLSS: In the SW¼ of the SE¼ of Section 12, T. 13S., R. 68W. of the 6th P. M. at a point 1524 feet from the East Section line and 1135 feet from the South Section line. 6. Crystal Reservoir: Located in the Southwest quarter of Section 17, the Southeast quarter of Section 18 and the Northwest quarter of Section 19, Township 13 South, Range 68 West of the 6th Principal Meridian. 7. South Catamount Reservoir: Located in the Northwest quarter of Section 18, Township 13 South, Range 68 West of the 6th Principal Meridian and the Southeast quarter of Section 12 and the Northern half of Section 13, Township 13 South, Range 69 West of the 6th Principal Meridian. 8. North Catamount Reservoir: Located in Sections 11, 12, 13, and 14, Township 13 South, Range 69 West of the 6th Principal Meridian. c. Northfield Collection System (West Monument Creek). 1. Intake No. 1: A point on West Monument Creek whence the South quarter corner of Section 28, Township 12 South, Range 67 West of the 6th Principal Meridian bears South 80° 23’ East a distance of 2,060 feet. PLSS: In the SW¼ of the SW¼ of Section 28, T. 12., R. 67W. of the 6th P. M. at a point 234 feet from the West Section line and 418 feet from the South Section line. 2. Intake No. 2: A point on West Monument Creek whence the South quarter corner of Section 28, Township 12 South, Range 67 West of the 6th Principal Meridian bears South 49° 50’ East a distance of 1,255 feet. PLSS: In the SE¼ of the SW¼ of Section 28, T. 12S., R. 68W. of the 6th P. M. at a point 1351 feet from the West Section line and 844 feet from the South Section line. 3. Intake No. 3: A point on the North Fork of West Monument Creek whence the South quarter corner of Section 28, Township 12 South, Range 67 West of the 6th Principal Meridian bears South 9° 10’ West a distance of 4,288 feet. PLSS: In the NW¼ of the NE¼ of Section 28, T. 12S., R. 68W. of the 6th P. M. at a point 1036 feet from the North Section line and 1914 feet from the East Section line. 4. Northfield Reservoir: Located in the Southeast quarter of Section 25, Township 12 South, Range 68 West of the 6th Principal Meridian. 5. Stanley Canyon Reservoir: Located in Section 19, Township 12 South, Range 67 West of the 6th Principal Meridian. 6. Nichols Reservoir: Located in the Southwest quarter of Section 25 and the Southeast quarter of Section 26 and the Northwest quarter of Section 36, Township 12 South, Range 68 West of the 6th Principal Meridian. 7. Rampart Reservoir: Located in Sections 22, 23, 26 and 27, Township 12 South, Range 68 West of the 6th Principal Meridian. d. Pikeview System (Monument Creek). 1. Pikeview Intake (also known as Monument Creek Pipeline): A point on Monument Creek just upstream from the point where the Garden of the Gods Road crosses Monument Creek, in north Colorado Springs, whence the North quarter corner of Section 19, Township 13 South, Range 66 West of the 6th Principal Meridian bears North 8° 15’ East a distance of 3,189.8 feet. This intake delivers water to Pikeview Reservoir and Pikeview Reservoir No. 2. PLSS: In the NE¼ of the SW¼ of Section 19, T. 13S., R. 66W. of the 6th P. M. at a point 2208 feet from the West Section line and 2124 feet from the South Section line. 2. Pikeview Reservoir: An off-channel reservoir located adjacent to and on the west side of Monument Creek, at a point just downstream from the point where the Garden of the Gods Road crosses Monument Creek, in north Colorado Springs, in the Northeast quarter of the Northwest quarter and in the Northwest quarter of the Northeast quarter of Section 30, Township 13 South, Range 66 West of the 6th Principal Meridian. 3. Pikeview Reservoir No. 2: An off-channel reservoir located adjacent to and on the east side of Monument Creek, at a point just downstream from the point where the Garden of the Gods Road crosses Monument Creek, in north Colorado Springs, in the Northeast quarter of the Southwest quarter of Section 30, Township 13 South, Range 66 West of the 6th Principal Meridian. While Pikeview Reservoir No. 2 was decreed as a structure for conditional appropriative rights of exchange, Pikeview Reservoir No. 2 no longer exists and the land on which the reservoir was located has been sold. Applicant therefore agrees that the conditional appropriative rights of exchange to this structure have been abandoned. e. 33rd Street Diversion Intake (Fountain Creek). The 33rd Street Intake is located on Fountain Creek at 33rd Street in west Colorado Springs, whence the South quarter corner of Section 3, Township 14 South, Range 67 West of the 6th Principal Meridian bears South 12° West a distance of 535 feet. PLSS: In the SW¼ of the SE¼ of Section 3, T. 14 S., R. 67 W. of the 6th P. M. at a point 523 feet from the South Section line and 2535 feet from the East Section line. An alternate point of diversion for the 33rd Street Intake is located at a point on the North bank of Fountain Creek in the Southwest quarter of Section 3, Township 14 South, Range 67 West of the 6th
Principal Meridian, approximately 153 feet upstream of the original point of diversion. The alternate point of
diversion was adjudicated on February 21, 1991, in Case No. 90CW29, Water Division No. 2. PLSS: In the SE¼ of the SW¼ of Section 3, T. 14 S., R. 67 W. of the 6th P. M. at a point 570 feet from the South Section line and 2612 feet from the West Section line. f. Bear Creek System (Bear Creek). The Bear Creek Intake is located on Bear Creek just south of the intersection of Gold Camp Road and Bear Creek Canyon Road, in El Paso County, at a point whence the Southwest corner of Section 15, Township 14 South, Range 67 West of the 6th Principal Meridian bears North 43° 14’ East a distance of 2,280 feet. PLSS: In the SW¼ of the NE¼ of Section 21, T. 14S., R. 67W. of the 6th P. M. at a point 1484 feet from the East Section line and 1656 feet from the North Section line. g. South Suburban System (Cheyenne Creek). 1. SouthCheyenne Creek Intake: Located on South Cheyenne Creek at a point just west of the intersection of Mesa Avenue and South Cheyenne Canyon Road, in southwest Colorado Springs, whence the quarter corner common to Sections 34 and 35, Township 14 South, Range 67 West of the 6th Principal Meridian bears North 35° 16’ East a distance of 1,329.7 feet. This intake delivers water to South Suburban Reservoir and Gold Camp Reservoir. PLSS: In the NE¼ of the SE¼ of Section 34, T. 14S., R. 67W. of the 6th P. M. at a point 795 feet from the East Section line and 1537 feet from the South Section line. 2. North Cheyenne Creek Intake: Located on North Cheyenne Creek at a point approximately one mile west of the intersection of North and South Cheyenne Canyon Roads, in southwest Colorado Springs, whence the Northeast corner of Section 34, Township 14 South, Range 67 West of the 6th Principal Meridian bears North 7° 29’ East a distance of 4,419.2 feet. This intake delivers water to South Suburban Reservoir and Gold Camp Reservoir. PLSS: In the SW¼ of the NW¼ of Section 34, T. 14S., R. 67W. of the 6th P. M. at a point 910 feet from the West Section line and 1460 feet from the North Section line. 3. South Suburban Reservoir: An off-channel reservoir located just north of the intersection of North and South Cheyenne Canyon Roads, in southwest Colorado Springs, in Sections 26 and 35, Township 14 South, Range 67 West of the 6th Principal Meridian. 