role of type vi secretion system in stress adaptations and
Post on 03-Jun-2022
1 Views
Preview:
TRANSCRIPT
Role of Type VI Secretion System in Stress
Adaptations and Developing Control Strategies
for Campylobacter jejuni
By
Zobia Noreen
CIIT/SP13-PBS-009/ISB
PhD Thesis
In
Biosciences
COMSATS University Islamabad
Islamabad Campus-Pakistan
Spring, 2019
ii
COMSATS University Islamabad
Role of Type VI Secretion System in Stress
Adaptations and Developing Control Strategies for
Campylobacter jejuni
A Thesis Presented to
COMSATS University, Islamabad
In partial fulfillment
of the requirement for the degree of
PhD (Biosciences)
By
Zobia Noreen
CIIT/SP13-PBS-009/ISB
Spring, 2019
iii
Role of Type VI Secretion System in Stress
Adaptations and Developing Control Strategies for
Campylobacter jejuni
_________________________________________
A Post Graduate Thesis submitted to the Department of Biosciences as partial
fulfillment of the requirement for the award of the Degree of PhD in Biosciences.
Name Registration Number
Zobia Noreen CIIT/SP13-PBS-009/ISB
Supervisor
Dr. Syed Habib Bokhari
Professor, Department of Biosciences
COMSATS University Islamabad (CUI)
Islamabad Campus.
iv
v
vi
vii
viii
DEDICATION
To My Loving Brother Zeeshan Khurshid (Late)
ix
ACKNOWLEDGEMENTS
I bow my head in profound gratitude to my Almighty Allah Who in His infinite mercy
bestowed upon me the strength and potential to complete this task. I do greatly
acknowledge hereby the Holy Prophet Muhammad (P.B.U.H), whose life and
principles served as a beacon of knowledge for the whole mankind.
I would like to thank COMSATS University, Islamabad for providing me In-House
study leave for carrying out my PhD work. I would also like to acknowledge HEC for
providing me the opportunity to complete a part of my PhD research in National
University of Singapore (NUS) under IRSIP scholarship.
I would delectably present my sincere gratitude to my worthy supervisor, Prof. Dr.
Habib Bokhari, Professor, Department of Biosciences, for his dynamic supervision,
able guidance, illustrious advice, genuine interest, constructive criticism and
encouragement during my research work and thesis write up. I wish to pay my most
sincere regards to Dr. Sivaraman (National University of Singapore) providing
guidance and facilities to complete my work in his lab during my IRSIP visit. I would
also like to say thanks to Assistant Professor, Dr. Sundus Javed and Dr. Aamira Tariq
for their timely help and sincere guidance.
Heartfelt mention goes to amiable lab fellows Dr. Fariha Siddiqui, Kashaf Javed,
Salma Saeed, Sidra Siddiqui, Sobia Kanwal, Qurat ul Ain, Junaid Akhtar, Nighat
Parveen, Yasir, Kamran, Fizza, Kalsoom and Tahira for their support. I sincerely
acknowledge Dr. Jobichen Chacko, Edem, Kannupriya Mishra, YC, Sunil, and Digant
for their cooperation and generous help in NUS, Singapore.
I owe a special debt of gratitude to my friends Bushra Ijaz and Sadaf Azad who have
shared all my worries and happiness and for being there whenever I needed any help.
Now I would like to express my love, appreciation and deep sense of gratitude from the
citadel of my heart to my sweet and affectionate father Khurshid Ali khan and mother
Saeeda Akhtar for their prayers and consistent encouragement throughout the PhD
course. I would also acknowledge my Mother for her unparalleled effort in helping me
raise my two little kids along with my PhD work. I would like to thank my sister Dr.
Ayisha Khurshid for been always there for me when all seemed quite lost.
x
I would like to acknowledge my eternal gratitude, love, and deepest appreciation to my
husband Dr. Imran Ahmed who provide unparalleled support and encouragement and
gave me the strength to go on and complete this research work.
In the end I would like to say sorry, to my kids, Shahmeer Hassan and Aaiza Imran for
not giving them their due attention and time due to my busy PhD scheduled, but I
promise I will make up for it in near future.
“Much of what is right about this dissertation owe in my part to my teacher. All
errors of course, are mine”
Zobia Noreen
CIIT/SP13-PBS-009/ISB
xi
ABSTRACT
Role of Type VI Secretion System in Stress Adaptations and
Developing Control Strategies for Campylobacter jejuni
The human Gram-negative enteropathogen Campylobacter jejuni is the leading cause
of gastroenteritis, with 25% of the cases worldwide being attributed to this organism.
C. jejuni, due to emergence of multidrug resistances, has also been classified as “high
priority pathogens” thus making surveillance system as an essential key for the control
of disease. However, in developing countries like Pakistan, the prevalence and source
prediction of MDR C. jejuni isolates has been under reported due to lack of proper
surveillance program. Therefore, the first section of the present study was conducted to
determine the prevalence of C. jejuni isolates among pediatric diarrheal cases in
Pakistan, their origin through source tracking as well as associated antibiotic resistance
patterns. C. jejuni was detected in 54.6% of the total samples and more than 75% of the
isolated strains were resistant to panel of 8 out of 13 antibiotics tested however; high
level of susceptibility was observed against imipenem (12.2%) and tigecycline (9.7%).
Moreover, six isolates (7.3%) were metallo-beta lactamase (MBL) producer and were
positive for at least one of the five screened metallo-beta lactamase genes. Source
tracking using source predictive PCR, showed that 57.3% of the isolates belonged to
livestock associated cluster (C1 to C6) and 42.8% were assigned to non-
livestock/environmental clusters (C7-C9). Isolates belonging to livestock cluster had
high MAR index as compared to non-livestock suggesting possible transmission of
antimicrobial resistant C. jejuni strains to human population via food chain. Moreover,
it also suggests that extensive use of antibiotics for disease control and growth
promotion in livestock especially in poultry industry results in the emergence and
spread of AMR C. jejuni and the genes associated with resistance.
C. jejuni, although being a fastidious microorganism, is able to survive and maintain its
pathogenesis in the harsh environments. However, the mechanisms of stress adaptations
and pathogenesis is C. jejuni are not fully elucidated. Type VI secretion system among
several gram-negative bacteria have been associated with virulence and stress
xii
adaptations but its role in stress tolerance and pathogenesis of C. jejuni is still unknown.
Moreover, in contrast to the other T6SS positive bacteria, C. jejuni has only one
hemolysin coregulated protein (Hcp) protein, the hallmark of a functional T6SS system,
whose structure and secretory function was not known. Therefore, the second aim of
this study was to determine the role of type VI secretion system in biofilm formation (a
stress adaptive mechanism) and pathogenesis. Moreover, the structure and function of
Hcp protein was also elucidated. Comparative analysis of effect of different sub-lethal
stresses on biofilm forming potential of isolates having fully functional T6SS (Hcp+)
and those lacking functional T6SS (Hcp-) showed that the biofilm formation was
significantly more enhanced in T6SS positive (Hcp+) groups as compared to T6SS
negative (Hcp-) group under heat (55ºC) and oxidative stresses (8mM of H2O2).
Structural analysis of Hcp showed similarities between the hexameric ring structure of
Hcp-Cj and that of Hcp3 from Pseudomonas aeruginosa. Through functional studies,
two roles for Hcp-Cj were identified i.e., in cytotoxicity toward HepG2 cells and in
biofilm formation in C. jejuni. Structure-based mutational analyses showed that an
Arginine to Alanine mutation at position 30 within the extended loop of Hcp-Cj resulted
in a significant decrease in cytotoxicity. However, biofilm formation function remained
unaffected by this mutation. Collectively, this study supports the dual role of Hcp-Cj as
a structural and effector protein in C. jejuni.
High prevalence of C. jejuni associated diarrhea in both developed and developing
countries can be attributed towards three major factors i) emergence of multidrug
resistant C. jejuni isolates making WHO recommended antibiotics ineffective for
treatment; ii) lack of control strategies at poultry level (as poultry meat consumption is
the major source of infection in human); iii) persistence of C. jejuni as biofilm in poultry
processing units and water reservoirs.. Therefore, third part of the present study was to
develop control strategies against C. jejuni at three different levels i.e., 1) In-silico drug
target identification was done using comparative proteomics and metabolomics
approach by which ten essential non-homologous drug targets were identified which
can be used in future to develop safe and effective drug against MDR C. jejuni ; 2) pH
sensitive alginate coated chitosan nanoparticles were designed for targeted delivery of
anti-campylobacter hexane fraction (PE-CANP) of Trachyspermum ammi (ajwain) into
the chicken caecum without loss of its activity in gizzard to control C. jejuni at poultry
farm level. The PE-CANP nanoparticles were able to reduce C. jejuni load to 6 logs (in
xiii
CFU/g of caecal content) as compared to control group in chicken after 21 days of post
infection and can therefore be used as a good alternative to conventional antibiotics for
on-farm control of C. jejuni; 3) Three different metallic nanoparticles i.e.,
Silver/Graphene/TiO2, Erbium doped Li-Ni Ferrites and ZnO nanoparticle were tested
for their antibacterial activity against C. jejuni which showed excellent antibacterial and
anti-biofilm activity. All these nanoparticles can serve as an excellent coating material
for control of C. jejuni biofilms in food processing setups and hence may control the
transmission of C. jejuni to humans.
Overall the present study helps in better understanding the disease transmission patterns
and associated drug resistance traits as well as provides a better insight into the role of
T6SS in C. jejuni in stress adaptation and thereafter developing control strategies for
tackling C. jejuni both at farm and food processing level to reduce the burden of
campylobacteriosis in humans.
xiv
TABLE OF CONTENTS
1. Introduction .................................................................................................. 1
1.1 Campylobacter spp ........................................................................ 2
1.1.1 History and Taxonomy ....................................................... 2
1.1.2 General Characteristics ...................................................... 3
1.1.3 Epidemiology of Campylobacter jejuni ............................ 3
1.2 Transmission of Campylobacteriosis ........................................... 5
1.2.1 Sources and Reservoirs ..................................................... 5
1.2.1.1 Poultry as a major source of C. jejuni infections 7
1.2.2 Source Tracking of C. jejuni Infections ............................ 7
1.2.3 Antibiotic Resistance ........................................................ 8
1.3 Pathogenesis of C. jejuni .............................................................. 9
1.3.1 Motility .............................................................................. 9
1.3.2 Adhesion and Invasion Factors ....................................... 11
1.3.3 Toxin Production .............................................................. 12
1.3.4 Surface Carbohydrates .................................................... 12
1.3.5 Secretion Systems ........................................................... 13
1.3.5.1 Type III Secretion System (T3SS) .................. 13
1.3.5.2 Type IV Secretion System (T4SS) ................. 14
1.3.5.3 Type VI Secretion System (T6SS) ................. 14
1.3.5.3.1 Type VI Secretion System (T6SS) in
C. jejuni .......................................... 17
1.3.5.3.2 Hemolysin Coregulated Protein ..... 17
1.4 Stress Adaptations in C. jejuni ................................................... 18
1.4.1 Viable but Non-culturable Form (VBNC) ....................... 19
1.4.2 Transition from Spiral to Coccoid Shape ........................ 19
1.4.3 Adaptive Tolerance Response (ATR) .............................. 19
1.4.4 Genetic Heterogeneity ..................................................... 20
1.4.5 Biofilm Formation ........................................................... 20
1.4.5.1 T6SS and Biofilm Formation ............................ 21
1.5 Control of C. jejuni ..................................................................... 22
xv
1.5.1 Biosecurity Measures ....................................................... 22
1.5.2 Vaccination ..................................................................... 22
1.5.3 Antimicrobial Alternatives ............................................... 23
1.5.3.1 Bacteriophage Therapy ..................................... 23
1.5.3.2 Probiotics and Prebiotics .................................. 24
1.5.3.3 Antimicrobial Peptides ..................................... 25
1.5.3.4 Natural Antimicrobial Compounds .................. 25
1.6 Aims and Objectives ................................................................. 26
2. Materials and Methods ............................................................................. 27
2.1 Antibiotic Resistance Profiling and Source Attribution of C. jejuni
Isolates from Paediatric Diarrhoeal Cases ................................. 28
2.1.1 Sample Collection ............................................................ 28
2.1.2 Isolation of C. jejuni ........................................................ 28
2.1.4 Biochemical Identification of C. jejuni ........................... 28
2.1.5 PCR based for the Detection of C. jejuni ........................ 29
2.1.5.1 DNA Isolation .................................................. 29
2.1.5.2 Species Specific PCR ....................................... 29
2.1.6 Antimicrobial Resistance Profiling ................................... 30
2.1.6.1 Kirby-Bauer Disc Diffusion Method................. 30
2.1.6.2 Detection of Metallo-β-Lactamase .................... 30
2.1.7 Source Attribution ............................................................. 31
2.2 Stress Adaptation in Type Six Secretion System Positive and
Negative C. jejuni Isolates ......................................................... 33
2.2.1 Growth of Bacterial Strains ............................................. 33
2.2.2 Determination of Sub-lethal Level of pH, Temperature and
Oxidative Stress ............................................................... 33
2.2.3 Motility Assay .................................................................. 33
2.2.4 Hydrophobicity Assay ..................................................... 34
2.2.5 Auto-aggregation Assay ............................................. 34
2.2.6 Biofilm Assay ................................................................... 34
2.3 Structural and Functional analysis of Hcp: Hallmark Protein of
T6SS ............................................................................................ 35
xvi
2.3.1 Plasmids and Bacterial Strain .......................................... 35
2.3.2 Point Mutations ................................................................ 35
2.3.3 Expression and Purification of Recombinant and Mutant
Hcp Protein ...................................................................... 37
2.3.4 Dynamic Light Scattering (DLS) ...................................... 37
2.3.5 Crystallization and Structure Determination ................... 38
2.3.6 Cytotoxicity towards Prokaryotic Cells ........................... 38
2.3.7 RBC Lysis Assay ............................................................. 38
2.3.8 Cytotoxicity towards Eukaryotic Cells (HepG2) .............. 39
2.3.9 Motility Assay .................................................................. 39
2.3.10 Biofilm Assay ................................................................ 39
2.4 In silico Drug Target Identification of C. jejuni ......................... 40
2.4.1 Complete Proteome Retrieval .......................................... 40
2.4.2Determination of Non-Homologous Essential
Genes/Proteins .................................................................. 40
2.4.3 Metabolic Pathway Analyses ............................................ 40
2.4.4 Drugability Potential of Shortlisted Proteins ................... 40
2.4.5 Prioritization of Druggable Target ................................... 41
2.4.5.1 Functional Categorization ................................... 41
2.4.5.2 Virulence Factor .................................................. 41
2.4.5.3 Molecular Weight ............................................... 41
2.4.5.4 Subcellular Localization ..................................... 41
2.4.5.5 Availability of Protein 3D Structure ................... 41
2.4.5.6 Chicken Proteome Homology Analysis .............. 41
2.4.5.7 Gut Flora Non-Homology Analysis .................... 43
2.5 Control of C. jejuni in Poultry by pH Sensitive Plant Extract
Encapsulated Alginate-Chitosan Nanoparticles ......................... 43
2.5.1 Screening of Plant extracts for Anti-campylobacter
Activity .................................................................................... 43
2.5.2 Fractioning of Trachyspermum ammi .............................. 44
2.5.3 Antibacterial activity of Trachyspermum ammi Fractions 44
xvii
2.5.3.1 Determination of Minimum Inhibitory
Concentration ...................................................... 44
2.5.3.2 Influence on Growth of Bacteria and Cell Survival
............................................................................. 44
2.5.4 Gas Chromatography- Mass Spectroscopy Analysis ....... 46
2.5.5 Preparation Plant Extract Loaded Alginate Coated
Chitosan Nanoparticles as a Nanocarrier System for
Targeted Delivery ............................................................ 46
2.5.6 Characterization of plant extract loaded Alginate Coated
Chitosan Nanoparticles ................................................... 47
2.5.6.1 Scanning Electron Microscopy ........................... 47
2.5.6.2 Atomic Force Microscopy .................................. 47
2.5.6.3. Fourier Transform Infrared Spectroscopy ......... 48
2.5.6.4 Encapsulation Efficiency .................................... 48
2.5.6.5 Cytotoxicity Assay .............................................. 48
2.5.6.6 pH Dependent Release Profile ............................ 49
2.5.7 In-vivo Trial in Chicken .......................................... 49
2.6 Metallic Nanoparticle as Control of C. jejuni Biofilms ............. 50
2.6.1 Nanoparticles Used .......................................................... 50
2.6.2 Test Microorganisms ....................................................... 50
2.6.3 Determination of Minimal Inhibitory Concentration ....... 50
2.6.4 Growth Kinetics ............................................................... 52
2.6.5 Hydrophobicity Assay ..................................................... 52
2.6.6 Auto-aggregation Assay .................................................. 52
2.6.7 Motility Assay .................................................................. 52
2.6.8 DNA and Protein Leakage Assay .................................... 53
2.6.9 Antibiofilm Activity ........................................................ 53
2.6.10 Cytotoxicity Assay ......................................................... 54
3. Results ........................................................................................................ 55
3.1 Antibiotic Resistance Profiling and Source Attribution of C. jejuni
Isolates from Paediatric Diarrhoeal Cases ................................. 56
3.1.1 Isolation and Identification of C. jejuni ........................... 56
xviii
3.1.2 Antimicrobial Resistance Profiling .................................. 56
3.1.2.1 Multiple Drug Resistant Isolates ......................... 56
3.1.2.2 Detection of Metallo-β-Lactamase....................... 59
3.1.3 Source Attribution ............................................................ 59
3.2 Stress Adaptation in Type Six Secretion System Positive and
Negative C. jejuni Isolates ......................................................... 63
3.2.1 Determination of Sub-lethal Level of pH ......................... 63
3.2.2 Effect of Sub-lethal pH 4.5 on Motility ............................ 63
3.2.3 Effect of Sub-lethal pH 4.5 on Auto-aggregation and
Hydrophobicity ................................................................ 65
3.2.4 Effect of Sub-lethal pH 4.5 on Biofilm Formation ........... 65
3.2.5 Determination of Sub-lethal Level of Oxidative Stress ... 67
3.2.6 Effect of Sub-lethal Oxidative Stress (8mM of H2O2) on
Motility ............................................................................. 67
3.2.7 Effect of Sub-lethal Oxidative Stress (8mM of H2O2) on
Auto-aggregation and Hydrophobicity ............................ 69
3.2.8 Effect of Sub-lethal Oxidative Stress (8mM of H2O2) on
Biofilm Formation ............................................................ 69
3.2.9 Determination of Sub-lethal Temperature ....................... 71
3.2.10 Effect of Sub-lethal Temperature 55ºC on Motility ....... 71
3.2.11 Effect of Sub-lethal Temperature 55ºC on Auto-
aggregation and Hydrophobicity ................................... 73
3.2.12 Effect of Sub-lethal Temperature 55ºC on Biofilm
Formation ....................................................................... 73
3.3 Structural and Functional analysis of Hcp: Hallmark Protein of
T6SS ............................................................................................ 75
3.3.1 Expression and Purification of Recombinant and Mutant
Hcp Proteins .................................................................... 75
3.3.2 Confirmation of Eluted Protein as Hcp Protein by Mass
Spectroscopy ................................................................... 75
3.3.3 Dynamic Light Scattering (DLS).................................... 75
3.3.4 Crystallization ................................................................ 78
3.3.5 The Overall Structure of C. jejuni Hcp ........................... 84
xix
3.3.6 Comparison with Hcp-Cj with Known Crystal Structures
of Hcp ............................................................................. 87
3.3.7 Functional Analysis of Secretory Hcp Protein ............... 93
3.3.7.1 Cytotoxicity towards Prokaryotic Cells ............. 93
3.3.7.2 RBC Lysis Assay ............................................... 93
3.3.7.3 Cytotoxicity towards Eukaryotic Cells (HepG2) 93
3.3.7.4 Motility Assay ................................................... 96
3.3.7.5 Biofilm Assay ..................................................... 96
3.4 In silico Drug Target Identification of C. jejuni ......................... 99
3.4.1 Essential Non-homology Protein in C. jejuni ................. 99
3.4.2 KEGG Pathway Analysis .............................................. 99
3.4.3 Drugability Potential of the Shortlisted Proteins ......... 101
3.4.4 Prioritization of Druggable Target ............................... 101
3.5 Control of C. jejuni in Poultry by pH Sensitive Plant Extract
Encapsulated Alginate-Chitosan Nanoparticles ....................... 108
3.5.1 Screening of Plant for Anti-campylobacter Activity ..... 108
3.5.2 Active Anti-campylobacter fraction of Trachyspermum
ammi ............................................................................... 108
3.5.3 Influence on Bacterial Cell Survival .............................. 108
3.5.4 Gas Chromatography- Mass Spectroscopy Analysis ..... 111
3.5.5 Characterization of plant extract loaded Alginate Coated
Chitosan Nanoparticles ................................................. 115
3.5.5.1 Scanning Electron Microscopy ......................... 115
3.5.5.2 Atomic Force Microscopy ................................ 118
3.5.5.4 Encapsulation Efficiency .................................. 118
3.5.5.5 Cytotoxicity Assay ............................................ 118
3.5.5.6 pH Dependent Release Profile .......................... 118
3.5.5.3 Fourier Transform Infrared Spectroscopy ......... 121
3.5.7 In-vivo Trial in Chicken ................................................. 124
3.6 Metallic Nanoparticle as Control of C. jejuni Biofilms ........... 127
3.6.1 TiO2-Ag-Graphene Nanocomposites ............................. 127
xx
3.6.1.1 Minimal Inhibitory Concentration ..................... 127
3.6.1.2 Cell Survival ...................................................... 127
3.6.1.3 Hydrophobicity and Auto-aggregation .............. 127
3.6.1.4 Motility Assay .................................................... 129
3.6.1.5 DNA and Protein Leakage ................................ 129
3.6.1.6 Anti-biofilm Activity ......................................... 129
3.6.1.7 Cytotoxicity Assay ............................................. 129
3.6.2 Erbium doped Lithium Nickel Ferrite Nanoparticles .... 132
3.6.2.1 Minimal Inhibitory Concentration ..................... 132
3.6.2.2 Cell Survival ...................................................... 132
3.6.2.3 DNA and Protein Leakage ................................ 132
3.6.2.4 Motility Assay .................................................... 132
3.6.2.5 Anti-biofilm Activity ......................................... 135
3.6.2.6 Cytotoxicity Assay ............................................. 135
3.6.3 Zinc Oxide Nanoparticles .............................................. 137
3.6.3.1 Minimal Inhibitory Concentration ..................... 137
3.6.3.2 Cell Survival ...................................................... 137
3.6.3.3 Anti-biofilm Activity ......................................... 137
3.6.3.4 Cytotoxicity Assay ............................................. 137
4. Discussion ................................................................................................. 140
4.1 Conclusions ............................................................................... 155
4.2 Future Prospects ........................................................................ 156
5. References ................................................................................................ 157
Annexure (Meta data and publications) .......................................................... 188
xxi
LIST OF FIGURES
Fig. 1.1 Sources and transmission pathway of C. jejuni infections in human ......... 6
Fig. 1.2 Schematic model for T6SS components, assembly and effector translocation
into (a) the prey cell (b) and environment (adapted from Gallique et al., 2017) ........ 15
Fig. 2.1 Pet22b+ construct showing the insertion site of Hcp gene ...................... 36
Fig. 2.2 The overall scheme for identification of drug targets ............................ 40
Fig. 2.3 Scheme of Fractioning of Trachyspermum ammi extract ........................ 45
Fig. 3.1 Identification of C. jejuni isolates a) characteristics growth of C. jejuni on
mCCDA media; b) positive hippurate hydrolysis test; c) Species specific PCR for hipO
gene Lane 1- 1 kb ladder, Lane 2- 3, Isolates positive for hipO genes; Lane 4- Positive
control (Cj 255) ................................................................................................... 57
Fig. 3.2 Antibiotic resistance pattern of isolates C. jejuni against 13 tested antibiotics
........................................................................................................................... 58
Fig. 3.3 Detection of metallo-β-lactamases in C. jejuni using multiplex PCR assay
for MBL encoding genes i.e., IMP (188bp), SIM (390bp), and VIM (570bp) .......... 60
Fig. 3.4 Source predictive multiplex PCR: lane 1, 100-bp ladder; lane 2, strain BH20
(mPCR 1); lane 3, strain BH20 (mPCR 2); lane 4, strain SH11 (mPCR 1); lane 5, strain
SH11 (mPCR 2). mPCR 1 involved amplification of genes Cj1422, Cj1139 and Cj0056.
mPCR 2 involved amplification of genes Cj1324, Cj1720 and Cj0485. .................... 60
Fig. 3.4 Dendrogram displaying source attribution clusters of C. jejuni strains, based
on binary data of PCR profiles by using UPGMA analysis (PAST3.16 Software); Green
strain labels MAR=0.35-0.45, Blue strain labels- MAR=0.5-0.65, Red strain
labels=0.7-0.8; *** indicate isolates which are MBL producers ................................. 61
Fig. 3.5 Percentage and average MAR index of isolates attributed to livestock and
non-livestock clusters .................................................................................................. 62
Fig. 3.6 Average percentage survival of T6SS positive and negative strains at
different pH .................................................................................................................. 64
Fig. 3.7 Effect of sub-lethal pH (4.5) on motility of T6SS positive and negative
strains expressed in terms of fold change with respect to control .............................. 64
xxii
Fig. 3.8 Effect of sub-lethal pH (4.5) on hydrophobicity and auto aggregation of
T6SS positive and negative C. jejuni isolates (shown in term of average fold change in
each group)................................................................................................................... 66
Fig. 3.9 Effect of sub-lethal pH (4.5) on biofilm formation of T6SS positive and
negative C. jejuni isolates (shown in term of average fold change in each group). .... 66
Fig. 3.10 Average percentage survival of T6SS positive and negative strains at
different oxidative stress (2-12mM H2O2). .................................................................. 68
Fig. 3.11 Effect of sub-lethal oxidative stress (8mM) on motility of T6SS positive and
negative strains in terms of fold change with respect to control ................................. 68
Fig. 3.12 Effect of sub-lethal oxidative stress (8mM) on hydrophobicity and auto
aggregation of T6SS positive and negative C. jejuni isolates (shown in term of average
fold change in each group) ........................................................................................... 70
Fig. 3.13 Effect of sub-lethal oxidative stress (8mM) on biofilm formation of T6SS
positive and negative isolate (shown in term of average fold change in each group) . 70
Fig. 3.14 Average percentage survival of T6SS positive and negative strains at
different temperature stress (42-65ºC). ........................................................................ 72
Fig. 3.15 Effect of sub-lethal heat stress (55ºC) on average motility rate of T6SS
positive and negative strains with respect to control. .................................................. 72
Fig. 3.16 Effect of sub-lethal temperature stress (55⁰C) on hydrophobicity and auto
aggregation of T6SS positive and negative C. jejuni isolates (shown in term of average
fold change in each group) ........................................................................................... 74
Fig. 3.17 Effect of sub-lethal temperature stress (55⁰C) on biofilm formation of
individual T6SS positive and negative isolate (shown in term of average fold change in
each group)................................................................................................................... 74
Fig. 3.18 Hcp-Cj protein expression and purification a) BL21 cells showing
expression of Hcp protein (18kDa) in induced culture (IN) and no expression in
uninduced cells (UIN) b) Showing fraction obtained in Ni-NTA coulmn purification;
Lane M: marker, 1: elution, 2: Soluble fraction of cell lysate, 3: insoluble fraction of
cell lysate, 4: flow through after binding with Ni-NTA, Lane 5-7 three subsequent
wahes with imidazole, 8: Hcp protein bonded to beads after elution ......................... 76
Fig. 3.19 Size exclusion chromatography a) elution profile of Hcp protein b) SDS-
PAGE analysis of the eluted fractions of SEC (chosen from the shaded region) showing
purified Hcp-Cj protein. ............................................................................................... 76
xxiii
Fig. 3.20 Mass spectroscopy analysis a) Mass spectrum of tryptic peptide digest of
purified Hcp protein; b) peptides that matched with hcp protein of C. jejuni using
Mascot are underlined ................................................................................................. 77
Fig. 3.21 Dynamic light scattering analysis of Hcp-Cj at 10mg/ml concentration
showing the protein is homogenous with polydispersity index of 0.03 ....................... 77
Fig. 3.22 Overall structure of the Hcp-Cj from C. jejuni Cartoon representation of the
Hcp monomer (a) and hexameric ring (b).................................................................... 85
Fig. 3.23 Multiple sequence alignment of Hcp-Cj with its homologs ..................... 88
Fig. 3.24 Structural alignment (a) showing that Hcp-Cj (with homolog protein) vary
greatly in length and composition especially the overhang loops L1,2 and L2,3 [Green:
Hcp_Cj, Magenta: EvpC (3EAA), Brown: B. pseudomallei (3WX6), Hot pink: E. coli
(4HKH), Yellow: P. aeruginosa Hcp3(3HE1), Cyan: P. aeruginosa Hcp1 (1Y12),
Blue: A. baumannii (4W64)]. b) Showing residues 30R and 31Y which were mutated
to Alanine ..................................................................................................................... 89
Fig. 3.25 Conserved residues on the Hcp surface. Deep red color represents highly
conserved residues and blue represent variable residues. External surface of the
hexamer is moderately conserved (a, b, e) as whereas the internal surface has
comparatively more variable residues (d). Conserved region mainly lies in the beta
sheets and helix (c)....................................................................................................... 90
Fig. 3.26 Effect of Hcp exposure on the growth of T6SS positive (strain ID 77, 255);
T6SS negative (strain ID 301, Akc27) and Dh5α. ....................................................... 94
Fig. 3.27 Hemolysis assay depicting that exposure of recombinant type hcp,
HcpR30A mutant and HcpY31A mutant protein didn’t caused lysis of Sheep
erythrocytes. Control group show lysis of RBC by 1% SDS ..................................... 94
Fig. 3.28 Cytotoxicity of recombinant and mutant Hcp-Cj towards HepG2 cells. A)
Showing reduction in HepG2 cells viability (%) on exposure to recombinant type and
mutant Hcp-Cj. B) Microscopic image of untreated and treated (Hcp-Cj exposed)
HepG2 cells. ................................................................................................................. 95
Fig. 3.29 Motility assay showing that recombinant and mutant Hcp-Cj didn’t cause
significant change in zone of motility of both type six positive (77, 255) and type six
negative strains (301, akc27) ....................................................................................... 97
Fig. 3.30 Effect of recombinant and mutant Hcp-Cj on Biofilm formation in C. jejuni.
a) Biofilm formation was significantly enhanced on exposure to Hcp-Cj as compared
xxiv
to unexposed cells. b) No significant difference in biofilm formation on exposure to
mutant and recombinant type Hcp-Cj was observed. .................................................. 97
Fig. 3.31 Number of essential non-homologous proteins of C. jejuni involved in
common (blue) and unique pathways ....................................................................... 100
Fig. 3.32 Anti-campylobacter activity of crude extract of A) positive control
Ampicillin, B) Trachyspermum annum (28.5mm), C) Mentha longifolia (17mm), D)
Camellia sinensis (23mm) E) Berberis lycium (26.5mm) F) Nigella sativa (25.5mm)
.................................................................................................................................... 109
Fig. 3.33 MTT assay showing the anti-campylobacter activity of different fraction of
Trachyspermum annum (seeds). Four fractions were found to be active with i.e.,
methanolic fraction (MF), hexane fraction (HF), butanol fraction (BF) and ethyl acetate
fraction (EF) with minimum inhibitory concentration of 0.125, 0.0362, 0.25 and 0.5
mg/ml respectively ..................................................................................................... 109
Fig. 3.34 Time dependent cell survival assay a) graph showing log reduction in
CFU/ml on exposure to hexane fraction of T. annum ............................................. 110
Fig. 3.35 The GC analysis of n-hexane fraction of Trachyspermum ammi seeds
showing four major peaks .......................................................................................... 112
Fig. 3.36 Mass spectra of peaks with retention time of a) 2.23 minutes identified as
4—Cyclohexadiene b)2.54 minutes identified as Mitozolomide c) 4.08 minutes
identified as Thymol) 4.151 minutes identified as 4 Hydroxy,3 methyl acetophenone.
.................................................................................................................................... 113
Fig. 3.37 Scanning Electron Microscopy (SEM) images of a) empty chitosan
nanoparticles (CNP) b) alginate coated chitosan nanoparticles (PE-CNP) c) plant
extract loaded chitosan alginate nanoparticles (PE-CANP) showing that the size of the
nanoparticles was below 100nm and nanoparticles were evenly distributed ............ 116
Fig. 3.38 Atomic force microscopic images showing surface topography and 3-
Dimensional (3D) structures of a) Chitosan nanoparticle (CNP) b) Alginate coated
chitosan nanoparticles (CANP) c) Alginate coated chitosan nanoparticle loaded with
plant extract (PE-CANP). .......................................................................................... 119
Fig. 3.39 Cytotoxicity assay of plant extract (PE), empty alginate coated chitosan
nanoparticles (CANP) and plant extract loaded chitosan alginate nanoparticles (PE-
CANP) using Human neuroblastoma cells (SH-SY5Y). Untreated cells were used as
negative controls ........................................................................................................ 120
xxv
Fig. 3.40 pH dependent release profile showing percentage release of plant extract
from Alginate coated chitosan nanoparticles (PE-CANP) at acidic (3.0) and neutral
(7.0) pH ..................................................................................................................... 120
Fig. 3.41 Fourier-transform infrared spectroscopy analysis showing spectra of a)
Plant extract (PE) b) Alginate coated chitosan nanoparticles (CANP) c) Alginate coated
chitosan nanoparticle loaded with plant extract (PE-CANP) ............................ 122
Fig. 3.42 Log reduction in C. jejuni CFU/g of chicken fecal samples at day 7 and 14
post infection in CANP (empty alginate coated chitosan nanoparticles), PE group (Plant
extract as feed additive), PE-CANP (Plant extract encapsulated alginate coated chitosan
nanoparticles as feed additive). .................................................................................. 125
Fig. 3.43 Average feed to gain ratio of chickens at day 7 and 14 post infection in
CANP group (empty alginate coated chitosan nanoparticles), PE group (Plant extract
as feed additive), and PE-CANP group (Plant extract encapsulated alginate coated
chitosan nanoparticles as feed additive). ................................................................... 125
Fig. 3.44 Log reduction in C. jejuni CFU/g of chicken caecum at day 21st post
infection in CANP (empty alginate coated chitosan nanoparticles), PE group (Plant
extract as feed additive), PE-CANP (Plant extract encapsulated alginate coated chitosan
nanoparticles as feed additive) ................................................................................... 126
Fig. 3.45 Average feed to gain ratio of chickens at day 7 and 14 post infection in
CANP group (empty alginate coated chitosan nanoparticles), PE group (Plant extract
as feed additive), and PE-CANP group (Plant extract encapsulated alginate coated
chitosan nanoparticles as feed additive). ................................................................... 126
Fig. 3.46 Influence of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG) and
Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles on the growth of C. jejuni ............ 128
Fig. 3.47 Effect of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG) and
Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles on hydrophobicity and aggregation of
C. jejuni ...................................................................................................................... 128
Fig. 3.48 Effect of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG) and
Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles on C. jejuni motility ..................... 130
Fig. 3.49 Inhibition of biofilm activity of C. jejuni by TiO2, TiO2-graphene
(TiO2/GR), Ag-TiO2 (TiO2/AG) and Ag/TiO2-graphene (TiO2/GR/AG nanoparticles
.................................................................................................................................... 130
xxvi
Fig. 3.50 Leakage of DNA and protein in response to 2 and 4 h exposure of Ag/TiO2-
graphene (TiO2/GR/AG nanoparticles) expressed in terms of cytoplasmic leakage
index ........................................................................................................................... 131
Fig. 3.51 Cytotoxicity of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG) and
Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles towards Human neuroblastoma cells
(SH-SY5Y) ................................................................................................................ 131
Fig. 3.52 Size dependent antibacterial activity of Erbium doped Li-Ni ferrite
nanoparticles shown in terms of Minimum inhibitory concentration (MIC) ............. 133
Fig. 3.53 Influence of Erbium doped Li-Ni ferrite nanoparticles on the growth of C.
jejuni .......................................................................................................................... 133
Fig. 3.54 Leakage of DNA and protein in response to 2 and 4 hrs exposure of
Ag/TiO2-graphene (TiO2/GR/AG nanoparticles) expressed in terms of cytoplasmic
leakage index ............................................................................................................ 134
Fig. 3.55 Inhibition of biofilm activity of C. jejuni by erbium doped Li-Ni ferrite
nanoparticles .............................................................................................................. 136
Fig. 3.56 Cytotoxicity of different sized erbium doped Li-Ni ferrite towards Human
neuroblastoma cells (SH-SY5Y) ................................................................................ 136
Fig. 3.57 Determination of Minimum Inhibitory Concentration of ZnO nanoparticles
using tetrazolium chloride based micro-dilution method .......................................... 138
Fig. 3.58 Influence of ZnO nanoparticles on the growth of C. jejuni ..................... 138
Fig. 3.59 Inhibition of biofilm activity of C. jejuni by ZnO nanoparticles ............. 139
Fig. 3.60 Cytotoxicity of ZnO nanoparticles towards Human neuroblastoma cells
(SH-SY5Y) ................................................................................................................ 139
xxvii
LIST OF TABLES
Table 1.1 Virulence factors of C. jejuni ............................................................... 10
Table 2.1 Detail of Primers and PCR conditions used in this study .................... 32
Table 2.2 Detail of nanoparticles used ................................................................. 51
Table 3.1 Screening of crystal condition using Index Screens (Hampton Research)
HR2-110 conditions 1-24 .......................................................................................... 79
Table 3.2 Sub-optimization of Crystal Screen HR2-110 condition no. 4 i.e., 0.1
Tris-HCl 8.5, 2M Ammonium Sulphate .................................................................... 81
Table 3.3 Sub-optimization of Crystal Screen HR2-110 condition no. 17 i.e., 0.2M
Lithium Sulphate monohydrate, 0.1 M Tris-HCl 8.5, 30% PEG ............................... 82
Table 3.4 Sub-optimization of Crystal Screen HR2-110 condition no. 22 i.e., 0.2M
Sodium acetate trihydrate, 0.1 M Tris-HCl 8.5, 30% PEG ........................................ 83
Table 3.5 Data collection and refinement statistics. ............................................ 86
Table 3.6 Sequence and structural comparison of Hcp-Cj with its homologs ..... 91
Table 3.7 Druggable target of C. jejuni before prioritization ........................... 103
Table 3.8 List of Druggable target of C. jejuni after prioritization .................... 106
Table 3.9 Statistical summary of drug target identification of C. jejuni. .......... 107
xxviii
LIST OF ABBREVIATIONS
Å Angstrom
AF Aqueous Fraction
AFM Atomic Force Microscopic
Ag Silver
AGDP Agricultural Gross Domestic product
Ag-TiO2 Silver-Titanium Oxide
AMR Antimicrobial Resistant
Amu Atomic Mass Unit
ATCC American Type Culture Collection
BF n-Butanol
BHI Brain Heart Infusion
bp Base Pair
CAMP Cationic Antimicrobial Peptide (CAMP) Resistance
CANP Alginate Coated Chitosan Nanoparticles
CDT Cytolethal Distending Toxin
CF Chloroform
CFU Colony Forming Unit
CLSI Clinical and Laboratory Standards Institute
CNP Empty Chitosan Nanoparticles
DEG Database of Essential Genes
DLS Dynamic Light Scattering Analysis
DMEM Dulbecco’s Modified Eagle Medium
DMSO Dimethyl Sulfoxide
DNA Deoxyribonucleic Acid
dNTPs Deoxyribose Nucleotide Triphosphates
DTT Dithiothreitol
EDTA Ethylenediamine Tetra acetic acid
EE Encapsulation Efficiency
xxix
EF Ethyl Acetate
EFSA European Food Safety Authority
ESBL Extended-spectrum β-Lactamase
FBS Fetal bovine serum
FCR Feed to Gain Ratio
FDA Food and Drug Administration
FTIR Fourier-transform Infrared Spectroscopy
GBS Guillain Barre’ Syndrome
GC-MS Gas Chromatography Mass Spectrometry
GIM German Imipenemase
GRAS Generally Recognized as Safe
H2O2 Hydrogen per Oxide
hcp Hemolysin Coregulated Protein
Hcp-Cj Hemolysin Coregulated Protein- C. jejuni
HepG2 Hepatoma G2 cell line
HF n-Hexane
HipO Hippurate Hydrolysis
IBS Irritable Bowel Syndrome
IcmF Intracellular Multiplication Factor
IMP Imipenemase
IPTG Isopropyl β-D-1-Thiogalactopyranoside
KBr Potassium Bromide
kDa Kilo Dalton
KEGG Kyoto Encyclopedia of Genes and Genomes
LB Lauria Broth
Li-Ni Lithium-Nickel
LOS Lipooligosaccharide
LPS Lipopolysaccharide
MBL Metallo-β-lactamases
mCCDA Modified Charcoal Cefoperazone Deoxycholate Agar
MDR Multi Drug Resistant
xxx
MF Methanolic Fraction
MFS Miller Fisher Syndrome
MH Mueller Hinton
MIC Minimum Inhibitory Concentration
mL Milliliter
MLST Multi Locus Sequence Typing
mM Millimolar
mPCR Multiplex Polymerase Chain Reaction
MRSA Methicillin Resistant Staphylococcus aureus
μL Microliter
µm Micrometer
MTT [3-(4, 5-Dimethylthiazol-2yl)-2, 5-Diphenyltetrazolium Bromide]
NCS Non-Crystallographic Symmetry
NCTC National Collection of Type Cultures Xii
Ni-NTA Nickel-nitrilotriacetic acid.
nm Nanometer
O. D Optical Density
PAGE Polyacrylamide Gel Electrophoresis
PBS Phosphate Buffered Saline
PCR Polymerase Chain Reaction
PDB Protein Data Bank
PE Plant Extract
PE-CANP Plant Extract Encapsulated Chitosan Alginate Nanoparticles
PEG Poly Ethylene Glycol
pH Power of Hydrogen Ion
RBC Red Blood Cells
RMSD Root Mean Square Deviation
SDS Sodium Dodecyl Sulfate (SDS)
SEM Scanning Electronic Microscopy
SIM Sao Paulo Metallo-beta-lactamase
SPM Seoul Imipenemase
xxxi
SRB Sulforhodamine B
STE Sodium Chloride Tris-EDTA
T3SS Type Three Secretion System
T4SS Type Four Secretion System
T6SS Type Six Secretion System
Taq Thermus Aquaticus
TE Tris EDTA
TiO2 Titanium Oxide
TiO2/Ag/Gr Titanium-Silver- Oxide-Graphene
TiO2/Gr Titanium Oxide-Graphene
TPP Sodium Tripolyphosphate
TTC Triphenyl tetrazolium Chloride
UPGMA Unweighted Pair Group Method Analysis
UV Ultra Violet
VBNC Viable But Non Culturable
vgrG Valine Glycine Repeats G
VIM Verona Imipenemase
WHO World Health Organization
ZDC Zone of Motility in Control
ZDT Zone of Motility in Treated
ZnO Zinc Oxide
Chapter 1 Introduction
1
Chapter 1
Introduction
Chapter 1 Introduction
2
Diarrhoea, is considered as the leading cause of death among children below 5 years of
age worldwide, accounting for 525,000 deaths per annum (WHO, 2017a). Diarrhoea,
the passage of three or more loose or liquid stools per day, is a preventable and treatable
disease. Mortalities linked to diarrhoea mostly occur due to acute dehydration or fluid
loss, and less commonly due to bacteremia. Diarrhoeal infections are transmitted
through contaminated food, water and even from person to person. Poor sanitation,
unsafe drinking water, malnutrition and low immunity are the major risk factors
associated with diarrhoea, thus making developing countries more susceptible to such
infections as compared to developed countries. Diarrhoeal infections are caused by a
variety of gastrointestinal bacteria (Campylobacter spp, Salmonella spp, Vibrio
cholera, Shigella spp and enterotoxigenic Escherichia coli,), viruses (rotavirus,
norovirus, adenovirus and asterovirus) and parasites (Giardia lamblia, Entamoeba
histolytica, Isospora belli, Cryptosporidium spp) (Platts-Mills et al., 2015). Among all
the listed causative agents of diarrhoea Campylobacter spp. is classified as the most
common cause of bacterial associated with acute diarrhoea worldwide (WHO, 2012,
Platts-Mills et al., 2015).