4. Gold Camp Reservoir: An off-channel reservoir located just north of the intersection of North and South Cheyenne Canyon Roads, in southwest Colorado Springs, in Sections 27 and 34, Township 14 South, Range 67 West of the 6th Principal Meridian. G. Source of Water: The sources of water which are the subject of the Local Exchange Plan are sewered return flows and the reuse and successive use of those return flows derived from sources of supply that are not native or tributary to the Arkansas River. Those sources of supply are Colorado Springs’ ownership interest in the following: i. The Blue River Project which diverts water from the headwaters of the Blue River and its tributaries in Summit County. The 1929 water rights associated with this project were adjudicated by the decree in Civil Action No. 1710 (District Court, Summit County) dated October 26, 1937, and were modified by the decree in Civil Action No. 1883 (District Court, Summit County) dated June 15, 1953. These water rights have an appropriation date of August 5, 1929. The 1948 water rights associated with this project were adjudicated by the decree in Civil Action No. 1806 (District Court, Summit County) dated May 10, 1952, the Final Decree in Consolidated Cases No. 2782, 5016, and 5017 (U.S. District Court, District of Colorado) dated October 15, 1955, and were made absolute by the decree in Consolidated Cases No. 2782, 5016, and 5017 (U.S. District Court, District of Colorado) dated February 26, 1968. These water rights have an appropriation date of May 13, 1948. An additional component of the Blue River Project is water diverted from the Middle Fork of the South Platte River in Park County. Water from the Middle Fork of the South Platte is stored in Montgomery Reservoir pursuant to Priority No. A-207 dated September 5, 1930, by absolute decree dated May 16, 1966, in Civil Action No. 3286, District Court of Park County. ii. The Homestake Project which diverts water from the headwaters of tributaries of the Eagle River in Eagle County. The water rights were conditionally adjudicated by the decree in Civil Action No. 1193 (District Court, Eagle County) dated June 8, 1962. These water rights have an appropriation date of September 22, 1952. Applicant has the right to utilize one-half of the waters produced by the Homestake Project by virtue of the agreement dated June 18, 1962, between the City of Aurora and the City of Colorado Springs. iii. The Fryingpan-Arkansas Project which diverts water from the headwaters of Hunter Creek and the Fryingpan River and its tributaries in Pitkin County. The water rights were adjudicated by the decrees in Civil Action No. 4613 (District Court, Garfield County) dated June 20,1958, and August 3, 1959, and were modified by the decree in Case No. W-829-76 (District Court, Water Division No. 5) dated November 27, 1979. These water rights have an appropriation date of July 29, 1957. a. The application in this case does not give Applicant any rights of use of Fryingpan-Arkansas Project structures, or any rights of ownership or rights to purchase or receive allocation of Fryingpan-Arkansas Project water or return flows from Fryingpan-Arkansas Project water, but does not alter any existing rights Applicant may otherwise have. The amount of Project water available to Applicant is determined by Southeastern Colorado Water Conservancy District’s (“Southeastern”) annual allocations made pursuant to its Allocation Principles, policies, and agreements. Return flows from Project water will be utilized in exchanges only after they are purchased from Southeastern. Applicant’s purchase and use of Project water and return flows therefrom shall be consistent with the Allocation Principles of Southeastern (as they may be amended from time to time), and the lawful rules, regulations, policies, procedures, contracts, charges and terms as may be lawfully determined from time to time by Southeastern, in its sole discretion. The exchange and use of Project water under this application shall be subject to and consistent with the terms of any agreement between Applicant and Southeastern for storage of Applicant’s allocated and purchased Project water and return flows therefrom in non-project facilities. iv. The Independence Pass Transmountain Diversion System (also known as the Twin Lakes Project) which diverts water from the headwaters of the Roaring Fork River and its tributaries in Pitkin County. The water rights were adjudicated by a decree in Civil Action No. 3082 (District Court, Garfield County) dated August 25, 1936, and were modified by a decree in Case No. W-1901 (District Court, Water Division No. 5), dated May 12, 1976. These water rights have an appropriation date of August 23, 1930. Applicant has the right to take and use its pro rata share of the water diverted and stored by the Twin Lakes Reservoir and Canal Company under these water rights. H.Description of Exchanges: i. Exchange and Reuse Program to the Ruxton Creek System. a. Stream Reaches of Exchanges: The reaches of Fountain Creek and its tributaries between the following points: 1. Points From Which Water is Exchanged and Reused: A. The Las Vegas Street Wastewater Treatment Facility Outfalls on Fountain Creek; B. The Air Force Academy Wastewater Treatment Facility Outfall on Monument Creek; and C. Any other supplemental or replacement wastewater treatment facility outfall, including terminal storage facilities, located within the drainage of Fountain Creek or the Arkansas River above its confluence with Fountain Creek. 2. Points To Which Water is Exchanged and Reused: Sheep Creek Intake, South Ruxton Creek Intake No. 1, South Ruxton Creek Intake No.2, Cabin Creek Intake, Ruxton Creek Intake at Lake Moraine, Dark Canyon Intake, Lion Creek Intake, Lake Moraine Reservoir and Big Tooth Reservoir. 3. Amount: 34.70 cfs total for each point from which water is exchanged to each direct flow diversion facility to which water is exchanged, of which 18.50 cfs has been decreed absolute, and 16.20 cfs remains conditional; and 1,590.00 af total from the points which water is exchanged to the storage reservoirs, of which 258.89 af has been decreed absolute, and 1,331.11 af remains conditional. ii. Exchange and Reuse Program to the North Slope System. a. Stream Reaches of Exchanges: The reaches of Fountain Creek and its tributaries between the following points: 1. Points From Which Water is Exchanged and Reused: A. The Las Vegas Street Wastewater Treatment Facility Outfalls on Fountain Creek; B. The Air Force Academy Wastewater Treatment Facility Outfall on Monument Creek; and C. Any other supplemental or replacement wastewater treatment facility outfall, including terminal storage facilities, located within the drainage of Fountain Creek or the Arkansas River above its confluence with Fountain Creek. 2. Points ToWhich Water is Exchanged and Reused: French Creek Intake, Cascade Creek Intake, Crystal Creek Intake, South Catamount Creek Intake, North Catamount Creek Intake, Crystal Reservoir, South Catamount Reservoir and North Catamount Reservoir. 3. Amount: 56.80 cfs total from each point from which water is exchanged to each direct flow diversion facility to which water is exchanged, of which 23.10 cfs has been decreed absolute, and 33.70 cfs remains conditional; and 17,430.00 af total from the points from which water is exchanged to the storage reservoirs, of which 1,538.70 af has been decreed absolute and 15,891.30 af remains conditional. iii. Exchange and Reuse Program to the Northfield Collection System. a. Stream Reaches of Exchanges: The reaches of Fountain Creek and its tributaries between the following points: 1. Points From Which Water is Exchanged and Reused: A. The Las Vegas Street Wastewater Treatment Facility Outfalls on Fountain Creek; B. The Air Force Academy Wastewater Treatment Facility Outfall on Monument Creek; and C. Any other supplemental or replacement wastewater treatment facility outfall, including terminal storage facilities, located within the drainage of Fountain Creek or the Arkansas River above its confluence with Fountain Creek. 2. Points To Which Water is Exchanged and Reused: West Monument Creek Intake No. I, West Monument Creek Intake No. 2, North Fork of West Monument Creek Intake No. 3, Northfield Reservoir, Stanley Canyon Reservoir, Nichols Reservoir and Rampart Reservoir. 