1.1 Campylobacter spp
1.1.1 History and Taxonomy
Campylobacter was first identified in 1886 by Theodor Escherich in the stool samples
of children suffering from a disease he called ‘cholera infantum’ (Friedman et al.,
2000). In 1909, McFadyean and Stockman isolated Campylobacter from aborted ewes’
fetuses and later the same microaerophilic spiral bacterium was also reported to be
associated with infectious abortions in sheep and calves by several researchers
(McFadyean and Stockman, 1913; Vinzent et al., 1950; Fox, 1982; Franco, 1988).
Smith isolated and named these bacteria as ‘Vibrio fetus’ based on its spiral morphology
(Smith, 1919). In 1957 and 1972, similar Vibrios were reported to be isolated from
blood and stool of diarrhoeal patient respectively. In 1963, these Vibrios were grouped
as a new genus i.e., Campylobacter, based on differences in carbohydrate fermentation
and DNA guanine-cytosine (GC) content, by Sebald and Véron (Veron, 1973). First C.
jejuni from the blood and stool sample of diarrhoeal patient was isolated in 1972 by
Dekeyser and coworkers using differential filtration using 0.65-µm filters (Dekeyser et
Chapter 1 Introduction
3
al., 1972). In 1977, Skirrow developed a method for selective recovery of C. jejuni from
stool specimens which further led to introduction of easy and reliable method of
isolation used nowadays (Skirrow, 1977). Campylobacter from stool samples, in
modern day laboratories, are routinely isolated by growing them using selective culture
media supplemented with antibiotics and incubating them under microaerophilic
conditions at elevated temperature (42oC). Campylobacter spp. belongs to genus
“Campylobacter”, of epsilon class of proteobacteria, which comprises of 26 species and
nine subspecies. C. jejuni and C. coli are major foodborne pathogens and are associated
with gastroenteritis. C. jejuni is further divided into two subspecies, namely C. jejuni
subspecies jejuni and C. jejuni doylei (Hendrixson and Rita, 2004).
1.1.2 General Characteristics
Members of Campylobacter spp. are non-spore forming, curved or spiral rod with size
ranging from 0.2-0.5 µm in diameter and 0.5-5µm in length (Hansson et al., 2007).
Campylobacters are pleomorphic as they appear as short spiral in log phase, long spiral
in mid stationary phase and coccoid in late stationary phase (Griffiths, 1993;
Tangwatcharin et al., 2006). The cells are highly motile and have unipolar or bipolar
flagella which help them to move in a corkscrew-like motion (Silva et al., 2011;
Kaakoush et al., 2015). C. jejuni are fastidious in nature and are microaerophilic i.e.,
can grow in the presence of low oxygen (5% O2, 10% CO2, and 85% N2) (Kelly, 2001,
Garénaux et al., 2008). These bacteria are catalase and oxidase positive but do not
possess urease enzyme. C. jejuni are thermotolerant with optimum growth temperature
of 42ºC, as they do not possess cold shock protein therefore cannot grow below 30 0C
(Hazeleger et al., 1998). C. jejuni can hydrolyze hippurate which help it differentiate it
from C. coli that are otherwise phenotypically and genotypically similar (Roop et al.,
1984).
1.1.3 Epidemiology of Campylobacter jejuni
Campylobacteriosis, diarrhoeal illness caused by Campylobacter spp, is considered as
a major public health concern worldwide with estimated cases of 500 million per annum
(Chlebicz et al., 2018). More than 90% of campylobacteriosis cases reported in human
are associated with C. jejuni, therefore accounting for the major burden of the disease
Chapter 1 Introduction
4
(Friedman et al., 2000; Gillespie et al., 2002; Moore et al., 2005). Campylobacteriosis
is generally self-limiting, with symptoms like watery or bloody diarrhoea, abdominal
cramps, fever, myalgia, headache, nausea and vomiting (Black et al., 1988).
Sometimes, C. jejuni infection may lead to sequel with long term consequences like
Guillain-Barré syndrome (GBS), Miller Fisher syndrome (MFS) and Irritable Bowel
syndrome (IBS) (Blaser and Engberg, 2008). The infection dose of C. jejuni in humans
is low; as few as 500 organisms can cause infection (Chlebicz et al., 2018). Although
the infection may occur among individuals of all age groups, however, children under
5 years of age are the major risk group (Butzler, 2004). Moreover,
immunocompromised individuals are more likely to suffer from campylobacteriosis as
compared to normal individuals. Though campylobacteriosis can occur throughout the
year but the incidence of disease is markedly increased in late spring and early summers
(Hudson et al., 1999).
The exact global burden of bacterial gastroenteritis due to Campylobacter spp. is
unknown, especially in low income countries, but in high-income countries the annual
incidence has been estimated to be 4.4-9.3 per 1000 population. This incidence varies
from region to region i.e., in the European Union 59.8 cases have been reported per
100,000 persons, in the US 14.3 cases/100,000, whereas 161 cases/100,000 are reported
in New Zealand (Ailes et al., 2008; Sears et al., 2011; Havelaar et al., 2013). Similarly,
C. jejuni has been reported as one of the most common cause of gastroenteritis in China,
Japan and India (Huang et al., 2009; Chen et al., 2011; Kubota et al., 2011; Mukherjee
et al., 2013; Mukherjee et al., 2014). In Pakistan, the high prevalence of
Campylobacter spp has been reported among food commodities such as chicken meat,
vegetable/fruit salad, beef and milk (Hussain et al., 2007; Nisar et al., 2018). C. jejuni
has also been the most frequently reported cause of childhood diarrhoea and dysentery
in Karachi and Rawalpindi, Pakistan (Ali et al., 2003; Soofi et al., 2011). The
epidemiological data of campylobacteriosis from Asia and the Middle East is under
reported due to the lack of proper surveillance system, diagnostic system and public
awareness. However, the numbers of campylobacteriosis cases have increased
significantly worldwide during the last two decades making it the most common
Chapter 1 Introduction
5
zoonotic infection surpassing both salmonella and shigella (EFSA, 2011; Havelaar et
al., 2013).
C. jejuni infections are generally sporadic but rare outbreaks have been reported in the
UK, Denmark, USA, China, Korea, and Canada which are mostly associated with
consumption of contaminated water, milk and meat (Gubbel et al., 2012; Taylor et al.,
2013; Kaakoush et al., 2015).
1.2 Transmission of Campylobacteriosis
Campylobacteriosis is a zoonotic food-borne disease as it has a broad host range
including domestic (poultry, cattle, sheep) and wild animals; and usual routes of
infection for humans are raw meat or cross-contaminated food products. The disease
(50-70% of reported cases) is mainly transmitted by consumption of contaminated raw
and undercooked poultry meat, unpasteurized milk, raw vegetables and unhygienic
water. Cases of campylobacteriosis transmitted via direct contact with domesticated
animals, especially birds and cats, have also been reported (Ketley, et al., 1997;
Kapperud et al., 2003). Apart from zoonotic transmission, traveling to endemic regions
can also be an additional risk factor for acquiring the infection. Several cases have been
associated with recent travel to other countries and such acquired infections are
generally more resistant to antibiotics than domestic cases (Kassenborg et al., 2004;
Evans et al., 2009). However, the source of approximately 50% of all infections is still
unknown (Janssen et al., 2008).
1.2.1 Sources and Reservoirs
C. jejuni, despite being fastidious in nature, is widespread in nature as it has number of
host and reservoirs which protect them against harsh environment. C. jejuni is a normal
commensal in the gut of animals like chicken, cattle, wild birds, pig, dog and sheep.
But when transmitted to a human host it can cause disease (Whiley et al., 2013). The
sources and transmission pathways of C. jejuni infection are summarized in Fig 1.1.
Chapter 1 Introduction
6
Fig. 1.1 Sources and transmission pathway of C. jejuni infections in human
(adapted from Kaakoush et al., 2015)
Chapter 1 Introduction
7
1.2.1.1 Poultry as a major source of C. jejuni infections
Poultry is considered the major source of campylobacteriosis in humans. C. jejuni,
being a thermotolerant, prefer poultry as host due to its high metabolic temperature (40-
42oC) (Horrocks et al., 2009). Generally, C. jejuni resides in the gut of chicken, turkeys,
ducks, goose game foul and ostrich without causing any illness in the host organisms.
Out of all poultry products, chicken is a major risk of campylobacteriosis accounting
for more than 50% of food born transmission. Consumption of non-chlorinated water
by the chickens exposes them to C. jejuni. The microbe spreads from one chicken to
whole flock within 3-5 days through infected faeces, water, insects, rodents or farm
workers, hence becomes very difficult to contain (Ridley et al., 2011; Saint-Cyr et al.,
2016). C. jejuni generally colonize the mucosa of the caecum of infected chickens but
has also been reported to be present in the blood, liver and spleen. One gram of fecal
matter of infected chicken can contain up to 1010 CFU of bacteria (Lin et al., 2009,
Bolton et al., 2015). The bacterium is transmitted from the meat of carrier birds to
originally non-carriers after encountering dropping during slaughtering process.
It has been estimated that 60% of retailer chicken meat in the EU and the US are
infected with C. jejuni (Epps et al., 2013; Whiley et al., 2013). Although, the disease
can be transmitted to human through direct contact with infected chicken and
consumption of infected eggs, but majority of the cases have been attributed to eating
of raw or undercooked chicken (Epps et al., 2013). It has been estimated that human
campylobacteriosis can be reduced by 30-fold by reducing the load of C. jejuni CFU
broiler carcass by 2-log (Rosenquist et al., 2003).
1.2.2 Source Tracking of C. jejuni Infections
Source attribution can help identify the origin of C. jejuni infection and antibiotic
resistance acquisition which will in turn help prevent the spread of disease. Due to high
genetic diversity and low host specificity among C. jejuni strains, it is challenging to
estimate the contribution of a specific source in human infections. Nevertheless, several
microbial typing methods have been used to track the source of C. jejuni infections in
human such as multilocus sequence typing (MLST), microarrays analysis, source
predictive PCR and whole genomes sequences (WGS) (Dingle et al., 2001; Dorrell et
al., 2001; Colles et al., 2003; Leonard et al., 2003; Pearson et al., 2003; Champion et
Chapter 1 Introduction
8
al., 2005; Kwan et al., 2008; Foley et al., 2009; Stabler et al., 2013). Although, the
multilocus sequence typing is the most widely used typing method for strain
comparison but in developing countries like Pakistan, source predictive PCR provide
reliable and cheap alternate for genotyping of human isolates to predict their source of
origin.
1.2.3 Antibiotic Resistance
Campylobacteriosis is generally a self-limiting disease but antibiotics like macrolides
(azithromycin and erythromycin) and fluoroquinolones (ciprofloxacin) are
recommended in immunocompromised, invasive or asymptomatic cases (Allos, 2001;
Smith and Fratamico, 2010). Majority of the C. jejuni isolates have been reported
worldwide to be intrinsically resistant to a few antibiotics, including bacitracin,
novobiocin, rifampin, streptogramin B, trimethoprim, vancomycin, and usually
cephalothin. Over the past two decades, the emergence of multidrug resistant C. jejuni
especially against erythromycin, fluoroquinolones and tetracycline have been reported
from both developing and developed countries (Alfredson and Korolik, 2007;
Wieczorek and Osek, 2013). Being a zoonotic pathogen, antimicrobial resistance
acquired by C. jejuni isolates has been mainly attributed towards use of these antibiotics
as prophylaxis in animal farming (Wilson et al., 2008; Mughini-Gras et al., 2013).
Disproportionate use of antibiotics in livestock industry results in development of more
resistant isolates on bacterial pathogens by either mutation or by acquisition of
antibiotic resistance genes through horizontal gene transfer (Holmes et al., 2016).
Antibiotics belonging to β-Lactams class have been used as preferably due to their high
efficacy and low toxicity to humans. The choice of β-Lactams is reduced to
carbapenems when infections are caused by extended-spectrum β-Lactamase (ESBL)
producing organisms (Dalhoff and Thomson, 2003). Such extended-spectrum β-
Lactamase (ESBL) producing isolates have also been reported in C. jejuni.
Carbapenems are β-lactam antibiotics that are highly effective against number of gram
positive and negative bacteria which are resistant to other β-lactam antibiotics. So far,
carbapenem resistant Pseudomonas spp, K. pneumoniae, Acinetobacter baumannii and
Escherichia coli have been reported which produce Carbapenemases or AmpC enzyme
to hydrolyze the antibiotics (Brink et al., 2004; Yong et al., 2009). Till date, no strain
Chapter 1 Introduction
9
belonging to Campylobacter genus have been reported to be shown resistance to
carbapenem making it an effective choice of control of severe infection.
In Pakistan data related to prevalence, antibiotic resistance and source prediction of C.
jejuni infection s is very limited due to lack of proper surveillance program (Ali et al.,
2003; Soofi et al., 2011; Siddiqui et al., 2015a). Such epidemiological data may provide
a better insight into to the current status of disease in the local population and will also
help develop better control strategies against it.
1.3 Pathogenesis of C. jejuni
Ingestion of as few as 500 CFU of C. jejuni is enough to establish an infection in the
gastrointestinal tract of human. The adhesion and invasion of intestinal epithelial cells
triggering pro-inflammatory response, by inducing the production of interleukin (IL)-
8, and eventual recruitment of dendritic cells, macrophages and neutrophils. Virulence
factor like motility, chemotaxis, adhesion, invasion and toxin production play a vital
role in successful colonization but the precise mechanism of pathogenesis of C. jejuni
is still unknown (Bouwman et al., 2013). The whole genome sequence of the C. jejuni
NCTC11168 has provided valuable insight into the pathogenesis, by verifying that
cytolethal distending toxin (CDTs) is the only toxins produced by the bacterium
(Parkhill et al., 2000). Furthermore, presence of homopolymeric G/C repeats and lack
of DNA repair genes in the genome may lead to phase variation which in turn may
enhances virulence potential and adaptation responses to environmental stresses
(Bayliss et al., 2012). Some of the key virulence factors associated with C. jejuni is
discussed in the following section (Table 1.1).
1.3.1 Motility
C. jejuni are highly motile bacteria and this ability helps them reach, invade and
colonize the host intestinal cells. Motility of C. jejuni is due to presence of polar flagella
which allows the bacterium to invade the mucosal barrier of intestinal epithelial cell
and hence considered essential for invasion and colonization
Chapter 1 Introduction
10
Table 1.1 Virulence factors of C. jejuni
Virulence Factors
Genes
References
Motility FlaA and FlaB
FlgR, RpoN and
FliA
Guerry et al., 1990; Nuijten et
al., 1990b; Alm et al., 1993;
Nuijten et al., 1995; Wösten et
al., 2004
Adhesion and Invasion CadF, FlpA, JlpA,
CiaA, CiaB, CiaI,
FlaC, FspA, flgB
and FlgE
Konkel et al., 1999; Jin et al.,
2003, Konkel et al., 2004; Song
et al., 2004, Poly et al., 2007;
Christensen et al., 2009;
Flanagan et al., 2009; Konkel et
al., 2010; Buelow et al., 2011;
Eucker and Konkel, 2012
Toxin production
Cytolethal distending toxin
(CDT)
CdtA, CdtB and
CdtC
Whitehouse, 1998; Hickey et
al., 2000; Lai et al., 2016.
Asakura et al., 2008
Flagellin O-linked
glycosylation proteins.
Cj1321-Cj1325/6 Champion et al, 2005.
Capsule KspM Bacon et al., 2001
Chapter 1 Introduction
11
(Nachamkin et al., 1993). The flagellum is composed of subunits of flagellin proteins,
encoded by two genes flaA and flaB which share a high degree of sequence homology
(Wassenaar and Blaser, 1999). Although expression of both flaA and flaB is crucial for
colonization of C. jejuni, but flaA is highly expressed as compared to flaB (Guerry et
al., 1990). Expression of both protein are independent of each other as gene expression
of flaA is regulated by r28 promoter, whereas that of flaB gene by r54 promoter (Guerry
et al., 1990; Nuijten et al., 1990b; Alm et al., 1993; Nuijten et al., 1995). Moreover,
flaA has also been shown to be linked with auto-agglutination (AAG) ability of
bacterium as flaA mutant lack this ability (Guerry et al., 2006). The regulation of
flagellin protein is very complex as flaA regulon is composed of 32 individual loci.
Although a few flagellar transcription activators like FlgR, RpoN and FliA have been
identified but the precise mechanism of their regulation and assemble is unknown
(Wösten et al., 2004).
1.3.2 Adhesion and Invasion Factors
After penetrating intestinal mucosal lining, adhesion and invasion of the epithelial cells
is crucial for long term establishment of infection (Jin et al., 2001). Very few adhesin
proteins with known host cell receptor are identified in C. jejuni which include CadF,
FlpA and JlpA. Fibronectin binding protein (CadF) and fibronectin-like protein A
(FlpA) help C. jejuni to bind to fibronectin (Fn) of host gastrointestinal tract (Konkel
et al., 2010; Flanagan et al., 2009). Both these genes are crucial for adherence as
mutation in either of the gene leads to reduction in the adherence of C. jejuni to human
INT 407 cells (Monteville et al., 2003; Flanagan et al., 2009). Jejuni lipoprotein (JlpA)
is an outer membrane protein which binds to heat shock protein 90 (Hsp90) of HEp-2
epithelial host cells and activates NF-κB and p38 MAP kinase (Jin et al., 2003). JlpA
mutant strains have shown reduced adherence to HEp-2 epithelial cells (Jin et al.,
2001).
Invasion of host epithelial cells is the key difference that leads to infection by C. jejuni
in humans as compared to chickens (Young et al., 2007). On contact with host cells or
serum factors, C. jejuni secrete a class of secreted factor proteins called Campylobacter
invasion antigen (Cia) (Konkel et al., 1999b). CiaB is an effector protein which helps
internalization of bacterium into the INT-407 cells and its secretion is dependent upon
Chapter 1 Introduction
12
flagellar subunits (Konkel et al., 1999, Konkel et al., 2004). CiaC is essential for
maximal invasion of INT-407 cells, whereas CiaI is involved in intracellular survival
of C. jejuni (Christensen et al., 2009; Buelow et al., 2011; Eucker and Konkel, 2012).
Secretory protein FlaC binds to Hep2 cells and help in bacterial invasion (Song et al.,
2004). The FspA protein is secreted by flagellum and induces apoptosis in INT-407
cells (Poly et al., 2007). Several flagellar proteins also take part in invasion mechanism
in host epithelial cells like flaA, flaB, flgB and flgE (Konkel et al., 2004; Poly and
Guerry, 2008).
1.3.3 Toxin Production
C. jejuni produce cytolethal distending toxin (CDT) which is a genotoxin composed of
three subunits namely CdtA, CdtB and CdtC (Whitehouse, 1998; Asakura et al., 2008).
CdtB is a DNase that induces double-strand breaks in the DNA, and which eventually
leads to cell apoptosis. CdtA and CdtC subunits are involved in delivery of CdtB to the
host cells by binding to cholesterol-rich microdomains of the host cell membrane (Lai
et al., 2016). Cytolethal distending toxin (Cdt) has also been associated with prolonged
survival in macrophages (Hickey et al., 2000).
1.3.4 Surface Carbohydrates
C. jejuni display several carbohydrate-based structures on its surface such as
lipopolysaccharides (LOS), capsule and O- and N-linked glycans which act as
important virulence factors. Lipopolysaccharides (LOS) are composed of
oligosaccharides and lipids that play major role in host immune system evasion,
adhesion to host cell and invasion. Sialylation of LOS causes increase in cell adhesion
of C. jejuni and reduces immunogenicity (Guerry et al., 2000; Louwen et al., 2008).
Polysaccharide capsule of C. jejuni helps in survival of bacteria, adherence to the cell
and evasion of immune system (Karlyshev et al., 2004). Mutation gene encoding for
polysaccharide transport protein (KspM) results in reduced invasion and colonization
of C. jejuni (Bacon et al., 2001). C. jejuni possess both O and N linked protein
glycosylation systems which are encoded by pgl gene and (Szymanski et al., 2003). O-
linked glycosylation system in C. jejuni is apparently associated with the modification
of only flagellin subunits and hence is essential for filament biogenesis (Goon et al.,
Chapter 1 Introduction
13
2003). On the other hand, N-linked glycosylation system is responsible for post
translational modification of more than 60 periplasmic proteins. Mutant C. jejuni with
defective N-linked glycosylation system show reduced invasion and colonization in
intestinal epithelial cells and in animals respectively (Szymanski et al., 2002;
Hendrixson and DiRita 2004).
1.3.5 Secretion Systems
Secretion systems provide selective advantage to both pathogenic and non-pathogenic
bacteria by enhancing their virulence potential and environmental adaptation
respectively (Aschtgen et al., 2010; Schwarz et al., 2010). Bacterial secretion systems
are designed to translocate proteins across single (bacterial inner membrane), two
(bacterial inner membrane and outer membrane) or even three membranes (bacterial
cell membrane, LPS and host cell membrane). Some proteins are translocated in two
steps i.e., 1) from cytoplasm to periplasm and 2) periplasm to outside via Sec and Tat
dependent pathways (Green and Mecsas, 2016). The Tat pathway translocate folded
whereas Sec pathway translocate unfolded proteins (Palmer and Berks, 2012). In Gram
negative bacteria, proteins can be translocated directed through channels that span both
the inner and outer bacterial membranes (Sec- or Tat-independent protein secretion)
into the host cell or environment. Six such secretion systems have been identified in
Gram negative bacteria (Type I-VI) out of which C. jejuni has been reported to possess
type III, IV and VI secretion systems (Bleumink-Pluym et al., 2013). These secretion
systems are briefly discussed as follows.
1.3.5.1 Type III Secretion System (T3SS)
Type III secretion system is a complex nano-injectisome composed of component
similar to that of flagella (Young et al., 1999). T3SS helps bacterium to deliver effector
proteins into host cells (both prokaryotic and eukaryotic) and to evade host immune
system (Gophna et al., 2003; Cornelis, 2006). C. jejuni lacks the classical T3SS system
and its flagellum (which is homologous to the classical T3SS) plays the role of sole
T3SS machinery (Parkhill et al., 2000). Proteins exported through the flagellar T3SS
of C. jejuni include CiaB, CiaC, CiaI, FlaC, and FspA (Song et al., 2004; Poly et al.,
2007; Konkel et al., 1999; Christensen et al., 2009).
Chapter 1 Introduction
14
1.3.5.2 Type IV Secretion System
Type IV secretion system facilitates transport of macromolecules such as proteins,
DNA or nucleoprotein across bacterial membranes to other bacteria, eukaryotic cell or
environment. The T4SS machinery is an ancestral homolog of bacterial conjugation
machinery (Rego et al., 2010). Functionally, T4SS is of three types 1) class 1 helps
transfer of DNA between cells by conjugation 2) class 2 helps uptake of DNA by
transformation and its release from extracellular milieu 3) class 3 helps transfer of
proteins (Alvarez-Martinez and Christie, 2009). In C. jejuni, T4SS is encoded by two
plasmids i.e., tetO and pVir. pTet encoded T4SS is involved in the conjugational
transfer of the tetO plasmid between strains thus transferring tetracycline resistance.
pVir encoded T4SS work in non-conjugative manner and is involved in natural
transformation and invasion of host cells (Bacon et al., 2002).
1.3.5.3 Type VI Secretion System
Type six secretion system, present in more than 20% of gram negative bacteria, acts
like a nanomachinery, injecting bacterial proteins/toxins into the host cell (eukaryotic
cell or bacterial competitor) and into the environment to affect virulence, inter-bacterial
communication, symbiosis, biofilm formation, antipathogenesis and environmental
stress response (Jani and Cotter 2010; Lertpiriyapong et al., 2012; Ho et al., 2014). To
perform different functions many bacteria possess more than one T6SS gene cluster in
the genome (Lertpiriyapong et al., 2012). T6SS is mainly functions in a contact
dependent manner; however, some effectors can exert their effect extracellularly
(Durand et al., 2014; Russell et al., 2014; Cianfanelli et al., 2016; Lin et al., 2017).
Needle like assembly of T6SS is composed of 13 core components (Fig 1.3) that
transverse across the bacterial cell membranes and delivers proteins into different type
of host cells (Cascales and Cambillau, 2012; Silverman et al., 2012). Hcp (Hemolysin
coregulated protein) is a hexameric protein that forms the core tube of needle like T6SS
machinery and help transport substrate through its channel. VgrG (Valine-glycine rich
repeats G) is present at the distil tip of Hcp tube and act like a puncturing device
(Pukatzki et al., 2009). ImpB (TssB) and ImpC (TssC) form the
Chapter 1 Introduction
15
Fig. 1.2 Schematic model for T6SS components, assembly and effector
translocation into (a) the prey cell (b) and environment (adapted from Gallique et al.,
2017a)
Chapter 1 Introduction
16
tubular sheath around the Hcp core (Bonemann et al., 2009; Basler et al., 2012). PAAR
((Pro-Ala-Ala-Arg) protein sharpens the spike of VgrG (Shneider et al., 2013). Trans-
periplasmic membrane complex of T6SS is responsible for binding of T6SS to cell
envelope and is made up of inner membrane proteins VasF and IcmF (TssL and TssM)
and outer membrane protein VasD (TssJ). Five proteins i.e., ImpA (TssA), ImpG (TssF),
ImpH (TssG), TssE (gp25) and VasE (TssK) form the basal complex (Bonemann et al.,
2009, Basler et al., 2012). Hcp and VgrG act as both structural and secretory proteins
which are released into the host cells along with T6SS effectors. Presence of Hcp (TssD)
and VgrG (TssI) is considered as market of functional T6SS (Pukatzki et al., 2007;
Zheng and Leung, 2007; Hachani et al., 2011).
T6SS start assembling by formation of membrane complex which is followed by
baseplate positioning. Tail is then formed onto the base plate by addition of Hcp
subunits and sheath proteins. The T6SS spear (Hcp-VgrG-PAAR complex) makes a
contact with the prey cell by contraction of sheath and punctures the host cell to deliver
effector proteins (Pukatzki et al., 2007; Ma and Mekalanos 2010 and Suarez et al.,
2010). Two types of effectors are delivered via T6SS i.e., ‘cargo’ or ‘specialized’
(Cianfanelli et al., 2016). Cargo effectors directly or with the help of adaptor attach
themselves to the Hcp-VgrG-PAAR complex for delivery whereas specialized effectors
are modified or evolved Hcp, VgrG or PAAR having C terminus effector domains
(Durand et al., 2015). After the delivery of these effector proteins the T6SS assemble
is dismantled by ClpV which can then be reused for new assembly cycle (Gallique et
al., 2017).
Type six secretion system is versatile machinery which can be used to combat other
bacteria and for invasion of eukaryotic cell host to establish infection. T6SS can work
in a defensive or offensive manner to fight against other bacteria. In P. aeruginosa,
T6SS system works as defensive mechanism and help fight off attack from T6SS
positive V. cholerae or A. baylyi. On the contrary T6SS in V. cholerae it works as
aggressive strategy to attack bacteria lacking T6SS system (Gallique et al., 2017).
Chapter 1 Introduction
17
1.3.5.3.1 Type VI Secretion System in C. jejuni
The T6SS has been recently discovered in C. jejuni and is associated with bloody
diarrhoeal cases (Lertpiriyapong et al., 2012, Harrison et al., 2013). Whole genome
sequencing has revealed that although core T6SS genes are conserved among different
strains of C. jejuni, but their arrangement shows great degree of variability. However,
all C. jejuni isolates possesses only one T6SS gene cluster in their genome assembly
(Harrison et al., 2014). T6SS in C. jejuni has been shown to enhance cytotoxicity,
hemolysis and colonization of mice but still very less work is done on the role of T6SS
component in the pathogenesis of the bacterium (Lertpiriyapong et al., 2012; Bleumink-
Pluym et al., 2013). This cytotoxicity toward red blood cell has been reported to be
contact dependent. The C. jejuni T6SS is unique from other T6SSs as it is seemingly
not essential for bacterial survival or growth, even though it is active. Moreover, it lacks
the T6SS secretion ATPase, ClpV, which is thought to provide energy to the T6SS
machinery (Bonemann et al., 2009). However, the structure and function of T6SS in C.
jejuni is not fully known.
1.3.5.3.2 Hemolysin Coregulated Protein
Out of the 13 core T6SS proteins, the hemolysin coregulated protein (Hcp) is
considered the hallmark of a functional system. Hcp protein in some bacteria e.g. P.
aeruginosa V. cholerae, A. hydrophila, and B. pseudomallei has been associated with
providing selective advantage to bacteria by killing other competing bacteria. Hcp is
essential for both T6SS assembly and function and plays both structural and effector
role. Many gram-negative bacteria possess more than one type of Hcp that encodes
either a structural or an effector protein; however, C. jejuni has only one Hcp protein
purposed to play both functions (Lertpiriyapong et al., 2012). Individual Hcp protein
forms a hexameric rings with an inner diameter of 40 Å which stack on top of each to
make a hollow tube, allowing effectors to pass through. Although all Hcp structures
resolved so far show the same architecture, the function of Hcp varies greatly in
different bacteria. Hcp of A. hydrophila helps evade host innate immunity by preventing
phagocytosis via macrophages (Suarez et al., 2010). Secretory Hcp1 of Escherichia coli
K1 causes actin rearrangement and apoptosis whereas non-secretory Hcp2 play role in
bacterial adherence and invasion of human brain microvascular endothelial cells (Zhou
Chapter 1 Introduction
18
et al., 2012). Hcp1 in B. pseudomallei induces cytotoxicity against macrophages and
induce multinucleated giant cell formation (Burtnick et al., 2011). Hcp family proteins
of P. fluorescens provide competitive advantage against Dickeya dadantii and play a
vital part in biofilm maturation (Decoin et al., 2015; Gallique et al., 2017b).
Functional studies have shown that Hcp in C. jejuni mediates in vivo colonization by
enhancing adhesion and invasion into the eukaryotic host cell and providing resistance
to bile salts and deoxycholic acids (Lertpiriyapong et al., 2012; Bleumink-Pluym et al.,
2013). Furthermore, it enhances contact-dependent hemolysis (Bleumink-Pluym et al.,
2013). All these functional studies on Hcp in C. jejuni are based on Hcp mutant strains
(which harbor the T6SS assembly), whereby mutation of Hcp shut down the functioning
of all T6SS component, therefore, it is difficult to analyze the potential effector role of
Hcp based on previous findings (Noreen et al., 2018).
1.4 Stress Adaptations in C. jejuni
Despite being fastidious in nature, C. jejuni faces and withstand a variety of stresses
during the process of transmission from reservoirs (poultry, cattle) to humans. These
stresses include nutrient limitation (in water reservoirs), cold and heat stress (in
processing plants), acidic pH (in both processing plant and host gut) and exposure to
atmospheric level of oxygen (Murphy et al., 2006; Jackson et al., 2009). C. jejuni do
not possess the usual stress response machinery found in other Gram negative
pathogenic bacteria such as oxidative stress response factors (SoxRS and OxyR), global
stationary phase response factor (RpoS), cold shock proteins (CspA) and the global heat
shock response regulator (RpoH). It is still not known that how C. jejuni is able to resist
stresses by just possessing only three sigma factors (RpoD, FliA and RpoN) (Parkhill
et al., 2000). Better understanding of the stress adaptation and survival mechanisms
of C. jejuni will help in control and treatment of campylobacteriosis. Several
mechanisms have been proposed that might help C. jejuni to survive under harsh
environmental stresses which are discussed as follows.
Chapter 1 Introduction
19
1.4.1 Viable but Non-culturable Form (VBNC)
The Viable but non-culturable form of bacteria is a state in which the bacteria are viable
but metabolic less active therefore it is very difficult to grow them under laboratory
conditions (Barer and Harwood, 1999; Oliver, 2005). Bacteria like C. jejuni convert
themselves into a viable non culturable state (VBNC) upon exposure to harsh
environmental stresses (Rollins and Colwell 1986; Korhonen and Martikainen 1991).
C. jejuni retains its virulence potential even in VBNC state and can regain its culturable
form upon favorable condition or after in-vivo passage through mice (Baffone et al.,
2006; Skovgaard, 2007).
1.4.2 Transition from Spiral to Coccoid Shape
C. jejuni in the late stationary phase of growth in laboratory culture and under hostile
environmental condition undergo a transition from spiral/rod shape (RF) to coccoid
form (CF) (Moran and Upton, 1987). This transition is induced by stresses such as
starvation, suboptimal temperature, pH, and osmotic stress (Reezal et al., 1998; Ikeda
and Karlyshev 2012). These coccoid cells are non-motile, low cultivability in laboratory
condition and may lead to viable but non culturable phenotype (Oliver, 2005; He and
Chen, 2010). Cell culture-based assay have shown that coccoid C. jejuni are less
virulent than the spiral form and rapidly convert back to spiral form as soon as they
become intracellular (Kiehlbauch et al., 1985). Coccoid cell in C. jejuni have reduced
level of protein synthesis and may lead to programmed cell death as in case of H. pylori
(Benaissa et al., 1996).
1.4.3 Adaptive Tolerance Response (ATR)
Exposure to sub-lethal dose of stresses (pH, temperature, oxidative, bile salts) is known
to induce an adaptive tolerance response (ATR) in several bacterial species which
provides protection to subsequent exposure to lethal dose of same (homologous) or
different (heterologous) stresses (Murphy et al., 2003b). Stress related proteins are
generally overexpressed in ATR which in turn contribute towards providing bacterial
immunity to subsequent exposure of stresses (Bieche et al., 2010). Adaptive tolerance
response helps C. jejuni withstand different stresses like acidic pH, heat and aerobic
stress (Murphy et al., 2003a; Murphy et al., 2003b). Heterologous adaptive response
Chapter 1 Introduction
20
in cold adapted C. jejuni cells helps it to survive not only at 4ºC but also provide
resistant to oxidative stress. Similarly, starvation adapted C. jejuni cells develop
resistance to heat stress via this cross-protection mechanism (Klančnik et al., 2006;
Garénaux et al., 2008).
1.4.4 Genetic Heterogeneity
C. jejuni show a great degree of genotypic plasticity which has been linked to survival
under harsh conditions (Murphy et al., 2006). This genetic diversity can be acquired
through DNA mutation, genetic recombination or by horizontal gene transfer (Arber,
2000).
C. jejuni has been shown to undergo both intra and interspecies genetic recombination
(Dingle et al., 2001; Ridley et al., 2008; Wilson et al., 2009). C. jejuni isolates are
considered highly competent and can easily take up DNA from the surrounding
environment leading to high level of genomic diversity (Vegge et al., 2012). Whole
genome analysis of C. jejuni showed that the bacteria possess many hyper-variable
regions which can be one of the causes of genetic diversity (Parkhill et al., 2000).
Hypervariable regions mainly comprise of tandem repeats of nucleotide (homo-
polymeric tracts) which result in slip stranded mutation and eventual differential
expression of genes related to flagella, capsule and lipo-oligosaccharide (Parkhill et al.,
2000; Hendrixson, 2006).
1.4.5 Biofilm Formation
Biofilms are defined as multilayered bacterial population (belonging to same or
different species) encapsulated in extracellular polymeric matrix composed of proteins
polysaccharides and nucleic acids (Donlan and Costerton, 2002). Biofilms are
irreversibly attached to interface or substratum help bacteria survive under unfavorable
conditions (Costerton, 1995; Donlan and Costerton, 2002, Nguyen et al., 2012;
Turonova et al., 2015). Moreover, theses biofilms provide bacteria resistance to
antibiotics and host defenses (Costerton et al., 1995). Multiple environmental stresses
such as the starvation, iron depletion and oxidative stress may trigger establishment of
biofilms (Yoon et al., 2002; Sauer et al., 2004; Oh et al., 2018).
Chapter 1 Introduction
21
Many strains of C. jejuni have been shown to possess biofilm forming capability, but
degree of biofilm formation varies from strain to strain (Joshua et al., 2006; Kalmokoff
et al., 2006; Gunther and Chen 2009). Morphologically biofilms of C. jejuni can exist
as surface adherent, pellicle or aggregates but the composition of extracellular
polymeric matrix secreted by them is still unknown (Joshua et al., 2006). C. jejuni are
capable of both initiate biofilm formation as well as becoming part of pre-established
biofilm of other bacteria (Hanning et al., 2008). Compared with other biofilm forming
bacteria, C. jejuni are not very strong biofilm former under normal conditions.
However, under aerobic conditions biofilm formation is enhanced in C. jejuni which
not only protects bacteria from harsh conditions but also act as planktonic cell reservoir
(Reuter et al., 2010). C. jejuni can form biofilms on both non-biological (stainless
steel and glass) and biological (human intestinal tissue) substrate which may play an
important part in transmission as well as pathogenesis of the bacterium (Sanders et al.,
2008; Haddock et al., 2010). Better understanding of biofilm formation dynamics in
C. jejuni can lead to development of control measure for its spread and transmission in
food chain.
1.4.5.1 T6SS and Biofilm Formation
The T6SS enhances environmental adaptation and the survival of gram-negative
bacteria (Ho et al., 2014). Biofilm formation helps bacteria contend with harsh
environmental stressors in natural, clinical and industrials setups (Nguyen et al., 2012;
Turonova et al., 2015). The T6SS has a diverse impact on biofilm formation in various
bacteria; in some bacteria, it enhances biofilm formation (Acinetobacter baumannii;
Avian-pathogenic Escherichia coli, Acidovorax citrulli, enteroaggregative Escherichia
coli); in others, it aids in biofilm maturation (Pseudomonas fluorescens) or has no effect
(Vibrio alginolyticus) (de Pace et al., 2011; Tian et al., 2015; Gallique et al., 2017; Kim
et al., 2017). Hcp has been reported to secreted and accumulation in sister cells in a
manner similar to auto-inducer accumulation in quorum sensing (Vettiger and Basler,
2016; Gallique et al., 2017). Bacteria possessing T6SS perceive environmental stress
via T6SS dependent quorum sensing and trigger biofilm formation. (Gallique et al.,
2017). However, the role of T6SS in C. jejuni biofilm formation had yet to be reported.
Chapter 1 Introduction
22
1.5 Control of C. jejuni
Among all reservoirs, poultry has the highest prevalence of C. jejuni and thus is
considered the major cause of campylobacteriosis (Friedman et al., 2000). Studies have
shown that more than 90% of human cases of campylobacteriosis have been associated
with contaminated chicken consumption whereas other sources like water, cattle, wild
animal and pets are responsible for remaining 10% cases (Gillespie et al., 2002, Wilson
et al., 2008). Chicken intestine is the only amplifying point of C. jejuni in the whole
food chain, therefore reduction at poultry level will has the major impact in the spread
of campylobacteriosis (Wagenaar et al., 2006). According to quantitative risk
assessment models, a 2-log reduction of C. jejuni CFU broiler carcass can lead to
reduction of human campylobacteriosis cases by 30 folds (Rosenquist et al., 2003).
Therefore, most of the approaches have been designed to control campylobacteriosis
are targeted to reduce the load of C. jejuni in poultry (Lin, 2009; Ghareeb et al., 2013).
Till date there is no safe, effective, reliable, and practical intervention measure available
to reduce C. jejuni colonization in poultry as well in humans, however some of the
control strategies designed so far are discussed as follows.
1.5.1 Biosecurity Measures
Reduction of chances to exposure of C. jejuni to chickens can prevent colonization in
poultry. General biosafety measures which are known to reduce C. jejuni load in poultry
include physical step-over barriers, pest/rodent management, house-specific
boots/clothing, restricted access to farm and better hygiene of farm workers (Gibbens
et al., 2001; Hald et al., 2007; Newell et al., 2011). Strict implantation of on-farm
biosecurity practices has been shown to reduce C. jejuni prevalence up to 50% at first
slaughter (Gibbens et al., 2001; Katsma et al., 2007; Newell et al., 2011). However,
effectiveness of these measures is dependent upon better knowledge of potential
sources and risk factors associated with poultry (Wagenaar et al., 2006). Moreover,
these measures are costly and unpractical in free-range flocks.
1.5.2 Vaccination
Vaccination of poultry is one of the promising alternate to reduce C. jejuni loads by
enhancing chicken immunity. Live attenuated vaccine, killed whole-cell vaccines and
Chapter 1 Introduction
23
subunit vaccines have been tested for their effectiveness in chicken but have limited
success (Lin, 2009; de Zoete et al., 2007; Saxena et al., 2013). No vaccine has been
marketed till date to reduce the intestinal load of C. jejuni (>2 log units) in broiler
chicken (de Zoete et al., 2007). Similarly, vaccine for human protection against C.
jejuni has been designed based on killed whole cell, recombinant protein and flagellin
antigen but all of them failed to provide protection in Phase II human challenge study.