3. Amount: 8.90 cfs total from each point from which water is exchanged to each direct flow diversion facility to which water is exchanged, of which 0.28 cfs has been decreed absolute, and 8.62 cfs remains conditional and 41,770.00 af total from the points from which water is exchanged to the storage reservoirs, of which 2,574.17 af has been decreed absolute, and 39,195.83 af remains conditional. iv. Exchange and Reuse Program to the Pikeview System. a. Stream Reaches of Exchange: The reaches of Fountain Creek and its tributaries between the following points: 1. Points From Which Water is Exchanged and Reused: A. The Las Vegas Street Wastewater Treatment Facility Outfalls on Fountain Creek; B. The Air Force Academy Wastewater Treatment Facility Outfall on Monument Creek; and C. Any other supplemental or replacement wastewater treatment facility outfall, including terminal storage facilities, located within the drainage of Fountain Creek or the Arkansas River above its confluence with Fountain Creek. 2. Points To Which Water is Exchanged and Reused: Pikeview Intake (also known as Monument Creek Pipeline), Pikeview Reservoir and Pikeview Reservoir No.2. 3. Amount: 11.00 cfs total from each point from which water is exchanged to the Pikeview Intake, of which 2.71 cfs has been decreed absolute, and 8.29 cfs remains conditional; and 204.50 af total from each point from which water is exchanged to Pikeview Reservoir and Pikeview Reservoir No. 2, all of which has been decreed absolute. v. Exchange and Reuse Program to the 33rd Street Diversion Intake. a. Stream Reaches of Exchanges: The reaches of Fountain Creek and its tributaries between the following points: 1. Points From Which Water is Exchanged and Reused: A. The Las Vegas Street Wastewater Treatment Facility Outfalls on Fountain Creek; B. The Air Force Academy Wastewater Treatment Facility Outfall on Monument Creek; and C. Any other supplemental or replacement wastewater treatment facility outfall, including terminal storage facilities, located within the drainage of Fountain Creek or the Arkansas River above its confluence with Fountain Creek. 2. Point To Which Water is Exchanged and Reused: 33rd Street Diversion Intake. 3. Amount: 13.90 cfs total from each point from which water is exchanged to the 33rd Street Diversion Intake, all of which remains conditional. vi. Exchange and Reuse Program to the Bear Creek Intake. a. Stream Reaches of Exchanges: The reaches of Fountain Creek and its tributaries between the following points: 1. Points From Which Water is Exchanged and Reused: A. The Las Vegas Street Wastewater Treatment Facility Outfalls on Fountain Creek; B. The Air Force Academy Wastewater Treatment Facility Outfall on Monument Creek; and C. Any other supplemental or replacement wastewater treatment facility outfall, including terminal storage facilities, located within the drainage of Fountain Creek or the Arkansas River above its confluence with Fountain Creek. 2. Point To Which Water is Exchanged and Reused: Bear Creek Intake. 3. Amount: 3.10 cfs total from each point from which water is exchanged to the Bear Creek Intake, all of which remains conditional. vii. Exchange and Reuse Program to the South Suburban System. a. Stream Reaches of Exchange: The reaches of Fountain Creek and its tributaries between the following points: 1. Points From Which Water is Exchanged and Reused: A. The Las Vegas Street Wastewater Treatment Facility Outfalls on Fountain Creek; B. The Air Force Academy Wastewater Treatment Facility Outfall on Monument Creek; and C. Any other supplemental or replacement wastewater treatment facility outfall, including terminal storage facilities, located within the drainage of Fountain Creek or the Arkansas River above its confluence with Fountain Creek. 2. Points To Which Water is Exchanged and Reused: South Cheyenne Creek Intake, North Cheyenne Creek Intake, South Suburban Reservoir and Gold Camp Reservoir. 3. Amount: 25.50 cfs total from each point from which water is exchanged to the South Cheyenne Creek Intake and the North Cheyenne Creek Intake, of which 15.17 cfs has been decreed absolute, and 10.33 cfs remains conditional; and 600.00 af total from the points from which water is exchanged to South Suburban Reservoir and Gold Camp Reservoir, of which 576.33 af has been decreed absolute and 23.67 af remains conditional. 4. Diligence: A. Integrated System. Applicant owns and operates an integrated system for water diversions, transmission, storage, treatment, and
distribution, as well as collection and treatment of the resultant wastewater for release, exchange, and reuse. The conditional water rights herein are a part of this integrated water system comprising all water rights decreed and used for development and operation of the City of Colorado Springs’ municipal water supply system. Reasonable diligence in the development of one component of the system comprises reasonable diligence in the development of all components. B. Diligence Activities. Provide a detailed outline of what has been done toward completion or for completion of the appropriation and application of water to a beneficial use as conditionally decreed, including expenditures. 1. Applicant owns and operates the municipal water supply system serving the City of Colorado Springs. The conditional water rights herein are a part of that municipal water supply system, which also comprises and includes other absolute and conditional water rights, and collection, storage, and diversion and delivery systems including, but not limited to, the structures (and/or interests therein) described in paragraph 3.F above. 2. During the diligence period, Applicant has undertaken numerous projects and activities for the improvement and enlargement of its water supply and distribution systems in order to facilitate the completion of the appropriation of the conditionally decreed water rights that are the subject of this application including, but not limited to: rehabilitation of the dam face of the Upper Blue Reservoir (Continental-Hoosier Diversion System); rehabilitation of the dam face and outlet works of Montgomery Reservoir (Continental-Hoosier Diversion System); pursuit of adjudication of a decree in Case No. 03CW320 (Water Division No. 5) for so-called “substitution operations” pursuant to the Blue River Decree (Consol. Cases Nos. 2782, 5016 and 5017); participation in negotiations regarding proposed administration of Green Mountain Reservoir pursuant to the Blue River Decree; pursuit of adjudication of a Colorado River-Blue River Exchange in Case No. 03CW314 (Water Division No. 5); design, environmental permitting, and initial construction of dam face and outlet works rehabilitation/maintenance of Homestake Reservoir (Homestake Project); adjudication of Case No. 95CW272 (Water Division No.5) for the so-called “Homestake II” Project and for Eagle River MOU joint use projects; environmental permitting, design, and initial construction activities on the Southern Delivery System major delivery system project; extensive participation in the Arkansas River Exchange Program; continued development of the Colorado Canal Reuse Program; participation as an objector in numerous water court applications, in Water Divisions 2 and 5, for the protection of the water rights and operations of the Colorado Springs’ municipal water supply system. In addition, Applicant has operated the decreed exchanges that are the subject of this application to divert and beneficially use additional amounts of water so as to make absolute additional incremental amounts of the decreed exchanges. 3. Applicant’s total capital expenditures in connection with the activities described above on its integrated system during the period from March 1, 2002 through February 28, 2013 have exceeded $662,260,779.00. In addition to that amount, over $39,773,609.00 was expended on the operation of the Local Exchange Plan. 5. If claim to make absolute: Applicant has operated the decreed exchanges that are the subject of this application to divert and beneficially use additional amounts of water beyond the amounts previously made absolute so as to make absolute additional incremental amounts of the decreed exchanges, as follows: A. Date water applied to beneficial use: Between March 1, 2002 and February 28, 2013 as documented in Exhibit A attached to the Application. (All exhibits mentioned herein are incorporated by reference and may be inspected at the office of the clerk of this Court.) 1.Amounts: As set forth in the Table below (2002-2013 Exchanges):