Live attenuated vaccines are not good choice for human use as lipo-oligosaccharides
(LOS) of many C. jejuni strains can lead to GBS via cross-reactivity with human
peripheral gangliosides (Riddle and Guerry, 2016). Among all current vaccines under
trail, capsule-conjugate vaccine CRM197 as the protein carrier has shown promising
immunogenicity in mice (Riddle and Guerry, 2016). Still new antigens need to be
identified and evaluated to make an effective vaccine against C. jejuni which help to
control spread of campylobacteriosis in both developing and developed countries
1.5.3 Antimicrobial Alternatives
The use of antibiotics as prophylactic and growth promoter in animal feed has resulted
in undesirable consequences such as emergence of multidrug resistant bacteria,
persistence of drug residue in the food and environment. These multidrug resistant
bacteria and antibiotic residue adversely affect human health; therefore, member
countries of the European Union (EU) have banned the use of all antibiotic-based
growth promoters (Cheng et al., 2014). However, this banning resulted in decrease
animal production and quality as well as increased infections among farm animals. To
overcome the resultant increase in morbidity and mortality, several replacement
strategies of antibiotics have been proposed (Seal et al., 2013). Some of the strategies
involve use of bacteriophages, probiotics, prebiotics, synbiotics, antimicrobial peptides
(AMPs), plant extracts and feed enzymes, etc. (Millet and Maertens, 2011).
1.5.3.1 Bacteriophage therapy
Bacteriophages are host specific natural predator of specific pathogenic bacteria which
can be utilized to control infection without effecting the environmental and intestinal
bacteria in poultry (El-Shibiny et al., 2009). Bacteriophages can be easily administered
via oral route and do not produce residues. Campylobacter-specific bacteriophages
Chapter 1 Introduction
24
have been shown to reduce C. jejuni load by 2–3 log units under experimental
conditions in chicken (Lin, 2009). The major concerns of bacteriophages therapy, is
that C. jejuni can readily uptake virulence genes using phage-mediated horizontal gene
transfer and development of quick resistance to phage therapy (Oechslin, 2018).
1.5.3.2 Probiotics and Prebiotics
Probiotics are becoming an attractive antimicrobial alternate for reduction of
colonization of C. jejuni in chicken. Several probiotic microbes such as Lactobacillus
plantarum, Bifidobacterium bifidum, Bacillus subtilius, Lactobacillus gallinarum, S.
cerevisiae and Lactobacillus helveticus etc. have been studied both in isolation and in
cocktail form for their ability to inhibit C. jejuni colonization in animal models
(Johnson et al., 2017). These probiotics use several mechanisms such as competitive
exclusion, modification of microbial community, change in luminal pH, production of
antimicrobial peptides (bacteriocins), enhancement of host barrier defenses, and
alteration of host signaling to reduce growth of pathogenic bacteria in host. Lactic acid
bacteria such as L. acidophilus, L. crispatus, L. gallinarum, and L. helveticus, reduce
the pH of lumen to 4.7, by producing lactic acid, at which the growth of C. jejuni is
inhibited (Bratz et al., 2015). B. subtilius with its enhanced velocity colonizes chicken
gut faster than C. jejuni. Moreover, some of these prokaryotic bacteria can also reduce
colonization of C. jejuni by releasing anti-campylobacter metabolites and by
stimulating host adaptive immunity and gut microbiome. Prebiotics promote growth of
beneficial gut bacteria and have been reported to decrease the load of C. jejuni in broiler
chicken when administered along with consortia of probiotic bacteria (Arsi et al., 2015;
Gracia et al., 2016).
1.5.3.3 Antimicrobial Peptides
Antimicrobial peptides are peptide antibiotics produced by commensal gut bacteria to
inhibit colonization of pathogenic bacteria in host. The antimicrobial peptides disrupt
the bacterial membrane and form a transmembrane pore which eventually leads to cell
death. Bacteriocins are one of such antimicrobial peptides having both narrow and
broad spectrum antibacterial effect host ranges. Several anti-campylobacter
bacteriocins (OR-7, SRCAM 602, E-760, E 50–52), produced by chicken gut bacteria,
Chapter 1 Introduction
25
have shown excellent ability to reduce C. jejuni load up to 8 logs in chickens (Stern et
al., 2005; Stern et al., 2006; Line et al., 2008; Svetoch et al., 2008). Despite their
effectiveness in controlling C. jejuni load at farm level, emergence of bacteriocins
resistance among C. jejuni is a major concern in administration of antimicrobial
peptides. Functional genomic analysis has shown that some C. jejuni strains harbor a
group of genes which may confers resistance to antimicrobial peptides, thus reducing
the effectiveness of this strategy in future (Hoang et al., 2012).
1.5.3.4 Natural Antimicrobial Compounds
Over the past few decades there has been decreased acceptability among consumers of
administration of synthetic additives in food chain which has led to development and
use of natural antimicrobial compounds as animal feed additive (Verbeke et al., 2007;
Brenes and Roura, 2010; Navarro et al., 2015). Several plant extracts have shown anti-
campylobacter activity including clove, basil, cinnamon bark, garlic, capsicum, lemon,
lemon grass, orange, rosemary, sage, thyme and oregano (Navarro et al., 2015). These
active compounds in these plants are mainly phenolics (anethole, carvacrol,
cinnamaldehyde, curcumin, eugenol, thymol, and vanillin), acids (rosmarinic and
carnosic acids) and organosulfur compounds (Lu et al., 2011; Klanènik et al., 2012;
Navarro et al., 2015). Due to its low cost and toxicity, natural anti-campylobacter
compounds offer a promising strategy for the control of C. jejuni in chicken.
Chapter 1 Introduction
26
1.6 Aims and Objectives
The present study was designed to study three aspects of C. jejuni. First aim was to
determine the extent of C. jejuni infections among pediatric patients by evaluating the
antibiotic resistance and source tracking of the isolates. Second aim was to study the
role of type VI secretion system in stress adaptation in general by comparing biofilm
formation of T6SS positive and negative isolates in response to stresses; more
specifically by determining the structure and function of Hcp protein (both in biofilm
formation and pathogenesis). Third aim was to develop control strategies against C.
jejuni which included in-silico drug target identification, nanocarrier based targeted
delivery of natural anti-campylobacter products as an on-farm control strategy to reduce
load of C. jejuni among chicken and metallic nanoparticles as a coating material for
control of C. jejuni biofilms.
This study will provide a better insight into the role of T6SS in C. jejuni in stress
adaptation which will, in future, help prevent persistence of C. jejuni in the
environment. Moreover, the control strategies proposed in this study will lead to
development of effective preventive approach to control C. jejuni both at farm and food
processing level which will in turn help reduce the burden of campylobacteriosis in
humans.
Chapter 2 Materials and Methods
27
Chapter 2
Materials & Methods
Chapter 2 Materials and Methods
28
2.1 Antibiotic Resistance Profiling and Source Attribution of C. jejuni
Isolates from Paediatric Diarrhoeal Cases
2.1.1 Sample Collection
A total of one hundred and fifty human diarrhoeal stool samples (including both non-
bloody and bloody diarrhoeal cases) were collected from hospitalized pediatric patients
from November 2014 to September 2015. Children’s age varied from 2 months to 5
years. All the cases were domestic in origin. Stool samples were collected and
transported in sterile cotton swabs containing Carry-Blair medium to Microbiology and
Public Health Laboratory of COMSATS University, Islamabad. The samples were
processed within 24 h of collection.
2.1.2 Isolation of C. jejuni
The fecal samples were streaked onto modified charcoal cefoperazone deoxycholate
agar (mCCDA) (Oxoid, CM0739) amended with CCDA selective supplement (Oxoid,
SR0155). The processed samples were incubated for 48-72 h at 42°C under
microaerophilic conditions generated by Campygen sachets (Oxoid, CN025A).
Colonies having translucent and watery morphology were selected as suspected
colonies belonging to Campylobacter spp. and were sub-cultured on Muller Hinton
Agar plates (Oxoid, CM0337) supplemented by 5% sheep blood (Siddiqui et al.,
2015a). Glycerol stocks (20%) of the purified cultures were made using brain heart
infusion broth (Oxoid, CM11035) and stored at -80ºC.
2.1.4 Biochemical Identification of C. jejuni
Suspected colonies of C. jejuni were preliminary identified using biochemical tests i.e.,
oxidase, indoxyl acetate, catalase and hippurate hydrolysis test. Strains showing
positive test results of all these four reactions were further processed for molecular
analysis (Chaban et al., 2010).
Chapter 2 Materials and Methods
29
2.1.5 PCR based for the Detection of C. jejuni
2.1.5.1 DNA Isolation
Phenol-chloroform method was used to isolate DNA from suspected C. jejuni colonies
(Englen and Kelley, 2000). Briefly, fresh grain size C. jejuni growth were picked and
washed with 1 ml STE buffer [150 mM NaCl, 10 mM Tris-HCl, 15 mM EDTA (pH
8.0)]. The cell suspension was centrifuged for 5 minutes at 4659 x g and the resultant
pellet was then dissolved in 570 µL of STE buffer supplemented with 30 µL Sodium
dodecyl sulfate (SDS) and 3 µL of proteinase K (20 mg/ml stock). The suspension
was briefly mixed and incubated for 2 h at 50oC. Then, 600 µL of PCI [phenol (25):
chloroform (24): isoamyl alcohol (1)] was thoroughly mixed with the suspension and
the mixture was centrifuged at 12,300 x g for 8 min. Approximately, 550µL of upper
aqueous phase was aspirated and added to a new 1.5 ml tube. An equal volume of
chloroform was added followed by thorough mixing and centrifugation at 12,300 x g
for 8 minutes. This washing step with chloroform was repeated twice. The upper phase
(approx.500 µL) was collected in new tube to which 50 µL sodium acetate (3M, pH
5.3) and 1 ml absolute ethanol was added followed by incubation at –20oC for 30 min.
Precipitated DNA was separated by centrifugation at 12,300 x g for 10 min and finally
resuspended in 200 ml of TE buffer (10 mM Tris-HCl, 1 mM EDTA, pH 8.0) containing
RNase at 10 mg/ml. After incubation for 1 h at 37oC, the purified DNA was stored at –
20oC.
2.1.5.2 Species Specific PCR
C. jejuni was detected in the samples based on the amplification of species specific gene
i.e., hippurate hydrolysis gene using oligonucleotide primers (Harrison et al., 2014).
The primers and conditions used are listed in Table 2.1. PCR amplification was done
using 25 µL reaction mixture comprising of 3 µL isolated DNA, 1X PCR buffer
(Fermentas, UAB), 200 µM of each of dNTPs (Fermentas, UAB), 2.5mM of MgCl2
(Invitrogen), 0.4 µM of each primer, 0.25 U of Taq DNA polymerase (Fermentas,
UAB). The rest of the volume was attained with nuclease free water. The PCR reaction
was carried out in a MJ MiniTM Thermocycler (Bio-Rad, USA). C. jejuni strain 255
(Siddiqui et al., 2015) was used as a positive control in the PCR. The PCR products
were loaded onto 2% agarose gel and run at 100V for 35 mins along with 100 bp DNA
Chapter 2 Materials and Methods
30
ladder (Fermentas, Lithuania, UAB). BDA digital gel documentation system (Core Life
Sciences, CA) was used for visualization of amplified PCR products.
2.1.6 Antimicrobial Resistance Profiling
Antibiotics resistance pattern of C. jejuni isolates were assessed by Kirby-Bauer disc
diffusion method. Detection metallo Beta lactamase in C. jejuni isolates was done using
combined disk method and PCR based on resistance genes. Details of these methods
are described below.
2.1.6.1 Kirby-Bauer Disc Diffusion Method
Antibiotic resistance profiling of the identified C. jejuni isolates was carried out using
the following antibiotics: Ceftriaxone (30µg) Ampicillin (10µg), Chloramphenicol (C)
(30 µg), Tetracycline (TE) (30 µg), Streptomycin (S) (10 µg), Ciprofloxacin (CIP) (5
µg), Nalidixic acid (NA) (30 µ g), Erythromycin (E) (30 µg), Gentamycin (CN) (10
µg), Sulphomethoxazole + trimethoprim (SXT) (25 µg), Tigecycline (15µg), Imipenem
(10µg) and Colistin (Oxoid, UK) as described by Fariha et al., 2015. The analysis of
zone diameter was done according to the CLSI (2010). Multiple antibiotic resistance
(MAR) was calculated using the following formula
MAR Index = a/b
Where ‘a’ is the number of antibiotics to which an isolate is resistant and ‘b’ is the total
number of antibiotics tested (Riaz et al., 2011).
2.1.6.2 Detection of Metallo-β-Lactamase
Phenotypic identification of Metallo-β-lactamase (MBL) enzyme in imipenem resistant
isolates was detected according to the combined disk method (CDT) (Yong et al.,
2002). Briefly overnight cultures of the imipenem resistant strains were exposed to one
imipenem (10 µg) alone and one imipenem (10 µg) disk amended with 750µg of
ethylene diamine tetra-acetic acid (EDTA). These disks were placed 25mm apart on
Muller Hinton plates. An increase of ≥7mm in the zone size of imipenem compared to
imipenem-EDTA disk after incubation of 24 h was used as a confirmation of a metallo-
β-lactamase positive organism. A multiplex PCR was used to verify the presence MBL
genes at molecular level. Five primer pairs, specific for each family of acquired MBLs,
were used for detection of IMP (188bp), VIM (390 bp), SPM (271 bp), GIM (477 bp)
Chapter 2 Materials and Methods
31
and SIM (570 bp) (Ellington et al., 2007). The details of primers and conditions used
are listed in Table 2.1. PCR amplification was done using 25 µL reaction mixture
comprising of 2 µL DNA, 1X DreamTaq Green PCR Master Mix (Thermo Scientific),
and 0.2 µM of each primer. The PCR reaction was carried out in a MJ MiniTM
Thermocycler (Bio-Rad, USA). The PCR products were run on 2% agarose gel at 100V
for 30 mins along with 100 bp DNA ladder (Fermentas, UAB). BDA digital gel
documentation system (Core Life Sciences, CA) was used for visualization of the
amplified PCR products.
2.1.7 Source Attribution
To predict the possible origin of these C. jejuni in human samples, source predictive
markers were used as described by Stabler et al. (2013). Six source discriminatory
genes i.e., Cj0056c (415 bps; hypothetical protein), Cj0485 (406 bps; putative
oxidoreductase), Cj1139c (703 bps; beta- 1, 3 galactosyltransferase), Cj1324 (765 bps;
hypothetical protein), Cj1422c (900 bps; putative sugar transferase), and Cj1720 (595
bps; hypothetical protein) were amplified in two sets of multiplex PCRs (M1 and M2).
The strain Cj255 was used as a positive control. The detail of primers and conditions
used are listed in Table 2.1. The PCR amplification was done using 25 µL reaction
mixture containing 2 µL DNA, 1X DreamTaq Green PCR Master Mix (Thermo
Scientific) and 0.2 µM of each primer. The PCR reaction was carried out in a MJ
MiniTM Thermocycler (Bio-Rad, USA). The PCR products were loaded onto 2%
agarose gel and run at 100V for 30 mins along with 100 bps DNA ladder (Fermentas,
UAB). BDA digital gel documentation system (Core Life Sciences, CA) was used for
visualization of the PCR products. The results of PCR were converted into binary data
and were clustered with the help of binary code provided by Stabler et al., 2013.
Chapter 2 Materials and Methods
32
Table 2.1: Detail of Primers and PCR conditions used in this study
Primers Product
size
Annealing
Temp (ºC)
Reference
Species specific primer
HipO-F
GACTTCGTGCAGATATGGATGCTT
HipO-R
GCTATAACTATCCGAAGAAGCCATCA
344 bp 59 Persson and
Olsen, 2005
Metallobeta-lactamase detection primers
Imp-F GGA ATA GAG TGG CTT AAY TCT
C
Imp-R CCA AAC YAC TAS GTT ATC T
188 bp
52 Ellington et
al., 2007
Vim-F GAT GGT GTT TGG TCG CAT A
Vim-R CGA ATG CGC AGC ATC CAG
390 bp
Spm-F AAA ATC TGG GTA CGC AAA CG
Spm-R ACA TTA TCC GCT GGA ACA GG
271 bp
Gim-F TCG ACA CAC CTT GGT CTG AA
Gim-R AAC TTC CAA CTT TGC CAT GC
477 bp
Sim-F TAC AAG GGA TTC GGC ATC G
Sim-R TAA TGG CCT GTT CCC ATG TG
570 bp
Source Prediction Primers
M1
Cj0056-cl-F GAAAGAAGTGAAGGGTGGGT
Cj0056-cl-R
TTATTCAAAGACAGGACTTGA
Cj1139-cl-F ATGAGTCAAATTTCCATCAT
Cj1139-cl-R GTTCTTGAATATTAGCTTCT
Cj1422-cl-F ATGCTCAACCCAAATTCAGC
Cj1422-cl-R
GCAAATTTTAAATCATTGCATG
415 bp
703 bp
900 bp
53 Stabler et al.,
(2013)
M2
Cj0485-cl-F
GATCTATGCCTAAAGAGCACG
Cj0485-cl-R
TCCTTAGCAAAAGCACAAGCC
Cj1324-cl-F GTGATCACTGCGTGATGCCA
Cj1324-cl-R
CAGTAAAACCACGACTTTTAGC
Cj1720-cl-F AAATGGAACCTGTTATCCAC
Cj1720-cl-R TCAACCTCCACCGATAAAGT
406 bp
765 bp
595 bp
.
Chapter 2 Materials and Methods
33
2.2 Stress Adaptation in Type Six Secretion System Positive and
Negative C. jejuni Isolates
2.2.1 Growth of Bacterial Strains
To study the role Type Six Secretion system in stress adaption five T6SS positive and
five T6SS negative isolates (reported by Siddiqui et al., 2015) were selected and were
grown on mCCDA agar plates as described in section 2.1. These strains were then used
in the following studies
2.2.2 Determination of Sub-lethal Level of pH, Temperature and Oxidative
Stress
Overnight cultures of C. jejuni were adjusted at an optical density of 0.05 (approx. 107
CFU/ml) using BHI broth and was used for following stress assays. To determine sub
lethal level of acidic stress, the bacterial strains were exposed to different pH (2.5, 3.5,
4.5, 5.5, 7.0) followed by incubation for 15 min at 42oC under microaerophilic
conditions. The cells were harvested by centrifugation for 5 min at 3000 x g and washed
twice with phosphate buffer saline (PBS). The cells were then re-suspended in fresh
BHI and viable cell count was done after serial dilution. To calculate the sub-lethal
temperature, the bacterial strains were exposed to different temperatures i.e., 42oC,
50oC, 55oC and 60oC for 15 min under microaerophilic conditions. The cultures were
serial diluted and plated to count viable cell count. To determine the sub-lethal level of
oxidative stress the bacterial strains were exposed to of H2O2 (2-12mM) for 15 min
after which the cells were washed twice and CFU count was done as described above.
The stress level which reduced the cell viability to 50% was considered as a sub-lethal
dose.
2.2.3 Motility Assay
Motility assay was performed on 0.45% Muller Hinton (MH) agar as described by
Golden and Acheson (2002). In brief, Optical density of C. jejuni suspension was
adjusted to 0.05 (~107 CFU). Five µL of the stress induced and normal cultures were
stabbed in Muller Hinton (MH) agar. The plates were incubated at 42ºC under
microaerophilic condition for 48 h and zone of motility (diameter) was measured in
mm.
Chapter 2 Materials and Methods
34
2.2.4 Hydrophobicity Assay
To study the effect of sub-lethal stresses on C. jejuni hydrophobicity, stress induced
and un-induced cells (107 CFU) were inoculated in Brain heart infusion (BHI) broth
and allowed to grow at 42 ºC for 24 h under microaerophilic conditions. The cells were
harvested in phosphate buffer saline (PBS, pH 7.2) (Ht0 OD570= 0.5). The bacterial
suspension was then mixed with n-hexadecane and incubated for 5 min at room
temperature (Rosenberg et al., 1980; Thies and Champlin, 1989). The optical density
of the aqueous phase was measured at 570 nm (Ht5) using a microtiter plate reader.
Hydrophobicity was calculated by the equation:
Hydrophobicity (%) = (1-Ht5/Ht0) x 100
2.2.5 Auto-aggregation Assay
To study the effect of sub-lethal stress on auto-aggregation, the stress-induced and un-
induced bacterial cells were grown for 24 h at 42ºC under microaerophilic conditions
(Collado et al., 2007). The cells were harvested and re-suspended in PBS (pH 7.2) to
adjust the OD570 to 0.5 (At0). Saline bacterial suspensions were incubated at 42ºC for 2
h. O.D of supernatants was assessed (At2) and aggregation potential calculated by the
following formula:
Auto-aggregation (%) = (1-At2/At0) x 100.
2.2.6 Biofilm Assay
Biofilm formation by stress induced C. jejuni cultures was studied using method
described by O’Toole and Kolter, 1998. Briefly overnight culture of bacterial were
adjusted to an O.D600 of 0.05 (~107 CFU) and exposed to the sub-lethal dose of either
of these stresses i.e., pH 4.5, Temperature 55ºC or 8 mM of H2O2. One ml of each of
these stress induced cultures was incubated for 48 h in sterile borosilicate glass tubes at
42ºC under microaerophilic conditions. After incubation, the planktonic cells were
discarded, and the tubes were gently washed thrice with PBS. The biofilms were stained
using 0.1% Crystal violet (Sigma) for 15 min and then excess stain was vigorously
washed with distilled water. The stained adherent cells were suspended in 80%
dimethyl sulfoxide (DMSO). The quantification of biofilm was carried out using UV-
VIS spectrophotometer at a wavelength of 570 nm. All the experiments were done
thrice, and each sample was tested in triplicate.
Chapter 2 Materials and Methods
35
2.3 Structural and Functional analysis of Hcp: Hallmark Protein of
T6SS
2.3.1 Plasmids and Bacterial Strain
The hcp gene (534bp) of C. jejuni was synthesized by Genscript (USA) in pET-22b
plasmid and was transformed into DH5α for propagation. The plasmid was then isolated
and transformed in BL21 (DE3) for expression of Hcp protein. The construct is shown
in Fig 2.1.
2.3.2 Point Mutations
Site-specific mutations in Hcp were introduced at positions 30 and 31 the extended loop
(L2,3) of hcp protein to generate HcpR30A and HcpY31A mutants by overlapping PCR
as previously described (Ho et al., 1989) and verified by the DNA sequencing. Breifly,
Mutant Hcp proteins were generated using the proof reading HiFi PCR kit (Kapa
Biosystems). The PCR amplification was done using 50 µL reaction mixture
comprising of 1 µL plasmid DNA, 1X Hifi Fidelity Buffer PCR buffer, 300 µM of each
of dNTPs (KAPA dNTP Mix), 0.3 µM of each T7 forward and reverse primer, 0.5 U
of HiFi DNA Polymerase and rest of the volume was attained with nuclease free water.
The PCR reaction was carried out in a MJ MiniTM Thermocycler (Bio-Rad, USA). The
PCR amplification conditions were initial denaturation of template DNA at 95ºC for 3
min; followed by 30 cycles of denaturation at 98ºC for 20 sec, annealing at 58ºC for 20
sec, and elongation step at 72ºC for 3 min; and a final extension at 72ºC for 5 mins. The
PCR products were loaded onto 1% agarose gel containing Syber safe (Thermo Fisher
Scientific) and run at 100V for 35 mins. The product was carefully cut with sterile blade
and was purified by E.Z.N.A.® Gel Extraction Kit. The purifed product was digested
using DpnI using 1x FD buffer followed by incubaction for 1 h. at room temperature.
Ten microliter of the digest was transformed in DH5α competent cells. The clones were
verified by DNA sequencing using Applied Biosystems 3130xl sequencer. Briefly, in
5 µL of reaction mixture was prepared using 100ng of template DNA (isolated from
mutant clones), 1 µM of either T7 forward or reverse primer and 1 µL BigDye® Ready
Reaction Mix. PCR was performed using following conditions: initial denaturation at
96°C for 1 minute followed by 35 cycles of denaturation at 96°C for 10 seconds,
annealing at 50°C for 5
Chapter 2 Materials and Methods
36
Fig. 2.1 Pet22b+ construct showing the insertion site of Hcp gene
Chapter 2 Materials and Methods
37
seconds, extention at 60°C for 4 minutes 4°C. The product was cleaned up by intial
precipitation using absolute ethanola and 3M sodium acetate folllowed by twice
washing with 70% ethanol. Ethanol was dried at 52 °C for 5 min and resuspended in
18ul of Hi-Di™ Formamide (Thermo Fisher Scientific). The mixture was dispensed in
96 well plate and analyzed using Applied Biosystems 3130xl sequencer.
2.3.3 Expression and Purification of Recombinant and Mutant Hcp Protein
Primary culture of BL21 carrying Hcp protein was prepared by inoculating single
colony of transformed cells in 100 ml of LB medium with 100 μg/ml ampicillin,
followed by incubation for 16-18 h. Twenty-five ml of this primary culture was used to
inoculate 1L of LB broth containing 100 μg/ml ampicillin and was allowed to grow at
37°C till an OD600 of 0.6 was attained. The culture was then induced using 0.3 mM
Isopropyl β-D-1-thiogalactopyranoside (IPTG, Sigma Aldrich) followed by incubation
at 16°C for 18h. The bacterial cells were harvested by centrifugation at 4000× g for
20 min at 4°C. The pellet was re-suspended in lysis buffer containing 50 mM Tris, pH
7.5, 200 mM NaCl, 5% glycerol, 5 mM DTT, 0.1% (vol/vol) Triton X-100, and one
tablet of complete protease inhibitor mixture (Roche Diagnostics). Following
sonication, the cell lysate was centrifuged at 20,000 × g for 10 min at 4°C and the clear
cell lysate was bound to Ni-NTA affinity beads pre-equilibrated with 200 mM NaCl,
50 mM Tris-HCl [pH 7.5], 5 mM DTT and 20 mM Imidazole. The protein was eluted
from the column using buffer containing 600 mM of imidazole. The Hcp protein was
further purified using a Superdex-200 column (GE Healthcare, UK) pre-equilibrated
with a buffer comprising of 50 mM NaCl, 50 mM Tris-HCl (pH 8.0), 2 mM DTT and
5% w/v Glycerol. Amicon Ultra 10,000 MCWO centrifugal filter units (Millipore) were
used to concentrate pooled peak fractions up to 20 mg/ml. The purified product was
analyzed by 12.5% SDS-PAGE and verified by Mass spectroscopy.
2.3.4 Dynamic Light Scattering (DLS)
Dynamic Light Scattering (DLS) is used to determine the homogeneity of the protein
as proteins which show extensive aggregation are difficult to crystallize under normal
circumstances. DLS measurements of the purified protein were performed on a
DynaPro at room temperature as described by Jobichen et al., 2010.
Chapter 2 Materials and Methods
38
2.3.5 Crystallization and Structure Determination
The initial crystallization conditions for the protein were identified by Index Screens
(Hampton Research) using the hanging-drop vapor-diffusion technique at 25°C.
Crystallization drops containing 1 µl protein solution (10 mg/ml) and 1 µl reservoir
solution were used. The diffraction quality crystals were obtained with the condition
consists of 0.2 M sodium acetate trihydrate, 0.1 M Tris-HCl (pH 8.5) and 32%
Polyethylene glycol after two days. Crystals were cryoprotected in the reservoir
solution supplemented with 25 % glycerol and flash cooled at 100 K. The Hcp-Cj
crystals diffracted to 2.8 Å resolution. A complete dataset was collected using a
Saturn944 CCD detector mounted on Rigaku X-ray generator and in the National
Synchrotron Light Source II, New York, USA. The data set was processed and scaled
using HKL2000 (Otwinowski and Minor, 1997). The structure of secreted protein Hcp3
from Pseudomonas aeruginosa (PDB code 3HE1) was used for molecular replacement
using the MORDA program. There were six molecules in the asymmetric unit. The
resultant electron density map was of good quality. Several cycles of model
building/refitting using the program Coot (Emsley and Cowtan, 2004), and alternated
with refinement using the program Phenix (Adams et al., 2010), lead to the convergence
of R-values. Non-crystallographic symmetry (NCS) restraints were used throughout the
refinement process.
2.3.6 Cytotoxicity towards Prokaryotic Cells
To determine the toxicity of Hcp-Cj towards other bacteria, overnight cultures of E.
coli (DH5α) and T6SS negative strains of C. jejuni (strain ID 301 and 27 from our
previous study) were incubated with 50 µg/ml of purified Hcp proteins (Siddiqui et al.,
2015). The samples were serially diluted and spotted on LB agar (DH5α) and mCCDA
(C. jejuni) agar. Growth of bacteria in terms of CFU/ml was recorded after 24-48h of
incubation. The cytotoxicity assays were done in collaboration with Institute of
Biomedical and genetic Engineering, KRL Hospital Islamabad.
2.3.7 RBC Lysis Assay
RBC lysis assay was done using Sheep erythrocytes prewashed thrice with phosphate
buffer saline (pH 7.5) and adjusted to a final concentration of 1% (v/v). The erythrocyte
Chapter 2 Materials and Methods
39
suspension (0.1 ml) was incubated with 50 µg/ml of purified Hcp protein for 4 h at
37°C. The samples were then centrifuged at 1,000 × g for 5 min and optical density of
the supernatant was measured at 550nm as an indicator of hemolysis degree (Moonah
et al., 2014).
2.3.8 Cytotoxicity towards Eukaryotic Cells (HepG2)
Cytotoxicity of purified Hcp protein against HepG2 (Liver Cancer cells) was evaluated
using sulforhodamine B (SRB) assay as described by Skehan et al., (1990). Briefly,
pre-seeded HepG2 cells (1.2 x 104 cells/well) were exposed to 50 µg/ml of normal and
mutant Hcp protein per well and incubated for 24 h at 37°C in 5% CO2 incubator. The
cells were then fixed using pre-chilled trichloroacetic acid (50%) at 4°C for a period of
1 hour and subsequently washed 5X with deionized water. The cells were stained with
SRB solution (0.4%) for 30 min at room temperature washed with 1% acetic acid and
air dried. The air-dried samples were photographed using Olympus IMT-2 inverted
microscope. The dye incorporated in the samples was solubilized in Tris (10 mM, pH
8.0) and absorbance (565 nm) was measured using microtiter plate reader (AMP
PLATOS R-496). Untreated cells were used as negative control.
2.3.9 Motility Assay
The motility of bacterial strains in response to Hcp-Cj exposure was compared using
method described by Golden and Acheson, 2002. Briefly, semi-solid BHI plates
(0.45%) were inoculated in the center with 5 µl of culture (pre-exposed to Hcp-Cj). The
bacterial strains unexposed to Hcp-Cj and PBS were used as controls. After incubation
of 48 h the diameter of growth zone was measured.
2.3.10 Biofilm Assay
To study the effect of Hcp-Cj on biofilm formation overnight cultures of C. jejuni
(T6SS positive strains (255, 77); T6SS negative isolates (301, 27) and E. coli (DH5α)
were exposed to 50 µg/ml of purified recombinant Hcp and mutant proteins in 96-well
polystyrene plates (Corning™ Costar™ Clear Polystyrene 96-Well Plates) for a period
of 24 hours (O’Toole and Kolter, 1998). After incubation, the planktonic cells were
discarded, and the wells were washed thrice with PBS. The biofilms were stained with
Crystal violet (0.1%) (Sigma) and then excess stain was washed with distilled water.
Chapter 2 Materials and Methods
40
The stained biofilms were dissolved in dimethyl sulfoxide (DMSO). Quantification of
biofilm was carried out using microtiter plate reader at a wavelength of 570nm. All
assays were performed in triplicate.
2.4 In silico Drug Target Identification of C. jejuni
2.4.1 Complete Proteome Retrieval
The complete proteome sequences of C. jejuni (NCTC 11168) and H. sapiens were
downloaded from UniProtKB (www.uniprot.org).
2.4.2 Determination of Non-Homologous Essential Genes/Proteins
Total proteins of C. jejuni were subjected to BLASTP against humans using threshold
expectation value (E-value 10−3) (Kerfeld and Scott, 2011). The protein sequences
which showed significant homology to human were eliminated and the remaining
proteins were considered as non-homologous sequences. Database of essential gene
(DEG) contain dataset of essential genes and their expressed proteins of 20 bacteria
(Zhang and Lin, 2009). The non-homologous protein sequences were subjected to
BLASTP against DEG (E-value 10−5) and minimum bit score cut off 100 to find out
essential genes (Acharya and Garg, 2016) (Fig 2.2). The protein which had significant
hit was then considered as non-homologous essential genes or Set 1.
2.4.3 Metabolic Pathway Analyses
KEGG metabolic pathway analysis helps identify proteins which are involved in unique
or common pathway (between host/s and pathogen). The metabolic pathway of the
proteins in Set 1 was analyzed by performing a BLASTP similarity search against
periodically updated KEGG database (Moriya et al., 2007). Proteins involved in
metabolic pathways were selected for further analysis (Set 2)
2.4.4 Drugability Potential of Shortlisted Proteins
Drug Bank database contains number of protein targets with respect to the drug IDs
approved by FDA (Wishart et al., 2006). In order to reach the novel drug targets, default
parameter for screening of protein sequences in Set 3 as potential drug target was done
by BLASTP (E-value 10−3) comparison against Drug Bank database. The proteins
Chapter 2 Materials and Methods
41
which showed significant hits against both approved and experimental drugs were
classified as Set 3.
2.4.5 Prioritization of Druggable Targets
2.4.5.1 Functional Categorization
Functional family prediction of proteins in Set 3 was done by using InterPro server
which uses the primary sequence of protein to group them into families and predict the
presence of domains and important sites. Proteins sequences which were classified as
enzymes were listed (Mulder and Apweiler, 2007).
2.4.5.2 Virulence Factor
The potential targets were analyzed for their role in virulence potential of C. jejuni by
using BLASTP against using Virulence Factor DataBase (VFDB) which comprises of
virulence factors of 24 genera of pathogenic bacteria (Chen et al., 2012).
2.4.5.3 Molecular Weight
The identified targets were characterized on the basis for their molecular weight using
UniProtKB as most drug-able targets are of ≤110 kDa (Butt et al., 2012).
2.4.5.4 Subcellular Localization
Sub cellular localization of non-homologous essential proteins was predicted using
PSORTb v.3.0 (Nancy et al., 2010) into five major localization sites viz. cytoplasmic,
periplasmic inner membrane, extracellular, and outer membrane. The results were
further validated by CELLO v2.5. TMHMM server to identify transmembrane helices
in the proteins using Hidden Markov Model (HMM) based tool (Krogh et al., 2001).
2.4.5.5 Availability of Protein 3D Structure
Protein Data Bank and ModBase databases were used to find the experimentally and
computationally solved 3D structures of the proteins in Set 5 respectively (Berman et
al., 2007; Pieper et al., 2006).
Chapter 2 Materials and Methods
42
Fig. 2.2 The overall scheme for identification of drug targets
Chapter 2 Materials and Methods
43
2.4.5.6 Chicken Proteome Homology Analysis
Shortlisted drug targets were subjected to BLASTP against Gallus gallus (chicken)
using threshold expectation value (E-value 10−3) (Altschul et al., 1990). Protein
sequences which showed significant homology to chicken proteome were eliminated
from further analysis
2.4.5.7 Gut Flora Non-Homology Analysis
Normal gut flora of humans includes approximately 1014 harmless microorganisms,
which help maintain human health by providing protection against pathogenic bacteria
(Fujimura et al., 2010). The use of drug which results in inhibition of these beneficial
bacteria along with the pathogen will eventually adversely affect the host. To prevent
such adverse reactions from drug, the shortlisted drug targets were subjected to
BLASTP against a list of gut flora proteome (E-value=0.0001) reported by Altschul et
al., 1990 and Raman et al., 2008 for homology search. The proteins which showed
homology to less than 10 hits were selected as potential targets (Shanmugham and Pan,
2013).
2.5 Control of C. jejuni in Poultry by pH Sensitive Plant Extract
Encapsulated Alginate-Chitosan Nanoparticles
2.5.1 Screening of Plant Extracts for Anti-Campylobacter Activity
Five plants i.e., Berberis lycium (bark), Trachyspermum annum (seeds), Nigella sativa
(Seeds), Camellia sinensis (leaves), Mentha longifolia (leaves) were screened for their
antibacterial activity against C. jejuni. Plant parts of these plants (bark, seed or leaves)
purchased from local market of Islamabad, Pakistan and were dried in shade. The plant
material was then grounded and passed through 100 mm sieve to get a fine powder.
The resultant fine powder (50g) was soaked in 200 ml of methanol for 5 days and was
filtered first through double layers of muslin and then by Whatman filter paper No.1.
The clear filtrate was dried by rotary evaporator and the yield was measured. The stock
solution of 50 mg/ml of plant extracts were made in DMSO and then tested for its anti-
campylobacter activity using agar well diffusion method (Sokmen et al., 2013). Briefly,
overnight culture of C. jejuni was spread on MH plates and 10mm well were made by
Chapter 2 Materials and Methods
44
sterile corker borer. 100µL of stock solutions was added to each well and the petri plates
were incubated under microaerophilic condition at 42ºC. Zone of inhibition was
measure after 48 h. Ampicillin was used as control.
2.5.2 Fractioning of Trachyspermum ammi
To determine the active fraction of T. ammi seeds, crude methanolic extract was
subjected to bio-guided fractionation as described by Shah et al., 2014. Briefly, the
dried crude extract (5g) was suspended in distilled water (200 ml) and was subject to
sequential partition (1:1, v: v) with n-hexane, chloroform, ethyl acetate, acetone, and n-
butanol as indicated in Fig 2.3. The leftover residue after the last fraction was classified
as aqueous fraction. Each fraction was concentrated using rotary evaporator and dried
under dark.
2.5.3 Antibacterial activity of Trachyspermum ammi Fractions
2.5.3.1 Determination of Minimum Inhibitory Concentration
The Minimal Inhibitory Concentration (MIC) of all fractions of Trachyspermum ammi
was determined by “Micro-titer assay” (Sarker et al., 2007) using 2, 3, 5- triphenyl
tetrazolium chloride (TTC) as an indicator of metabolic activity. Various doubling
concentrations of each fraction of T. ammi were made in DMSO i.e., 0.312, 0.625, 1.25,
2.5, 5 and 10 mg/ml. Twenty micro liters from the stock solutions was added to 180 µl
of bacterial suspension (108 CFU/ml) such that each test compound was checked at the
final concentration of 1.0, 0.5, 0.125, 0.0625 and 0.0312 mg/mL in respective well of
microtiter plate. After incubation of 48 h, 20 µl of TTC indicator solution (prepared as
5 mg/ml in H2O) was added to each well and change in color was recorded after 15-20
min. Pink color indicated the presence of viable bacteria whereas no change in color
was considered as nonviable bacteria. Twenty micro liters from each of the well with
no color change were inoculated on to nutrient agar plate. The experiment was repeated
thrice and the average of three readings was calculated as MIC for the test compound.
2.5.3.2 Influence on Growth of Bacteria and Cell Survival
Overnight culture of the C. jejuni (~107 CFU) were used to inoculate Brain Heart
Infusion (BHI) broth media with and without addition of hexane fraction of T. ammi
Chapter 2 Materials and Methods
45
Fig. 2.3 Scheme of Fractioning of Trachyspermum ammi seed extract adapted
from Shah et al., 2014.
Chapter 2 Materials and Methods
46
(concentration 2x less than MIC) in the individual flasks. The culture flasks were placed
in shaker incubator (100rpm) at 42ºC. To study the influence on growth of bacteria,
samples were drawn at regular time interval of 30 min. Each drawn sample was serially
diluted, and these dilutions were spotted on Muller Hinton Agar plate. The colony
forming units (CFU) were counted after 48h of incubation. The un-inoculated media
was used as negative control.
2.5.4 Gas Chromatography- Mass Spectroscopy Analysis
The GC-MS analysis of n-hexane fraction of Trachyspermum ammi seeds was
performed using a GC-Mass spectrometer system (Model, Thermo GC-Trace ultra-
version 5.0; Department of Chemistry Quaid-iAzam University Islamabad) equipped
with a fused silica gel column (30 m×0.25mm ID, film thickness 0.25 µm) coupled with
a Thermo MS DSQ-II (Thermo Fisher, USA). The detection of data or spectra was done
using an electron ionization system with ionization energy of 70 eV. The n-hexane (l00
mg/ml) was filtered with 0.22 µm Millex membrane filter paper (Millipore, France) to
remove any dust/suspended particles before injection. One ml of the sample was
injected at a rate of 1 μl/min using split mode. Oven temperature was programmed from
50 to 280 °C at 10 °C/min increment. Helium gas was used as a carrier at rate of 1.5
ml/min and detection limit was set at 50-800 amu. The constituents of the n-hexane
fraction of Trachyspermum ammi seeds were identified by comparing their mass spectra
with NIST 02 spectral library. The relative percentage (%) of each constituent was
expressed in terms of percentage by peak area.
2.5.5 Preparation Plant Extract Loaded Alginate Coated Chitosan
Nanoparticles as a Nanocarrier System for Targeted Delivery
pH sensitive alginate coated chitosan nanoparticles were prepared for targeted delivery
of plant extract (hexane fraction) to the intestine of chicken gut to prevent degradation
at acidic pH of gizzard. From hereafter, the term “plant extract” refers to the hexane
fraction of Trachyspermum ammi seeds. Chitosan (92% deacetylated-Sigma) was
dissolved in 1% (v/v) aqueous acetic acid solution at concentration of 3 mg/ml by
stirring at 400rpm for 2 h at 60ºC. An aqueous solution of 0.2% Sodium
tripolyphosphate (Sigma, USA) was prepared in deionized water. TPP was added drop
Chapter 2 Materials and Methods
47
wise into Chitosan solution in a ratio of 3:1 (Chitosan: TPP) under continuous stirring
at 400rpm for spontaneous formation of Chitosan nanoparticle (CNP). The CNP was
isolated by centrifugation 4000g for 20 min and pellet was stored after suspending in
deionized water. To prepare plant extract loaded chitosan nanoparticles (PE-CNP),
30mg of hexane fraction plant extract was dissolved in TPP solution which was then
drop wise added in chitosan solution and processed as above. For synthesis of alginate
coated nanoparticles (CANP), sodium alginate (Sigma, USA) was dissolved in
Phosphate buffer saline (PBS) at a concentration of 5 mg/ml by stirring at 400rpm for
2 h at room temperature. This sodium alginate solution added drop wise into the
Chitosan nanoparticle solution under mild agitation (400rpm) at room temperature
followed by centrifugation at 12000rpm for 10 min. The pellet of alginate coated
Chitosan nanoparticles was re-suspended in 0.262mM CaCl2 to promote cross linking
between alginate layer and Chitosan nanoparticles. To prepare plant extract loaded
alginate coated chitosan nanoparticles (PE-CANP), plant extract loaded Chitosan
nanoparticles (PE-CNP) was used for coating by sodium alginate using the same
protocol for alginate coated nanoparticles (CANP).