2002-2013 EXCHANGE Structure Name (Exchange to)
RemainingConditional
AmountTotal
Amount Previously
Made Absolute
Additional Amount Claimed Absolute
New Total Amount Claimed Absolute
Ruxton Creek System
Intake Structures
Storage Reservoirs 16.20 cfs1,331.11 af
18.50 cfs258.89 af
0.00 cfs245.09 af
18.50 cfs503.98 af
North Slope System
Intake Structures
Storage Reservoirs 33.70 cfs15,891.30 af
23.10 cfs1,538.70 af
0.00 cfs106.87 af
23.10 cfs1,645.57 af
Northfield System
Intake Structures
Storage Reservoirs 8.62 cfs39,195.83 af
0.28 cfs2,574.17 af
0.00 cfs0.00 af
0.28 cfs2,574.17 af
Pikeview System
Intake Structures
Storage Reservoirs 8.29 cfs0.00 af
2.71 cfs204.50 af
0.00 cfs0.00 af
2.71 cfs204.50 af
33rd Street System
Intake Structures 13.90 cfs 0.00 cfs 0.00 cfs 0.00 cfsBear Creek SystemIntake Structures
3.10 cfs 0.00 cfs 0.00 cfs 0.00 cfsSouth Suburban SystemIntake StructuresStorage Reservoirs 10.33 cfs
23.67 af 15.17 cfs576.33 af
0.00 cfs0.00 af
15.17 cfs576.33 af
B. Uses: All beneficial uses for which the water to be exchanged and reused are decreed, including those set forth in the Decree in Case No. 84CW202. The uses include municipal purposes within the Colorado Springs municipal water supply service area, including replacement/augmentation of evaporation on Colorado Springs Utilities Reservoirs. C. Description of place of use where water is applied to beneficial use: The service area of the Colorado Springs municipal water supply utility, and Colorado Springs Utilities Reservoirs. 6. Names and addresses of owners of the land upon which any new diversion or storage structure, or modification to any existing diversion or storage structure is or will be constructed or upon which water is or will be stored, including any modification to the existing storage pool: A. City of Colorado Springs, Colorado Springs Utilities, c/o M. Patrick Wells, P.E., P.O. Box 1103, Mail Code 930, Colorado Springs, CO 80947-0930. (Las Vegas Street Wastewater Treatment Facility Outfall; Ruxton Creek System; North Slope System; Intake No. 1, Intake No. 2, Northfield Reservoir, Stanley Canyon Reservoir, Nichols Reservoir, and Rampart Reservoir, of the Northfield Collection System; Pikeview Reservoir of the Pikeview System; 33rd Street Diversion Intake and Alternate Point of Diversion; Bear Creek System Intake; North Cheyenne Creek Intake, South Suburban Reservoir, and Gold Camp Reservoir of the South Suburban System) B. Air Force Academy, Attn: Real Estate Office, 8120 Edgerton Drive, Suite 40, USAF Academy, CO 80840. (Air Force Academy Wastewater Treatment Facility Outfall; Intake No. 3 of the Northfield Collection System) C. Pike National Forest, 2840 Kachina Drive, Pueblo, CO 81008. (Crystal Reservoir, South Catamount Reservoir, and North Catamount Reservoir of the North Slope System (with Applicant); Nichols Reservoir, Rampart Reservoir of the Northfield Collection System (with Applicant)) D. Crestline MHC LLC, c/o Continental Communities, 2015 Spring Road, Suite 600, Oak Brook, IL 60523. (Pikeview Intake (also known as Monument Creek Pipeline)) E. R.W. Case, Long Hope Joint Venture LLP, 2432 Parkview Lane, Colorado Springs, CO 80906. Pikeview Reservoir No. 2) F. Seven Falls Co., c/o Ad Valorem Tax Department, 1601 Elm Street, Suite 4700, Dallas, TX 75201. (South Cheyenne Creek Intake of the South Suburban System) 7. Remarks or other pertinent information: A. PLSS Descriptions. PLSS descriptions are included herein in compliance with Water Court forms. In the event of a discrepancy between the decreed location and the PLSS descriptions herein, the decreed location is controlling. Any person reading this application should rely on the terms of the decree in Case No. 84CW202 adjudicating the conditional water rights herein. WHEREFORE, Applicant requests (1) that a finding of reasonable diligence be entered, and the conditional water rights that are the subject of this application be continued in force; and (2) that the conditional water rights be made partially absolute in the additional amount set forth in Paragraph 5 above.------------------------------------------------------------------------------------------------------------THE WATER RIGHTS CLAIMED BY THE FOREGOING APPLICATION MAY AFFECT IN PRIORITY ANY WATER RIGHTS CLAIMED OR HERETOFORE ADJUDICATED WITHIN THIS DIVISION AND OWNERS OF AFFECTED RIGHTS MUST APPEAR TO OBJECT AND PROTEST WITHIN THE TIME PROVIDED BY STATUTE, OR BE FOREVER BARRED.
YOU ARE HEREBY NOTIFIED that any party who wishes to oppose this application, or application as amended, may file with the Water Clerk a verified statement of opposition setting forth facts as to why the application should not be granted, or why it should be granted only in part or on certain conditions, such statement of opposition must be filed by the last day of May 2013, (forms available at www.courts.state.co.us; filing fee $130.00). The foregoing is a resume and the entire application, amendment, exhibits, maps and any other attachments filed in the case may be examined in the office of the Clerk for Water Division No. 2, at the address shown below.---------------------------------------------------------------------------------------------------------
Witness my hand and the seal of this Court this 8th day of April, 2013./s/ Mardell R. DiDomenico________________________________Mardell R. DiDomenico, ClerkDistrict Court Water Div. 2203 Judicial Bldg., 320 W. 10th StreetPueblo, CO 81003 Tel. 583-7048
(Court seal)Published: April 18th, 2013 Published in the Eagle Valley Enterprise April 18, 2013
��A S P E N T I M E S . C O M / W E E K L Y
DIVISION 5 WATER COURT- MARCH 2013 RESUME
2. PURSUANT TO C.R.S., §37-92-302, AS AMENDED, YOU ARE NOTIFIED THAT THE FOLLOWING PAGES COMPRISE A RESUME OF THE APPLICATIONS AND AMENDED APPLICATIONS FILED WITH THE WATER CLERK FOR WATER DIVISION 5 DURING THE MONTH OF MARCH 2013. The water right claimed by this application may affect in priority any water right claimed or heretofore adjudicated within this division and owners of affected rights must appear to object and protest within the time provided by statute, or be forever barred.13CW23 GUNNISON COUNTY, CRYSTAL, ROARING FORK AND COLORADORIVERS. Application for Finding of Reasonable Diligence and for Change of Conditional Water Right. Larry Darien and Dana Darien, c/o Jefferson V. Houpt, Beattie, Chadwick & Houpt, LLP, 932 Cooper Ave, Glenwood Springs, (970) 945-8659. Structure: Darien Pipeline No. 1. Original decree entered on 03/18/07 in Case No. 06CW2. Location: SW¼NW¼ of Sec 29, T 11 S, R 88 W, 6th PM, 1,669.32 ft from N sec line and 4,348.7 ft from E Sec line. Source: Rapid Creek, trib to Crystal River, trib to Roaring Fork and Colo Rivers. Appropriation date: 01/11/06. Amount: 3.0 cfs, conditional. Use: Generation of electricity and power production. Applicant proposes to change the point of diversion decreed in 06CW2. The actual point of diversion of this water right is described as follows: (a) Easting 305048.94 and Northing 4327283.53; (b) Longitude -107 degrees, 15 minutes, 12.917 seconds W, Latitude 39 degrees, 4 minutes, 22.654 seconds N; and (c) SW¼NW¼ Sec 29, T 11 S, R 88 W, 6th P.M., 1,708 ft from N sec line and 939 ft from E sec line of said Sec 29. No change to this water right other than the description of the point of diversion is proposed. Owners of land upon which structure may be located: Applicants and the U.S. Forest Service, 900 Grand Ave, Glenwood Springs. (5 pages).YOU ARE HEREBY NOTIFIED THAT YOU HAVE until the last day of MAY 2013 to file with the Water Clerk a verified Statement of Opposition setting forth facts as to why this application should not be granted or why it should be granted in part or on certain conditions. A copy of such statement of opposition must also be served upon the applicant or the applicant’s attorney and an affidavit or certificate of such service shall be filed with the Water Clerk, as prescribed by Rule 5, CRCP. (Filing Fee: $130.00) KATHY HALL, Water Clerk, Water Division 5; 109 8th Street, Suite 104 Glenwood Springs, CO 81601.