2.5.6 Characterization of plant extract loaded Alginate Coated Chitosan
Nanoparticles
2.5.6.1 Scanning Electron Microscopy
Scanning electron microscopy (Jeol JSM; Central Resource Laboratory Peshawar
University, KPK) was used to study the size of the prepared nanoparticles. Briefly, 10µl
were placed on sterile glass slide (1 x1 cm) and was vacuum dried. Gold coating of the
dried sample was done using Jeol Quick Auto Coater (JFC-1500) ion sputtering device
6 s only. The prepared samples were analyzed at the resolution of 20 kV and 3000–
50000× magnification.
2.5.6.2 Atomic Force Microscopy
The 3D image of the of CANP, PE-CNP, PE-CANP nanoparticles was studied using
Molecular Imaging’s PicoPlus AFM using tapping mode equipped with Si tip (100 Å
diameter) coated with Al and a 200µ long Cantilever.
Chapter 2 Materials and Methods
48
2.5.6.3. Fourier Transform Infrared Spectroscopy
Fourier Transform Infrared Spectroscopy (FT-IR) (Perkin Elmer; IIUI Univeristy,
Islamabaad) was used to determine the functional groups and interactions in CANP,
PE-CNP, PE-CANP nanoparticles. A pellet/disc was prepared using nanoparticle and
KBr (FTIR grade Merck) in a ratio of 1:5. Spectra were acquired in a range between
4000 and 600 cm-1.
2.5.6.4 Encapsulation Efficiency
The encapsulation efficiency (EE) of PE-CNP and PE-CANP nanoparticles was
calculated using indirect method as described by Jain et al., 2011. Briefly, plant extract
chitosan alginate nanoparticles (PE-CANP) were centrifuged at 12,000 g for 20 min
(Eppendorf 5415D, Germany) to separate un-trapped hexane fraction. The supernatant
was quantified using UV/VIS spectrophotometer at wavelength of 450nm (maximum
absorption wavelength of plant extract obtained from wave scan analysis in a range of
200-700nm) and concentration of plant extract determined using the standard curve of
known concentration of plant extract. Encapsulation efficiency (EE) was calculated
using the following formula
EE (%) =Total PE loaded − PE in the supernatant
Total PE Loaded𝑥 100
2.5.6.5 Cytotoxicity Assay
Human neuroblastoma cells SH-SY5Y (ATCC2266) cells were maintained in
Dulbecco’s Modified Eagle Medium (DMEM) supplemented with FBS (10%) at
standard conditions (37°C / 5% CO2). To assess the cytotoxicity of pre-seeded SH-
SY5Y cells (15,000 cells/well) were exposed to the CNP, PE-CNP and PE-CANP
nanoparticles, (10 µg/ml) for 24 h. Untreated cells were used as negative controls. Cell
viability was estimated using MTT assay as described earlier (Mosmann, 1983). SH-
SY5Y cells were treated with the nanoparticles for 24 h. 10 µL of the MTT stock
solution (12 mM) was added to each well and further allowed to incubate at 37°C for 4
hours. 100 µL of SDS-HCl solution was added in each well and the microtiter plate
was incubated overnight in a humidified chamber. Absorbance was recorded at 565
nm and percentage viability of the cells was determined using the following formula:
Viability(%) =Abs(TS) − Abs (NPC)
Abs (UTS) − Abs(B)X 100
Chapter 2 Materials and Methods
49
Where “Abs(TS)” and “Abs(UTS)” represent the optical density at 565 nm for the
treated samples and untreated control samples, respectively. “Abs (NPC)” and
“Abs(B)” represent the background optical density at 565 nm of nanoparticles + media
and media only samples respectively. A percentage viability of 50 and above was
categorized as having ‘no effect’, viability between 50 and 25% as “moderate effect”
and below 25% having a ‘strong effect’. These assay were done in collaboration with
Institute of Biomedical and genetic Engineering, KRL Hospital Islamabad.
2.5.6.6 pH Dependent Release Profile
PE-CANP nanoparticle was suspended in 1 mL of phosphate-buffered saline at adjusted
pH of 3.5 and 7.0 to determine its behavior at simulated chicken crop and colon
respectively. At defined time intervals, the nanoparticles were centrifuged to remove
supernatant and fresh phosphate buffer was replaced. The concentration of plant extract
in the supernatant was measured by using UV-VIS spectrophotometer at a wavelength
of 450 nm (Gaonkar et al., 2017).
2.5.7 In-vivo Trial in Chicken
Day old chicks were purchased from commercial hatcheries and randomly distributed
into 4 groups of 15 chicks each i.e., Control group (no feed additive), PE group (Plant
extract as feed additive), CANP group (empty alginate coated nanoparticles as feed
additive), and PE-CANP (Plant extract encapsulated alginate coated chitosan
nanoparticles as feed additive). Individual bird in each group was orally gavage with
107 CFU of mid log culture of C. jejuni (strain Cj255) at day 3rd of post hatch. The feed
was manipulated with 1% (w/w) of the feed additive (Plant extracts/ CANP / CANP)
and was provided ad libitum for 3 days starting from day 3rd of post hatch. Fecal
samples (1g) collected on day 7 and day 14 post infection were serially diluted in PBS
and spot plated on mCCDA for calculation of C. jejuni load (CFU/g) in each group.
The plates were incubated at 42ºC for 48 h under microaerophilic conditions and
confirmation of representative colonies as C. jejuni was done using hippurate
hydrolysis test and species specific. The birds were euthanized by cervical dislocation
at day 21st post infection and cecum samples were collected (1g) by dissection. The
caecal samples serially diluted in PBS and spot plated on mCCDA for calculation of C.
jejuni load (CFU/g) in each group.
Chapter 2 Materials and Methods
50
2.6.1 Metallic Nanoparticle as Control of C. jejuni Biofilms
2.6.1 Nanoparticles Used
Three different types of synthesized nanoparticle were used in this study i.e., TiO2 based
(TiO2, TiO2-Ag, TiO2-graphene and TiO2-Ag-Graphene), Ferrite based (Erbium doped
Lithium nickel of various sizes) and Zinc oxide nanoparticles. Detail of these
nanoparticles is given in Table 2.2
2.6.2 Test Microorganisms
The antibacterial activity of synthesized nanoparticles was tested primarily against C.
jejuni (cj255). To further access its broad-spectrum action, the nanoparticles they were
screened against gram negative Vibrio cholerae, Enteropathogenic Escherichia coli,
and gram-positive Staphylococcus aureus (MRSA). All the tested strains were resistant
against multiple drugs (MDR) and were obtained from Microbiology and Public Health
Laboratory culture collection at COMSATS University, Islamabad, Pakistan (Manzoor
et al., 2016)
2.6.3 Determination of Minimal Inhibitory Concentration
The Minimum inhibitory concentration (MIC) of the above-mentioned nanoparticles
was determined by Micro-titer assay using 2, 3, 5-triphenyltetrazolium chloride (TTC)
as cell viability indicator (Sarker et al., 2007). Twenty micro liters from the stock
solutions was added to 180µl of bacterial suspension (108 CFU/ml) such that each test
compound was checked at the final concentration of 1.0 mg/mL, 0.5mg/mL, 0.125
mg/ml, 0.0625 mg/mL and 0.0312 mg/mL in respective well of microtiter plate. After
incubation of 48 h, 20 µl of TTC indicator solution (prepared as 5 mg/ml in H2O) was
added to each well and change in color was recorded after 15-20 min. Pink color
indicated the presence of viable bacteria whereas no change in color was considered as
nonviable bacteria. Twenty micro liters from each of the well with no color change
were inoculated onto nutrient agar plate. The experiment was done thrice and the
average of three readings was referred as MIC.
Chapter 2 Materials and Methods
51
Table 2.2 Detail of nanoparticles used
Nanoparticles ID Composition Size (nm)
TiO2 TiO2 10.5
TiO2/Gr TiO2/Graphene 9
TiO2/Ag TiO2/Silver 8.5
TiO2/Gr/Ag TiO2/Graphene/Silver 7.2
ErLiNiF3O4-24 Erbium doped Lithium Nickel Ferrite 24
ErLiNiF3O4-32 Erbium doped Lithium Nickel Ferrite 32
ErLiNiF3O4-41 Erbium doped Lithium Nickel Ferrite 41
ErLiNiF3O4-58 Erbium doped Lithium Nickel Ferrite 58
ErLiNiF3O4-107 Erbium doped Lithium Nickel Ferrite 107
ZnO Zinc Oxide 29
Chapter 2 Materials and Methods
52
2.6.4 Growth Kinetics
To study the influence of nanoparticles on the growth, overnight culture of C. jejuni
was used to inoculate Brain heart infusion (BHI) broth with and without addition of
nanoparticle (2X less than the MIC). The culture flasks were placed in shaker incubator
(100rpm) at 42oC for 6 h. One microliter of sample was drawn and serially diluted was
serially diluted and these dilutions were spotted on Muller Hinton Agar plate. The
colony forming units (CFU) were counted after 24-48h of incubation. The un-
inoculated media was used as negative control.
2.6.5 Hydrophobicity Assay
To study the effect of nanoparticles on C. jejuni hydrophobicity, cells (107 CFU) were
inoculated in Brain heart infusion (BHI) broth supplemented with nanoparticles (2X
less than the MIC) and allowed to grow at 42 ºC for 24 h under microaerophilic
conditions.
The cells were harvested in phosphate buffer saline (PBS, pH 7.2) (Ht0 OD570= 0.5).
The bacterial suspension was then mixed with n-hexadecane and incubated for 5 min
at room temperature (Rosenberg et al., 1980; Thies and Champlin, 1989). The optical
density of the aqueous phase was measured at 570 nm (Ht5) using a microtiter plate
reader. Hydrophobicity was calculated by the equation:
Hydrophobicity (%) = (1-Ht5/Ht0) x 100
2.6.6 Auto-aggregation Assay
To study the effect on auto-aggregation, the bacterial cells were grown for 24 h in the
absence and presence of nanoparticles (2X less than the MIC) at 42ºC under
microaerophilic conditions (Collado et al., 2007). The cells were harvested and re-
suspended in PBS (pH 7.2) to adjust the OD570 to 0.5 (At0). Saline bacterial suspensions
were incubated at 42ºC for 2 h. O.D of supernatants was assessed (At2) and aggregation
potential calculated by the following formula:
Auto-aggregation (%) = (1-At2/At0) x 100.
2.6.7 Motility Assay
Overnight culture of C. jejuni (O.D 0.05) exposed to nanoparticles (2X less than the
MIC) was used to stab semi-solid Muller Hinton agar plates (0.45%) and incubated at
Chapter 2 Materials and Methods
53
42 0C for 24 h under microaerophilic conditions (Golden and Acheson, 2002). Zone of
motility in control (ZDC) (i.e. without nanoparticles) and treated (ZDT) (i.e.; with
different nanoparticle exposure) was measured and the motility rate was calculated
using the following the equation:
Motility rate %= ZDT/ZDC x100
2.6.8 DNA and Protein Leakage Assay
Overnight cultures of C. jejuni (107 CFU) were exposed to nanoparticles (at MIC
values) for 4 h and sample was centrifuged at 123000 x g and the resultant supernatant
(TC) was passed through a 0.22 µm. DNA quantification was done 260nm using
nanodrop and for detection of protein in the supernatant Bradford assay was used
(Sampathkumar et al., 2003). Briefly 100 µL of the filtered supernatant were added to
500µL of Bradford reagent and absorbance was read at 595nm using
spectrophotometer. Untreated cell (UTC) and cells treated with Triton X-100 (TTC)
was used as negative and positive control (Singh et al., 2016). The experiment was
repeated three times. Total leakage of DNA or protein leakage was expressed in terms
of leakage index by using the following formula:
DNA Leakage Index = (TCO.D 260 - UTCO.D 260)/ TTCO.D 260
Protein Leakage Index = (TCO.D 595- UTCO.D 595)/ TTCO.D 595
2.6.9 Antibiofilm Activity
C. jejuni overnight culture was re-suspended in LB broth at an OD600 of ∼0.05. Both
borosilicate tubes as well as sterile 96-well polystyrene plates (Corning™ Costar™
Clear Polystyrene 96-Well Plates) were inoculated with bacteria along with
nanoparticles (2X less than the MIC) and incubated for 48h at 42°C (O’Toole and
Kolter, 1998). Following the incubation, the planktonic cells were discarded, and the
wells were rinsed thrice with PBS. Crystal violet (0.1%) (Sigma) was used to stain the
biofilm for 30 min followed by through washing with distilled water. The biofilm was
dissolved in dimethyl sulfoxide (DMSO) and quantified using spectrophotometer
(OD570). All assays were performed in triplicate.
Chapter 2 Materials and Methods
54
2.6.10 Cytotoxicity Assay
Human neuroblastoma cells SH-SY5Y (ATCC2266) cells were maintained in
Dulbecco’s Modified Eagle Medium (DMEM) supplemented with FBS (10%) at
standard conditions (37°C / 5% CO2). To assess the cytotoxicity of nanoparticles, pre-
seeded SH-SY5Y cells (>90% viability; 15,000 cells/well) were exposed to the
nanoparticles at 10 µg/ml for 24 h. The untreated cells were used as negative controls.
Cell viability was estimated using MTT assay as described in section 2.5.6.5 in
collaboration with Institute of Biomedical and genetic Engineering, KRL Hospital
Islamabad.
Chapter 3 Results
55
Chapter 3
Results
Chapter 3 Results
56
3.1 Antibiotic Resistance Profiling and Source Attribution of C. jejuni
Isolates from Paediatric Diarrhoeal Cases
In Pakistan, the epidemiological data related to campylobacteriosis is under reported
due to the lack of proper surveillance system. Therefore, this section was designed to
investigate the current status of C. jejuni infections among pediatrics patients by
evaluating the antibiotic resistance and source tracking of the isolates.
3.1.1 Isolation and Identification of C. jejuni
To study the prevalence of C. jejuni among diarrheal patients a total of 150 stool
samples, of children suffering from diarrhoea, were collected and processed to detect
the presence of C. jejuni. Biochemically identified C. jejuni strains (positive for
oxidase, catalase, indoxyl acetate and hippurate hydrolysis test) were further confirmed
by PCR using primers against hipO gene (344 bps) as shown in Fig. 3.1. C. jejuni was
found to be present in 82 samples indicating a high campylobacteriosis incident rate
(i.e., 52.4%). Cj255 was used as positive control.
3.1.2 Antimicrobial Resistance Profiling
3.1.2.1 Multiple Drug Resistant Isolates
In order to study multidrug resistance among the isolated C. jejuni their susceptibility
was tested against an array of 13 antibiotics. The results showed that most of the C.
jejuni isolates were resistant to tested antibiotics at the rate ranging from 9-96%. More
than 80% of the isolates were found to be resistance to the following antibiotics:
ampicillin (96%), erythromycin (96%), streptomycin (91%) and tetracycline (87),
trimethoprim/sulfamethoxazole (87%), cefotaxime (86%), gentamycin (79%), nalidixic
acid (79%), ciprofloxacin (69%) (Fig.3.2). Moderate percentages of isolates were
resistant to chloramphenicol (36%) and colistin (37%). However, imipenem and
tigecycline were found to be the most sensitive antibiotic with resistance of 12% and
9% respectively. Overall 75% of isolates were resistant to more than 8 antibiotics.
Chapter 3 Results
57
Fig. 3.1 Identification of C. jejuni isolates a) characteristics growth of C. jejuni
on mCCDA media; b) positive hippurate hydrolysis test; c) Species specific PCR for
hipO gene Lane 1- 1 kb ladder, Lane 2- 3, Isolates positive for hipO genes; Lane 4-
Positive control (Cj 255)
Chapter 3 Results
58
Fig. 3.2 Antibiotic resistance pattern of isolates C. jejuni against 13 tested
antibiotics expressed in terms of percentage of resistant isolates. AMP (Ampicillin
10µg), SXT (Sulphomethoxazole + trimethoprim; 25 µg), CIP (Ciprofloxacin; 5 µg),
CT (Colistin), TE (Tetracycline; 30 µg), C (Chloramphenicol; 30 µg), NA (Nalidixic
acid; 30 µ g), E (Erythromycin; 30 µg), CTX (Ceftriaxone; 30µg), TGC (Tigecycline;
15µg), IMP (Imipenem; 10µg), CN (Gentamycin; 10 µg), and S (Streptomycin; 10 µg),
Chapter 3 Results
59
3.1.2.2 Detection of Metallo-β-Lactamase
Metallo-β-lactamase (MBL) enzyme detection through combined disk method (CDT)
showed that 10% (n=8) were MBL positive. Molecular identification using MBL genes
(IMP, SIM, VIM, GIM and SPM) showed that 7.3% (n=6) of the total isolates were
MBL positive. Out of these six isolates, three isolates carried both IMP and VIM genes
and three isolates carried VIM, IMP or SIM gene alone. None of the isolates were
positive for GIM or SPM (Fig. 3.3).
3.1.3 Source Attribution
All the C. jejuni isolates were assigned to strain clusters using the binary code based on
the presence or absence of amplified products of six source predictive genes sequences
(Fig. 3.4, 3.5). The results showed that isolates were well distributed among all groups
i.e., C1/C2/C3 (14.6%), C4/C6 (26.8%), C5 (15.8%), C6/C7 (24.3%) and C9 (18.2%)
(Fig. 3.5). Overall 57.3% of the isolates belonging to C1 to C6 which have been
previously described as livestock-associated cluster (Fig. 3.6) comparatively 42.8% of
isolates belonging to C7 to C9 were predicted to be of non-livestock /environmental in
origin (Champion et al., 2005; Stabler et al., 2013). The relationship of livestock and
non-livestock associated strains along with MAR Index is shown in phenogram
(Hammer et al., 2001) (Fig. 3.6). The isolates belonging to livestock cluster had high
MAR index (p<0.0001) as compared to non-livestock isolates.
Chapter 3 Results
60
Fig. 3.3 Detection of Metallo-β-lactamases in C. jejuni using multiplex PCR
assay for MBL encoding genes i.e., IMP (188bp), SIM (390bp), and VIM (570bp)
Fig. 3.4 Source predictive multiplex PCR: lane 1, 100-bp ladder; lane 2, strain BH20
(mPCR 1); lane 3, strain BH20 (mPCR 2); lane 4, strain SH11 (mPCR 1); lane 5, strain
SH11 (mPCR 2). mPCR 1 involved amplification of genes Cj1422, Cj1139 and Cj0056.
mPCR 2 involved amplification of genes Cj1324, Cj1720 and Cj0485.
Chapter 3 Results
61
Fig. 3.4 Dendrogram displaying source attribution clusters of C. jejuni strains,
based on binary data of PCR profiles by using UPGMA analysis (PAST3.16 Software);
Green strain labels MAR=0.35-0.45, Blue strain labels- MAR=0.5-0.65, Red strain
labels=0.7-0.8; *** indicate isolates which are MBL producers.
Chapter 3 Results
62
Fig. 3.5 Percentage and average MAR index of isolates attributed to livestock
and non-livestock clusters. MAR index of the isolates belonging to livestock cluster
was significantly higher as compared to those associated with non-livestock origin
(Student’s t-test; P<0.005)
Chapter 3 Results
63
3.2 Stress Adaptation in Type Six Secretion System Positive and
Negative C. jejuni Isolates
Although C. jejuni lacks the general stress response machinery present in other gram-
negative bacteria but high prevalence of C. jejuni infections indicate some underlying
alternate mechanisms which may provide it protection against harsh environment.
Therefore, this section was designed to investigate the role of the Type Six Secretion
system (T6SS), which has been recently identified in C. jejuni, adaptation to different
stresses acidic pH, high temperature and oxidative stress. The effect of each of these
stresses on factor such as motility, hydrophobicity, auto aggregation and eventual
biofilm formation was investigated. Bacterial cells unexposed to these stresses and un-
inoculated media was used as positive and negative control respectively.
3.2.1 Determination of Sub-lethal Level of pH
C. jejuni encounters acid stress in host stomach and during food processing. To study
the behavior of T6SS positive and negative C. jejuni isolates under acidic stress,
bacterial strains were exposed to different pH 2.5, 3.5, 4.5, 5.5, 6.5 and the sub-lethal
level of acidic stress was determined. Both T6SS positive and negative isolates were
able to resist acidic pH up to 3.5 whereas no growth was observed in cultures exposed
to pH 2.5 (Fig. 3.6). Sub-lethal pH, at which bacterial cell survival rate is more than
50%, was found to be 5.5 for both T6SS positive and negative isolates.
3.2.2 Effect of Sub-lethal pH 4.5 on Motility
Motility is an important virulence factor in C. jejuni; therefore, T6SS positive and
negative C. jejuni isolates were exposed to sub-lethal pH to observe any differential
response between the two groups. Results showed that motility of both Type six
secretion system positive and negative isolates slightly decreased with exposure to sub-
lethal pH of 4.5 as indicated by a nearly negligible fold change (Student’s t-test; p>0.05)
in the Fig. 3.7.
Chapter 3 Results
64
Fig. 3.6 Average percentage survival of T6SS positive and negative strains at
different pH stress (2.5-6.5). Bacterial cells unexposed to stress and un-inoculated
media were used as positive and negative controls. Sub-lethal pH was found to be 5.5
for both T6SS positive and negative isolates.