7. PURSUANT TO C.R.S., §37-92-302, AS AMENDED, YOU ARE NOTIFIED THAT THE FOLLOWING PAGES COMPRISE A RESUME OF THE APPLICATIONS AND AMENDED APPLICATIONS FILED WITH THE WATER CLERK FOR WATER DIVISION 5 DURING THE MONTH OF MARCH 2013. The water right claimed by this application may affect in priority any water right claimed or heretofore adjudicated within this division and owners of affected rights must appear to object and protest within the time provided by statute, or be forever barred.13CW28 (06CW170) EAGLE COUNTY. EAST COULTER CREEK, TRIB. TO CATTLECREEK, TRIB. TO ROARING FORK RIVER, TRIB. TO COLORADO RIVER.APPLICATION FOR FINDING OF REASONABLE DILIGENCE. Applicant: Mary Teresa McNulty Homeowners’ Association, Inc., Attn: Rita Belle, President, 7649 East Vista Drive, Scottsdale, AZ 85250, c/o Garfield & Hecht, P.C., 420 7th St., Suite 100, Glenwood Springs, CO 81601, phone (970) 947-1936. Name of structure: Mary McNulty Subdivision Well. Original decree: Entered on April 9, 1985 in Case No. 83CW140, Dist. Court, Water Div. No. 5. Subsequent decrees: Case No. 92CW060 entered on Oct. 12, 1993; Case No. 99CW225 entered on July 6, 2000; and Case No. 06CW142 entered on Mar. 5, 2007. Location: The SE ¼ of the NE ¼ of Section 33, Township 6 South, Range 87 West of the 6th P.M., at a point whence the Southeast Corner of said Section 33 bears South 17° East a distance of 3,090 feet, in Eagle County, Colorado. Source: Groundwater tributary to East Coulter Creek, tributary to Cattle Creek, tributary to the Roaring Fork River, tributary to the Colorado River. Date of appropriation: October 30, 1981. Amount: 30 g.p.m. total; 15 g.p.m. absolute and 15 g.p.m. conditional. In Case No. 99CW225, the water right was made absolute in the amount of 15 g.p.m. for ordinary household uses inside one single-family dwelling and the irrigation of up to 1,500 square feet of lawns and gardens. Uses: Irrigation, domestic, stock watering, and fire protection purposes. Remarks: The well is permitted as Well Permit No. 37437-F. Claim for Finding of Reasonable Diligence: The Application contains a detailed outline of what has been done toward completion of the appropriation and application of water to beneficial use as conditionally decreed. Name and address of owner of the land upon which the subject water right is located: Rita Veronica Belle Trust, 7649 East Vista Drive, Scottsdale, AZ 85250. Wherefore, Applicant requests the Court to enter a decree finding and concluding that the Applicant has shown reasonable diligence in the development of the remaining conditional portion of the Mary McNulty Subdivision Well water right and continuing such conditional water right in full force and effect. (5 pages)YOU ARE HEREBY NOTIFIED THAT YOU HAVE until the last day of MAY 2013 to file with the Water Clerk a verified Statement of Opposition setting forth facts as to why this application should not be granted or why it should be granted in part or on certain conditions. A copy of such statement of opposition must also be served upon the applicant or the applicant’s attorney and an affidavit or certificate of such service shall be filed with the Water Clerk, as prescribed by Rule 5, CRCP. (Filing Fee: $130.00) KATHY HALL, Water Clerk, Water Division 5; 109 8th Street, Suite 104 Glenwood Springs, CO 81601.
8. PURSUANT TO C.R.S., §37-92-302, AS AMENDED, YOU ARE NOTIFIED THAT THE FOLLOWING PAGES COMPRISE A RESUME OF THE APPLICATIONS AND AMENDED APPLICATIONS FILED WITH THE WATER CLERK FOR WATER DIVISION 5 DURING THE MONTH OF MARCH 2013. The water right claimed by this application may affect in priority any water right claimed or heretofore adjudicated within this division and owners of affected rights must appear to object and protest within the time provided by statute, or be forever barred.13CW29 (03CW331) APPLICATION FOR FINDING OF REASONABLE DILIGENCE, ROUTT, GRAND, EAGLE, AND PITKIN COUNTIES. 1. Name, address and telephone number of applicant: Table Rock Properties, LLC (“Table Rock”), c/o Ron Wilson, 1100 Louisiana, Suite 320, Houston, TX 77002-5299, (713) 659-1221. Copies of all pleadings to: Charles B. White, Petros & White, LLC, 1999 Broadway, Suite 3200, Denver, Colorado 80202, (303) 825-1980, [email protected]. 2. Introduction: Table Rock was decreed absolute and conditional water rights in Case No. 03CW331 that together comprise an integrated Fish Habitat Project within the Table Rock Ranch (“Ranch”) on Rock Creek. The Fish Habitat Project water rights and features include the Oxbow Fishery Channel (a restored historic channel of Rock Creek), TRR Cameron Pond, TRR Lower Recreation Pond, TRR Upper Recreation Pond, and TRR Meadow Pond, together with associated open channels, fill ditches, and return structures to Rock Creek. This Application seeks a finding of reasonable diligence for the period from March 2007 to the present (“Diligence Period”) relating to the four conditional water rights (“Subject
Water Rights”) that are described in Paragraphs 3 to 6 below. A map depicting the Subject Water Rights, Exhibit A, is available for inspection at the office of the Division 5 Water Court. 3. Nameof Structure: TRR Cameron Pond. A. Date of Original Decree: March 5, 2007, Case No. 03CW331, District Court, Water Division No. 5. Subsequent decrees awarding findings of diligence: not applicable. B. Legal Description: TRR Cameron Pond is located in the NE1/4 of the NE1/4 of Section 30, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 760 feet from the North Section line and approximately 960 feet from the East Section line. (i) If off-channel reservoir, name and capacity of ditch used to fill reservoir, and legal description of point of diversion: Horn No. 2 Ditch and Horn No. 2 Ditch Enlargement, from the right bank in the NE1/4 of the NE1/4 of Section 30, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 450 feet from the North Section line and approximately 470 feet from the East Section line. (ii) TRR Cameron Pond is part of a flow through fish habitat system and is part of the Fish Habitat Project. The point of return to Rock Creek is in the NE1/4 of the NE1/4 of Section 30, Township 1 South, Range 83 West of the 6th P.M. at a point approximately 960 feet from the North Section line and approximately 760 feet from the East Section line. C. Source:Surface and groundwater tributary to Rock Creek, tributary to the Colorado River. D. AppropriationDate: May 15, 1998. E. Amount: (i) 14.32 acre feet, of which 6.81 acre feet is absolute and 7.51 acre feet is conditional. (ii) If off-channel reservoir, rate of diversion in c.f.s. for filling the reservoir: 5.0 c.f.s., absolute, through the Horn No. 2 Ditch and Horn No. 2 Ditch Enlargement. Legal description of the Horn No. 2 Ditch and Horn No. 2 Ditch Enlargement: from the right bank in the NE1/4 of the NE1/4 of Section 30, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 450 feet from the North Section line and approximately 470 feet from the East Section line. (iii) The groundwater component of this appropriation is limited to the amount of evaporative loss, which is 3.62 acre-feet per year, absolute. F. Use: Augmentation, exchange, recreation, piscatorial, wildlife watering, and fire protection. G. Surface area of high water line:1.11 acres. (i) Height of dam: Approximately 6 feet. (ii) Length of dam: Approximately 300 feet. H. Total capacity of reservoir in acre feet: 6.81 acre feet absolute, 7.51 acre feet conditional. All the 6.81 acre feet is above the water table and is active storage. All the 7.51 acre feet (when constructed) will be below the water table and will be inactive storage. Water released for augmentation and exchange purposes will be limited to the volume in active storage above the water table. 4. Name of Structure: TRR Upper Recreation Pond. A. Date of Original Decree:March 5, 2007, Case No. 03CW331, District Court, Water Division No. 5. Subsequent decrees awarding findings of diligence: not applicable. B. Legal Description: TRR Upper Recreation Pond is located in the NE1/4 of the NE1/4 of Section 31, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 50 feet from the North Section line and approximately 400 feet from the East Section line. (i) If off-channel reservoir, name and capacity of ditch used to fill reservoir, and legal description of point of diversion: TRR Recreation Ditch, from the left bank in the SE1/4 of the SE1/4 of Section 30, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 530 feet from the South Section line and approximately 950 feet from the East Section line. (ii) The TRR Upper Recreation Pond is part of a flow through fish habitat system and is part of the Fish Habitat Project. The points of return to Rock Creek are located: a. In the SE1/4 of the NE1/4 of Section 31, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 1,510 feet from the North Section line and approximately 660 feet from the East Section line; and/or b. In the NW1/4 of the SW1/4 of Section 32, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 2,000 feet from the South Section line and approximately 180 feet from the West Section line. C. Source: Surface and groundwater tributary to Rock Creek, tributary to the Colorado River. D. Appropriation Date: May 15, 1988. E. Amount: (i) 3.13 acre feet, absolute, which is the amount of annual evaporative loss. (ii) If off-channel reservoir, rate of diversion in c.f.s. for filling the reservoir: 1.6 c.f.s., absolute, and 3.4. c.f.s., conditional, through the TRR Recreation Ditch. F. Use: Recreation, piscatorial, wildlife watering, and fire protection. G. Surface Area of High Water Line: 1.02 acres. The Pond is an excavated structure. H. Total Capacity of Reservoir in Acre Feet: 6.77 acre feet existing, and 3.59 acre feet under proposed enlargement. 5. Name of Structure: TRR Meadow Pond. A. Date of Original Decree: March 5, 2007, Case No. 03CW331, District Court, Water Division No. 5. Subsequent decrees awarding findings of diligence: not applicable. B. Legal Description: TRR Meadow Pond is located in the NW1/4 of the SW1/4 of Section 32, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 2,460 feet from the South Section line and approximately 200 feet from the West Section line. (i) If off-channel reservoir, name and capacity of ditches used to fill reservoir, and legal description of each point of diversion: TRR Recreation Ditch, Frank Groh Ditch, and/or Frank Groh Ditch 2nd Enlargement. The TRR Meadow Pond will also be filled and maintained (in part) by seeps and springs which are intercepted by the Frank Groh Ditch. Per the decree in Case No. 91CW250, the headgate of the Frank Groh Ditch is located in Routt County, Colorado on the East (left) bank of Rock Creek, at a point from which the NE corner of Section 31, Township 1 South, Range 83 West, of the 6th P.M., bears N. 68º 14’ 50” E. 545.58 feet. The legal description for the TRR Recreation Ditch is described in Paragraph 4(B)(i). (ii) TRR Meadow Pond is part of a flow-through fish habitat system, and is part of the Fish Habitat Project. The point of return to Rock Creek is located in the NW1/4 of the SW1/4 of Section 32, Township 1 South, Range 83 West of the 6th P.M., at a point approximately 2,000 feet from the South Section line and approximately 180 feet from the West Section line. C. Source:Surface and groundwater tributary to Rock Creek, tributary to the Colorado River. D. Appropriation Date: July 24, 2002. E. Amount: (i) 21.40 acre feet, conditional. (ii) If off-channel reservoir, rate of diversion in c.f.s. for filling the reservoir: 5.0 c.f.s. through the TRR Recreation Ditch and/or Frank Groh Ditch 2nd Enlargement. (iii) The groundwater component of this appropriation is limited to the amount of evaporative loss, which is 6.94 acre feet per year, conditional. F. Use: Augmentation, exchange, recreation, piscatorial, wildlife watering, and fire protection. G. Surface area of high water line: 2.00 acres. (i) Height of dam: Approximately 9.9 feet. (ii) Length of dam: Approximately 500 feet. H. Total capacity of reservoir in acre feet: 21.4 acre feet, all active capacity (above the water table). Water released for augmentation and exchange purposes will be limited to the volume in active storage above the water table. 6. Nameof Structure: TRR Recreation Ditch. A. Date of Original Decree: March 5, 2007, Case No. 03CW331, District Court, Water Division No. 5. Subsequent decrees awarding findings of diligence: not applicable. B. Location: See Paragraph 4(B)(i). C. Source: Rock Creek, a tributary to the Colorado River. D. Appropriation Date: May 15, 1988. E. Amount: 1.6 c.f.s. absolute and 3.4 c.f.s., conditional. F. Use: To fill and refill continuously the TRR Lower Recreation Pond, TRR Upper Recreation Pond and TRR Meadow Pond to maintain full pond levels, and for recreation, piscatorial, fire protection, and wildlife watering purposes. 7. Detailed outline of work done to complete project and apply water to beneficial use: The Subject Water Rights, described above, are an integral component of Table Rock’s Fish Habitat Project. During the Diligence Period, Table Rock has incurred considerable expenses in developing its integrated project. The application contains a summary of specific projects and work undertaken during the Diligence Period and is available for review at the office of the Division 5 Water Court or via LexisNexis CourtLink. 8. Name(s) and address(es) of owner(s) or reputed owners of the land upon which any new diversion or storage structure, or modification to any existing diversion or storage structure
is or will be constructed or upon which water is or will be stored, including any modification to the existing storage pool: Applicant. WHEREFORE, the Applicant respectfully request that this Court enter a finding of reasonable diligence for the conditional water rights for TRR Cameron Pond, TRR Upper Recreational Pond, TRR Meadow Pond, and TRR Recreation Ditch adjudicated in Case No. 03CW331, Water Division No. 5. (10 pages)YOU ARE HEREBY NOTIFIED THAT YOU HAVE until the last day of MAY 2013 to file with the Water Clerk a verified Statement of Opposition setting forth facts as to why this application should not be granted or why it should be granted in part or on certain conditions. A copy of such statement of opposition must also be served upon the applicant or the applicant’s attorney and an affidavit or certificate of such service shall be filed with the Water Clerk, as prescribed by Rule 5, CRCP. (Filing Fee: $130.00) KATHY HALL, Water Clerk, Water Division 5; 109 8th Street, Suite 104 Glenwood Springs, CO 81601.
10. PURSUANT TO C.R.S., §37-92-302, AS AMENDED, YOU ARE NOTIFIED THAT THE FOLLOWING PAGES COMPRISE A RESUME OF THE APPLICATIONS AND AMENDED APPLICATIONS FILED WITH THE WATER CLERK FOR WATER DIVISION 5 DURING THE MONTH OF MARCH 2013. The water right claimed by this application may affect in priority any water right claimed or heretofore adjudicated within this division and owners of affected rights must appear to object and protest within the time provided by statute, or be forever barred.13CW31 EAGLE COUNTY. BLUE CREEK. Crawford Properties, LLC, c/o Patrick, Miller, Kropf & Noto, P.C., Kevin L. Patrick, Esq. and Danielle L. Van Arsdale, Esq., 229 Midland Ave., Basalt, CO 81621, (970) 920-1028. APPLICATION FOR FINDING OF REASONABLE DILIGENCE. First Claim for Finding of Reasonable Diligence. Name of structure: Crawford Dam No. 2. Description of conditional water right: Date of original Decree: May 18, 1978, Case No. W-3368, District Court, Water Division No. 5. Subsequent diligence decrees District Court, Water Division No. 5: August 15, 1981, Case No. 80CW364; June 26, 1986, Case No. 86CW24; October 16, 1992, Case No. 90CW63; March 9, 1999, Case No. 98CW195; March 15, 2007; Case No. 05CW48. Legal description: The SW Corner of the centerline of the axis of the dam is located at a point whence the SW Corner of Section 26, T. 7S, R87 W. of the 6th P.M. bears S. 24°00’ W. 1,175 feet in Eagle County. See Exhibit A. Source: Blue Creek, tributary to the Roaring Fork River, tributary to the Colorado River. Appropriation date: March 1, 1977. Amount: 56 acre feet, total, decreed. See Application for a table showing the amounts and uses made absolute in subsequent diligence cases. Uses: Piscatorial, recreational, municipal, domestic, irrigation, mechanical, manufacturing, generation of power, power generally, fire protection, sewage treatment, street sprinkling, watering of parks, lawns and grounds. Detailed outline of work performed toward completion of the appropriation and application of water to the conditional uses decreed during the relevant diligence period, including expenditures is on file with the Court.Applicant owns the land on which structure is or will be located, upon which water is or will be stored, or upon which water is or will be placed to beneficial use. (6 pages)YOU ARE HEREBY NOTIFIED THAT YOU HAVE until the last day of MAY 2013 to file with the Water Clerk a verified Statement of Opposition setting forth facts as to why this application should not be granted or why it should be granted in part or on certain conditions. A copy of such statement of opposition must also be served upon the applicant or the applicant’s attorney and an affidavit or certificate of such service shall be filed with the Water Clerk, as prescribed by Rule 5, CRCP. (Filing Fee: $130.00) KATHY HALL, Water Clerk, Water Division 5; 109 8th Street, Suite 104 Glenwood Springs, CO 81601.
17. PURSUANT TO C.R.S., §37-92-302, AS AMENDED, YOU ARE NOTIFIED THAT THE FOLLOWING PAGES COMPRISE A RESUME OF THE APPLICATIONS AND AMENDED APPLICATIONS FILED WITH THE WATER CLERK FOR WATER DIVISION 5 DURING THE MONTH OF MARCH 2013. The water right claimed by this application may affect in priority any water right claimed or heretofore adjudicated within this division and owners of affected rights must appear to object and protest within the time provided by statute, or be forever barred.13CW39 EAGLE COUNTY. GROUNDWATER AND LOCAL RUNOFF TRIBUTARY TO BLUE CREEK, TRIBUTARY TO THE ROARING FORK RIVER, TRIBUTARY TO THE COLORADO RIVER. Alex and Laura Foster Kim, c/o Robert M. Noone, Esq., The Noone Law Firm, P.C., P.O. Drawer 39, Glenwood Springs, CO 81602. (970) 945-4500. Amended Application for Finding of Reasonable Diligence. First Claim: for finding of reasonable diligence: Dragonfly Well. Original Decree: March 19, 2007. Case No. 2005CW114, Water Court, Division No. 5. Subsequent Decrees Awarding Findings of Diligence: N/A. The Dragonfly Well is located in the SW¼SE¼, Sec. 27, T. 7 S., R. 87 W., 6th P.M., 800 feet from the South line and 2000 feet from the East line of said Sec. 27. A map is on file with the Court. Source: Groundwater tributary to Blue Creek, tributary to the Roaring Fork River, tributary to the Colorado River. Appropriation Date: June 30, 2005. Amount: 15 gpm, conditional. Uses: In-house domestic use for four (4) single-family homes, four (4) accessory dwelling units (ADUs), a barn, a commercial kitchen, irrigation of up to 20,000 square feet for lawn and garden (to be taken from the Well or the Pond), pond evaporation replacement, and fire protection. Depth of Well: 300 feet Second Claim: for finding of reasonable diligence: Laura’s Pond. Original Decree: March 19, 2007. Case No. 2005CW114, Water Court, Division No. 5. Subsequent Decrees Awarding Findings of Diligence: N/A. Laura’s Pond is located in the SW¼, SE¼ of Section 27, Township 7 South, Range 87 West, of the 6th P.M. in Eagle County a distance of 550 feet North of the South line and 2010 feet West of the East line. A map is on file with the Court. Source: Tributary local runoff and the Dragonfly Well, which diverts from groundwater tributary to Blue Creek, tributary to the Roaring Fork River, tributary to the Colorado River. Appropriation Date: July 5, 2005. Use: In-house domestic use for four (4) single-family homes, four (4) accessory dwelling units (ADUs), a barn, a commercial kitchen, irrigation of up to 20,000 square feet for lawn and garden (to be taken from the Well or the Pond), pond evaporation replacement, and fire protection. Amount: 2.3 acre feet, conditional. A detailed outline of what has been done toward completion or for completion of the appropriation and application of water to a beneficial use as conditionally decreed, including expenditures, is on file with the Court. The Dragonfly Well and Laura’s Pond are components of an integrated water supply project involving both of the water rights described in this application, and decreed in Case No. 05CW114. (5 pgs)YOU ARE HEREBY NOTIFIED THAT YOU HAVE until the last day of MAY 2013 to file with the Water Clerk a verified Statement of Opposition setting forth facts as to why this application should not be granted or why it should be granted in part or on certain conditions. A copy of such statement of opposition must also be served upon the applicant or the applicant’s attorney and an affidavit or certificate of such service shall be filed with the Water Clerk, as prescribed by Rule 5, CRCP. (Filing Fee: $130.00) KATHY HALL, Water Clerk, Water Division 5; 109 8th Street, Suite 104 Glenwood Springs, CO 81601.
Published in the Aspen Times Weekly on April 24, 2013.
A S P E N T I M E S W E E K L Y F Ap r i l 18 - 2 4 , 20 13��
by MELISSa HarT for HIGH COuNTrY NEWSWORdPLAy INTELLIGENT EXErCISE
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17
18 19 20 21 22
23 24 25
26 27 28 29 30
31 32 33 34
35 36 37 38 39
40 41 42 43 44 45 46 47
48 49 50 51 52
53 54 55 56 57
58 59 60 61 62 63 64
65 66 67 68 69 70 71 72
73 74 75 76 77 78
79 80 81 82 83 84
85 86 87 88 89 90 91
92 93 94 95 96
97 98 99 100
101 102 103 104 105 106 107 108
109 110 111 112 113 114
115 116 117 118 119
120 121 122
123 124 125 126
D U E L S A T F J A K E D C C A BE R R O L S E L H A D E S E R A S EA B A S E S T A R E W A R S A O R T AL A T T E A R G O N S N E A T W O R KS N O W V O Y A G E R S H E L
E E K Y U P M C M K A IC A G E S T I N G I N I N T H E R A I NA W A K E E M E R I P O S T E N D SB A T E M A N F O R E V E R S A F E S TI R O N O N S N A T U R A LN E R D D E B C D C N A Y L U S H
C E R E B R O N A T A S H AC A C T U S D R A W N O F T H E D E A DI N H O T M I E N A S I A C I R R IT E E N C O M M A N D M E N T S E S P NE W W O R E M Y A A D S
B A R E R E G A L G E N I U SG R A I N M A N E N R A G E P I N T OL O C K E E A S T E R E G G O G D E NU L C E R O N E N D L I U T H I N GM E A N S N O T A S E P S T A N S
ACrOss
1 postal Id6 memphis belle?10 Raspberry14 Kind of form18 Cobbler’s job20 So that one might22 Black shade23 Stevedore, at
times24 College student’s
place25 dial competitor26 British soccer
powerhouse28 “got it”29 Fish with a long
neck31 procrastinators’
enablers34 Shark, maybe35 Beat at a Nathan’s
hot dog contest, say
36 Snake in “The Jungle Book”
39 Salad bar items40 “Le ___ de monte-
Cristo”42 Visa offering47 Of ___ (servicing)48 mayo containers?49 Turned50 “China Beach”
actress Helgenberger
52 Novelist who had two spouses simultaneously
53 Abbr. on car sellers’ license plates
54 N. African land55 “decision points”
author58 Repeats61 Vague response to
“When?”
62 marsh of detective fiction
65 ___ City, miss.66 gecko’s gripper69 Turbulence71 Local bird life73 “Bye Bye Bye”
band75 Onetime sunblock
agent77 BB shooter79 galileo, for one83 Electric ___84 mishandle
something, say85 One of the m’s of
3m: Abbr.88 Electric car89 Football
misdirection91 Hipster’s pad92 Charioteer’s place94 Apt anagram for
42-Across96 Beat it97 Name on a
museum plaque98 memphis-to-
Nashville dir.99 Opera character
who sings “Largo al factotum”
101 “The ___ Show” (best-selling album of 2002)
103 “great” 1666 conflagration
109 Birthday suit enthusiast
112 passage113 Video store penalty115 medical suffix116 Apt anagram for
24-Across119 designer picasso,
daughter of pablo120 Coastal niche121 They’re on the left
in Britain
122 “South pacific” protagonist and namesakes
123 Former Israeli president Weizman
124 dustup125 Baffled126 1978 peace prize
recipient
dOWn
1 Cuba, por ejemplo2 Coupe’s couple3 Apt anagram for
31-Across4 places to hole up
after holdups5 unvarying6 grant, e.g.7 How things are
generally stir-fried8 Backs,
anatomically9 munitions supplier10 Black shade11 Lover of psyche12 To be in paris?13 Buckingham
palace resident14 Alters to allow
development, maybe
15 Scotland’s “granite City”
16 English poet who co-founded the pre-Raphaelites
17 Begins, as a journey
19 Scratch the surface of, maybe
21 per ___27 galena and
cerussite30 Apt anagram for
55-Across32 Egyptian sun deity
33 Reggae precursor37 georgia neighbor38 Not much, as of
paint40 Fleetwood
or Eldorado, informally
41 Checked out43 Ask for change44 “How can ___
sure?”45 Hometown of TV’s
mcCloud46 pC insert49 Alternative to
“com”51 Banker’s concern54 Apt anagram for
79-Across56 Hot tar, e.g.57 mata ___59 good protein
source60 1984 title role for
Emilio Estevez63 Apt anagram for
103-Across64 Offshore
installation67 Sun68 multiple-choice
choices70 Order during an
m.R.I.72 Croatian leader?74 municipal facility:
Abbr.76 u.S.A. part: Abbr.78 Alternative to
white80 “Hurlyburly”
writer david81 Tomorrow’s is
tonight82 Like mars85 Was congenial86 Completely87 Like the word
“curiae” in
“amicus curiae”90 melodic phrase91 Legendary queen
of the Britons immortalized by Shakespeare
93 Teetotaler95 Cool, in slang96 Small chickens100 Lose it102 Heart104 Short pastoral
piece
105 Not built up106 prefix with car107 Some Siouans108 Where Hercules
slew the lion110 minuteman’s
location111 Stepped114 Big ___ (sports
conference)117 moses malone, on
the 76ers118 N.m. setting
iN NovEMbER1971,amantravelingunderthename“DanCooper”hijackedaBoeing727flyingbetweenPortlandandSeattle,demanded$200,000fromtheFBIandthenparachutedfromtheplaneintohistory,somewhereintheNorthwesternwilds.TheFBIhassearchedunsuccessfullyfor42yearsforanytraceofeitherthemanorthemoney;asrecentlyasAugust2011,agentswerestillinvestigatingpotentialleads.
OregonauthorWilliamL.Sullivanoffershisownconvolutedsolutionin“TheCaseofD.B.Cooper’sParachute,”a“whatif?”novelsetagainstabackdropofinternationalarttheft,Oregon’scommunityofRussianOldBelieversandPortland’sinfamousShanghaiTunnels.
Sullivancantellarivetingadventuretale.Hismiddle-aged,
guilt-rackedpoliceLt.NeilFergusonbicyclesaroundPortlandmaintaininglawandorderandkeepinganeyeonhisautisticdaughter.Reportsthata“D.B.Cooper”isstealingpaintingsfromaRussianOrthodoxchurchpropelthelieutenantintoamurdermysteryandintheprocesstransportthereaderintoCooper’smindandhispossiblemotivationsfortheextortionandhijacking.
PacificNorthwesterners,aswellasloversofallthingsPortlandia,willappreciateSullivan’sfrequentreferencestolocallandmarks.Ferguson’sdetectiveworktakeshimfromPortland’sGrotto—aCatholicshrineandbotanicalgarden—tothedragonboatracesontheWillametteRiver,anduptoMountHood’shistoricTimberlineLodge.“ThemanwhocalledhimselfCooperwasnotpleased,”Sullivan
writeslateinthenovel.“HeshuffledslowlyacrosstheTimberlineLodgelobby,pushinghiswalkerpastthebigstonefireplacewithitscracklingpinelogs.Noonehadeverdiscoveredhisidentitybefore.”
Asbefitsaclassicmystery,Fergusonteamsupwithabeautifulandenigmaticwoman—inthiscase,aRussiantranslator—tosolveaseriesofcrimes.Thoughreadersmayhavetroubleuntanglingthisnovel’scomplexpoliticalsubplots,manyofthemwillfindtheauthor’sdramaticconclusionconvincingenoughtodeclarewithsatisfaction,“caseclosed.”
‘THE CaSE OF D.B. COOPEr’S ParaCHuTE’
fITTINg REARRANgEMENTSby MaTT GINSBErG | edited by WILL SHOrTz
BOOk rEVIEW
“the case of D.B. cooper’s Parachute”william L. Sullivan411 pages, paperback, $14.95navillus Press, 2012
NOTEWORTHy
— Last week’s puzzle answers —
��A S P E N T I M E S . C O M / W E E K L Y
Aspen | 970.925.6060 Snowmass | 970.923.2006 Basalt | 970.927.8080 Carbondale | 970.963.4536
AspenSnowmassSIR.com
6 bedrooms, 6.5 baths, 6,050 sq ftSensational & luxurious mountain home Patio with built-in BBQ, fire pit, & hot tubMedia, exercise, & ski rooms, 3 car garage$11,500,000 $8,995,000 FurnishedCraig Morris | 970.379.9795Maureen Stapleton | 970.948.9331
Ski-In/Ski-Out Snowmass Village
Remodeled former home of Rupert Murdoch11,051 sq ft situated on 2 acres with views6 bedrooms, 6.5 baths, staff quarters, indoor pool, & outdoor entertaining areas$18,750,000 $8,500,000 Turn-Key FurnishedCarol Dopkin | 970.618.0187StarwoodHome.info
Elegant Glamorous Starwood Estate
5 bedrooms, 6.5 baths, 7,805 sq ftLovely grounds and EXTRAORDINARY viewsWarmth & character - not cookie cutter$8,495,000 FurnishedAnneAdare Wood | 970.274.8989
Distinctive Starwood Home
Exclusive Two Creeks Home
room
$9,500,000 FurnishedLarry Jones | 970.379.8757
70 acre Homestead parcel2 miles from the heart of BasaltPrivate fishingBuild a lasting family legacy$10,000,000 $7,500,000Jana Dillard | 970.948.9731Ted Borchelt | 970.309.3626
Frying Pan River Frontage
Slopeside mountain home on Thunderbowl6 bedrooms+ ADU, 6.5 baths, 8,046 sq ftElevator, exercise room, bar, and libraryOutdoor stone patio with fire pit & Jacuzzi$10,900,000 AspenLuxurySkiHome.comChris Klug | 970.948.7055
Premier Ski-In/Ski-Out Luxury Home
5 bedrooms, 7.5 baths, 8,662 sq ft
Filled with natural light, panoramic viewsLowest priced home in the Highlands$9,495,000Rochelle Bouchard | 970.379.1662
The Highest Home in the Highlands