Fig. 3.7 Effect of sub-lethal pH (4.5) on motility of T6SS positive and negative
strains (shown in term of average fold change in each group with respect to control i.e.,
bacterial cells unexposed to stress). No significant difference in motility among T6SS
positive and negative groups was observed.
Chapter 3 Results
65
3.2.3 Effect of Sub-lethal pH 4.5 on Auto-aggregation and Hydrophobicity
Both auto aggregation and hydrophobicity play a vital role in adherence of bacterial
cells to host cells and substrates; therefore, the differential effect of acidic stress on
these factors was evaluated in both T6SS positive and negative groups. Our results
showed that auto-aggregation and hydrophobicity of both T6SS positive and negative
isolates increased to a very small extent in response to exposure to sub-lethal pH of 4.5
(Student’s t-test; p>0.05) (Fig. 3.8).
3.2.4 Effect of Sub-lethal pH 4.5 on Biofilm Formation
Biofilm formation ability of both T6SS positive and negative isolates under sub-lethal
dose of pH 4.5 was evaluated in order to study the adaptive advantage of T6SS under
acidic stress. Biofilm formation potential was slightly increased in both T6SS positive
and negative isolates. However, no significant difference in average fold change in
biofilm formation among T6SS positive and negative groups was observed (Student’s
t-test; p>0.05) (Fig. 3.9).
Chapter 3 Results
66
Fig. 3.8 Effect of sub-lethal pH (4.5) on hydrophobicity and auto aggregation of
T6SS positive and negative C. jejuni isolates (shown in term of average fold change in
each group with respect to control i.e., bacterial cells unexposed to stress). No
significant difference in hydrophobicity/auto-aggregation among T6SS positive and
negative groups was observed.
Fig. 3.9 Effect of sub-lethal pH (4.5) on biofilm formation of T6SS positive and
negative C. jejuni isolates (shown in term of average fold change in each group with
respect to control i.e., bacterial cells unexposed to stress). No significant difference in
biofilm formation among T6SS positive and negative groups was observed.
Chapter 3 Results
67
3.2.5 Determination of Sub-lethal Level of Oxidative Stress
C. jejuni, being microaerophilic bacteria, faces unavoidably harsh oxygen stress under
normal environmental condition. Such oxidative stress has been previously reported to
enhance stimulate biofilm formation, however in this study the role of T6SS in
oxidative stress adaptation was evaluated (which was previously unknown). Sub lethal
oxidative stress was determined as measure of resistance to H2O2 concentration. The
average growth of both T6SS positive and negative isolates decreased with the increase
in concentration of H2O2. Sub lethal dose of H2O2, at which bacterial cell survival rate
is more than 50%, was recorded as 8mM for both T6SS positive and negative isolates.
No growth was observed at an exposure above 10 mM (Fig. 3.10).
3.2.6 Effect of Sub-lethal Oxidative Stress (8mM of H2O2) on Motility
Motility is a key factor in stress adaptation and biofilm formation in this experiment we
evaluated the influence of sub lethal oxidative stress on T6SS positive and negative
groups. Motility of T6SS positive isolates slightly decreased with exposure to sub lethal
oxidative stress; however, no significant change in the average motility among T6SS
negative group was observed (student’s t-test; P>0.05) (Fig. 3.11).
Chapter 3 Results
68
Fig. 3.10 Average percentage survival of T6SS positive and negative strains at
different oxidative stress (2-12mM H2O2). Sub lethal dose of H2O2, was recorded as
8mM for both T6SS positive and negative isolates.
Fig. 3.11 Effect of sub-lethal oxidative stress (8mM) on motility of T6SS positive
and negative strains in terms of fold change with respect to control i.e., bacterial cells
unexposed to stress. No significant difference in motility among T6SS positive and
negative groups was observed.
Chapter 3 Results
69
3.2.7 Effect of Sub-lethal Oxidative Stress (8mM of H2O2) on Auto-
aggregation and Hydrophobicity
Effect of sub-lethal oxidative stress on auto aggregation and hydrophobicity was
evaluated in to get a better insight into role of T6SS in stress adaptations. Auto-
aggregation and hydrophobicity of both T6SS positive and negative isolates increased
in response to exposure of sub- lethal dose of oxidative stress (8mM of H2O2). Marked
difference in both autoaggregation (student’s t-test; P<0.01) and hydrophobicity
(student’s t-test; P<0.005) among T6SS positive and negative groups was observed
(Fig. 3.12).
3.2.8 Effect of Sub-lethal Oxidative Stress (8mM of H2O2) on Biofilm
Formation
Comparative effect of sub-lethal dose of oxidative stress on the biofilm forming
potential of T6SS positive and negative isolates was done. Biofilm formation was
enhanced among isolates belonging to T6SS positive group in response to sub-lethal
dose of oxidative stress i.e., 8mM, whereas no effect on biofilm formation was observed
among T6SS negative isolates (student’s t-test; P<0.005) (Fig. 3.13).
Chapter 3 Results
70
Fig. 3.12 Effect of sub-lethal oxidative stress (8mM) on hydrophobicity and auto
aggregation of T6SS positive and negative C. jejuni isolates (shown in term of average
fold change in each group i.e., bacterial cells unexposed to stress). Significant
difference in hydrophobicity/auto-aggregation among T6SS positive and negative
groups was observed. Student’s t-test; **P<0.01
Fig. 3.13 Effect of sub-lethal oxidative stress (8mM) on biofilm formation of
T6SS positive and negative isolate (shown in term of average fold change in each group
with respect to control i.e., bacterial cells unexposed to stress). Significant increase in
biofilm formation among T6SS positive groups as compared to T6SS negative groups
was observed. Student’s t-test; *** P<0.005
Chapter 3 Results
71
3.2.9 Determination of Sub lethal Temperature
C. jejuni are temperature sensitive bacteria which grow optimally at body temperature
of human and birds i.e., 37 ºC and 42 ºC respectively. However, majority of
Campylobacteriosis cases in human have been reported to be due to ingestion of under
cooked meat and vegetables suggesting its survival under heat stress. In this study the
role of T6SS in heat stress adaptation was evaluated. To determine sub lethal
temperature, bacterial strains were exposed for 15 minutes to different temperature i.e.,
42 ºC, 50 ºC, 55 ºC, 60 ºC, and 65 ºC. Both T6SS positive and negative isolates were
able to resist heat up to 60 ºC whereas no growth was observed in culture exposed to
65 ºC (Fig. 3.14). No significant difference in survival response to heat stress was
observed among T6SS positive and negative isolates (student’s t-test; P>0.05). Sub
lethal temperature, at which bacterial cell survival rate is more than 50%, of all isolates
was recorded as 55 ºC.
3.2.10 Effect of Sub-lethal Temperature 55ºC on Motility
The effect of sub-lethal heat stress on motility of T6SS positive and negative bacteria
was studied to any differential response between the two groups. The motility of T6SS
positive strain reduced upon exposure to sub lethal heat stress of 55ºC. On the contrary,
heat stress did not affect the motility of T6SS negative isolates (Fig. 3.15).
Chapter 3 Results
72
Fig. 3.14 Average percentage survival of T6SS positive and negative strains at
different temperature stress (42-65ºC). Bacterial cells unexposed to stress and un-
inoculated media were used as positive and negative controls. Sub lethal temperature
was recorded as 55 ºC.
Fig. 3.15 Effect of sub-lethal heat stress (55ºC) on average motility rate of T6SS
positive and negative strains with respect to control i.e., bacterial cells unexposed to
stress. No significant difference in biofilm formation among T6SS positive and
negative groups was observed.
Chapter 3 Results
73
3.2.11 Effect of Sub-lethal Temperature 55ºC on Auto-aggregation and
Hydrophobicity
Change in auto aggregation and hydrophobicity of T6SS positive and negative bacteria
under sub lethal heat stress was evaluated to study whether T6SS enhances virulence/
adherence potential of C. jejuni or not? Hydrophobicity of both T6SS positive and
negative isolates increased in response to exposure to sub lethal temperature of 55ºC.
However, marked effect was observed in case of T6SS positive group (student’s t-test;
P<0.01). Auto aggregation increased slightly in case of T6SS positive group whereas a
slightly negative effect on auto aggregation ability of T6SS negative group was
observed (student’s t-test; P<0.05) (Fig. 3.16).
3.2.12 Effect of Sub-lethal Temperature 55ºC on Biofilm Formation
Biofilms helps bacteria withstand heat stress; therefore, to analyze the role of T6SS in
heat stress induce biofilm formation both T6SS positive and negative bacteria were
exposed to sub lethal temperature of 55ºC and biofilm formation was recorded.
Biofilm formation was enhanced among all T6SS positive and T6SS negative isolates
in response to sub lethal temperature i.e., 55ºC. Significant difference (student’s t-test;
P <0.01) in average fold change in biofilm formation among T6SS positive and negative
group was observed (Fig. 3.17).
Chapter 3 Results
74
Fig. 3.16 Effect of sub-lethal temperature stress (55⁰C) on hydrophobicity and
auto aggregation of T6SS positive and negative C. jejuni isolates (shown in term of
average fold change in each group with respect to control i.e., bacterial cells unexposed
to stress). Significant difference in hydrophobicity/auto-aggregation among T6SS
positive and negative groups was observed. Student’s t-test; *P<0.05, ** P<0.01
Fig. 3.17 Effect of sub-lethal temperature stress (55⁰C) on a) biofilm formation of
individual T6SS positive and negative isolate (shown in term of average fold change
with respect to control i.e., bacterial cells unexposed to stress in each group) Significant
increase in biofilm formation among T6SS positive groups as compared to T6SS
negative groups was observed. student’s t-test; **P<0.01.
Chapter 3 Results
75
3.3 Structural and Functional analysis of Hcp: Hallmark Protein of
T6SS
Both oxidative and temperature stresses caused significant increase in biofilm
formation in T6SS positive isolates. To further validate the role of T6SS in biofilm
formation the structure and function of hemolysin co-regulatory protein (Hcp) was
studied in detail. Moreover, virulence potential of secretory Hcp was also evaluated.
3.3.1 Expression and Purification of Recombinant and Mutant Hcp Proteins
To determine the structure of Hcp Protein the protein was overexpressed in BL21 cells
and purified using both His Tag and size exclusion chromatography. The hcp gene
(534bp) of Campylobacter jejuni cloned in pET-22b plasmid was expressed using 0.3
mM IPTG and was purified using Ni-NTA affinity beads (Fig. 3.18). The eluted protein
(shown in lane 1; Fig. 3.18b) was further purified using Superdex-200 column (GE
Healthcare, Buckinghamshire, UK). The purified protein was eluted as a single peak
corresponding to hexameric form of Hcp-Cj protein (Fig. 3.19a).
3.3.2 Confirmation of Eluted Protein as Hcp Protein by Mass Spectroscopy
The eluted protein fractions were run on 12.5% SDS which showed that all fractions
were pure and of same size (Fig. 3.19b). One band was cut and was analyzed by Mass
spectroscopy to confirm the identity of purified protein. Peptides mass fingerprints
showed highest score with Hcp-Cj protein of C. jejuni (Fig. 3.20).
3.3.3 Dynamic Light Scattering
All the fractions corresponding to the peak area shown in the SEC graph (3.19a) were
collected, pooled and concentrated to 10mg/ml. Dynamic Light Scattering (DLS) was
used to determine the homogeneity of the protein. The percentage of poly dispersity of
Hcp-Cj protein was recorded as 3% and the SOS error as 18.3 at 10 mg/ml concentration
(Fig. 3.21).
Chapter 3 Results
76
Fig. 3.18 Hcp-Cj protein expression and purification a) BL21 cells showing
expression of Hcp protein (18kDa) in induced culture (IN) and no expression in
uninduced cells (UIN) b) Showing fraction obtained in Ni-NTA coulmn purification;
Lane M: marker, 1: elution, 2: Soluble fraction of cell lysate, 3: insoluble fraction of
cell lysate, 4: flow through after binding with Ni-NTA, Lane 5-7 three subsequent
wahes with imidazole, 8: Hcp protein bonded to beads after elution
Fig. 3.19 Size exclusion chromatography a) elution profile of Hcp protein b) SDS-
PAGE analysis of the eluted fractions of SEC (chosen from the shaded region) showing
purified Hcp-Cj protein.
Chapter 3 Results
77
Fig. 3.20 Mass spectroscopy analysis a) Mass spectrum of tryptic peptide digest
of purified Hcp protein; b) peptides that matched with hcp protein of C. jejuni using
Mascot are underlined
Fig. 3.21 Dynamic light scattering analysis of Hcp-Cj at 10mg/ml concentration
showing the protein is homogenous with polydispersity index of 0.03.
Peptide
R.LPTVEVHWFR.T
R.VHKPFSFTCSLNK.S
K.VVWEHTAAGTSGSDDWR.E
R.KVVWEHTAAGTSGSDDWR.E
K.IEGSTQGLISSGASTEASIGNR.Y
K.LEDAIITNIELIMPNAQESSNHDKTELLK.V
K.SGHEDEIMAQEVSHIVTVPVDQQSGQPSGQR.V
Sequence of HCP-Cj
MAEPAFIKIEGSTQGLISSGASTEASIGNRYKSGHEDEIMAQEVSHIVTVPVDQQSGQPSGQRVHKPFSFTCS
LNKSVPLLYNALTKGERLPTVEVHWFRTATSGGSEHFFTTKLEDAIITNIELIMPNAQESSNHDKTELLKVS
MSYRKVVWEHTAAGTSGSDDWREGKA
a
b
Chapter 3 Results
78
3.3.4 Crystallization
The purified Hcp protein was then used to prepare crystals for structure determination.
The initial crystallization conditions for the Hcp-Cj protein were screened by Index
Screens (Hampton Research) using the hanging-drop vapor-diffusion technique at
25°C. Crystals were formed in four different screens i.e. HR110 screen 4 i.e., 0.1M
Tris-HCl 8.5 2.0 M Ammonium sulfate, screen 17 i.e., and screen no 22 i.e., 0.2M
Sodium acetate trihydrate, 0.1 M Tris-HCl 8.5, 30% PEG (Table 3.1). These screens
were sub-optimized using various conditions shown in (Table 3.2-3.4). The diffraction
quality crystals were obtained with relatively more stringent condition i.e. 0.2 M
sodium acetate trihydrate, 0.1 M Tris-HCl (pH 8.5) and 32% Polyethylene glycol after
two days. The size of the crystal was recorded as 1160µm
Chapter 3 Results
79
Table 3.1 Screening of crystal condition using Index Screens (Hampton Research)
HR2-110 conditions 1-24
Screen
no.
Conditions Results
1 0.02 M Calcium chloride dehydrate, 0.1 M
Sodium acetate trihydrate pH 4.6, 30% v/v (+/-)-
2-Methyl-2,4-pentanediol
Precipitates
2 0.4 M Potassium sodium tartrate tetrahydrate Clear
3 0.4 M Ammonium phosphate monobasic Clear
4 0.1M Tris-HCl 8.5, 2.0 M Ammonium sulfate 2 large Crystals used
for diffraction
Tuning issues
5 0.1 M HEPES sodium pH 7.5, 0.2 M Sodium
citrate tribasic dehydrate, 30% v/v (+/-)-2-
Methyl-2,4-pentanediol
Precipitates
6 0.1 M Tris hydrochloride pH 8.5, 0.2 M
Magnesium chloride hexahydrate, 30% w/v
Polyethylene glycol 4,000
Precipitates
7 0.1 M Sodium cacodylate trihydrate pH 6.5, 1.4
M Sodium acetate trihydrate
Clear
8 0.1 M Sodium cacodylate trihydrate pH 6.5, 0.2
M Sodium citrate tribasic dehydrate, 30% v/v 2-
Propanol
Precipitates
9 0.1 M Sodium citrate tribasic dihydrate pH 5.6,
0.2 M Ammonium acetate, 30% w/v
Polyethylene glycol 4,000
very small crystals
numerous
10 0.1 M Sodium acetate trihydrate pH 4.6, 0.2 M
Ammonium acetate
30% w/v Polyethylene glycol 4,000
Clear
11 0.1 M Sodium citrate tribasic dihydrate pH 5.6,
1.0 M Ammonium phosphate monobasic,
Crystals
12 0.2 M Magnesium chloride hexahydrate, 0.1 M
HEPES sodium pH 7.5, 30% v/v 2-Propanol
Precipitates
13 0.1M Tris-HCl 8.6, 0.2 M Sodium citrate
tribasic dehydrate, 30% v/v Polyethylene glycol
400
Clear
14 0.1 M HEPES sodium pH 7.5, 0.2 M Calcium
chloride dehydrate, 28% v/v Polyethylene glycol
400
Clear
15 0.1 M Sodium cacodylate trihydrate pH 6.5, 0.2
M Ammonium sulfate, 30% w/v Polyethylene
glycol 8,000
Not done
16 0.1 M HEPES sodium pH 7.5, 1.5 M Lithium
sulfate monohydrate
Not done
17 0.1M Tris-HCl 8.5, 0.2m Lithium sulphate,
PEG=30
Crystals-checked for
further optimization
Chapter 3 Results
80
Large but many
fewer in number
Screen
no.
Conditions Results
18 0.2 M Magnesium acetate tetrahydrate, 0.1 M
Sodium cacodylate trihydrate pH 6.5, 20% w/v
Polyethylene glycol 8,000
Not done
19 0.2 M Ammonium acetate, 0.1 M TRIS
hydrochloride pH 8.5, 30% v/v 2-Propanol
Precipitates
20 0.2 M Ammonium sulfate, 0.1 M Sodium
acetate trihydrate pH 4.6, 25% w/v Polyethylene
glycol 4,000
Precipitates
21 0.2 M Magnesium acetate tetrahydrate, 0.1 M
Sodium cacodylate trihydrate pH 6.5, 30% v/v
(+/-)-2-Methyl-2,4-pentanedio1
Precipitates
22 0.2 M Sodium acetate trihydrate, 0.1 M TRIS
hydrochloride pH 8.5, 30% w/v Polyethylene
glycol 4,000
Crystals-checked for
further optimization
Large but few
23 0.2 M Magnesium chloride hexahydrate, 0.1 M
HEPES sodium pH 7.5, 30% v/v Polyethylene
glycol
Clear
24 0.2 M Calcium chloride dihydrate, 0.1 M
Sodium acetate trihydrate pH 4.6, 20% v/v 2-
Propanol
Crystals
Chapter 3 Results
81
Table 3.2 Sub-optimization of Crystal Screen HR2-110 condition no. 4 i.e., 0.1 Tris-HCl 8.5, 2M Ammonium Sulphate
1 2 3 4 5 6
A 0.1M Tris-HCl 8.4
2M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
2M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
2M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
2M Ammonium
Sulphate
2:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
2M Ammonium
Sulphate
2:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
2M Ammonium
Sulphate
2:1 protein: buffer
Clear
B
0.1M Tris-HCl 8.4
1.8M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
1.8M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
1.8M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
1.8M Ammonium
Sulphate
2:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
1.8M Ammonium
Sulphate
2:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
1.8M Ammonium
Sulphate
2:1 protein: buffer
Clear
C 0.1M Tris-HCl 8.4
1.6M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
1.6M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
1.6M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
1.6M Ammonium
Sulphate
2:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
1.6M Ammonium
Sulphate
2:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
1.6M Ammonium
Sulphate
2:1 protein: buffer
Clear
D 0.1M Tris-HCl 8.4
2.2M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
2.2M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
2.2M Ammonium
Sulphate
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
2.2M Ammonium
Sulphate
2:1 protein: buffer
One large crystal
954.51 um
0.1M Tris-HCl 8.5
2.2M Ammonium
Sulphate
2:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
2.2M Ammonium
Sulphate
2:1 protein: buffer
One large crystal
Chapter 3 Results
82
Table 3.3 Sub-optimization of Crystal Screen HR2-110 condition no. 17 i.e., 0.2M Lithium Sulphate monohydrate, 0.1 M Tris-HCl 8.5,
30% PEG
1 2 3 4 5 6
A 0.1M Tris-HCl 8.4
0.2m CaCL2
PEG=22 %
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.4
0.2m CaCL2
PEG=24
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.4
0.2m CaCL2
PEG=26
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.4
0.2m CaCL2
PEG=28
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.4
0.2m Lithium Sulphate
PEG=30
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.4
0.2m Lithium sulphate
PEG=32
1:1 protein: buffer
Crystals
B
0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=22
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=24
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=26
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=28
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium sulphate
PEG=30
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.5
0.2m Lithium sulphate
PEG=32
1:1 protein: buffer
Crystals
C 0.1M Tris-HCl 8.6
0.2m Lithium
sulphate
PEG=22
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2m Lithium
sulphate
PEG=24
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2m Lithium
sulphate
PEG=26
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2m Lithium
sulphate
PEG=28
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2m Lithium sulphate
PEG=30
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.6
0.2m Lithium sulphate
PEG=32
1:1 protein: buffer
Crystals
D 0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=22
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=24
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=26
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium
sulphate
PEG=28
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium sulphate
PEG=30
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2m Lithium sulphate
PEG=32
1:1 protein: buffer
Crystals
Chapter 3 Results
83
Table 3.4 Sub-optimization of Crystal Screen HR2-110 condition no. 22 i.e., 0.2M Sodium acetate trihydrate, 0.1 M Tris-HCl 8.5, 30%
PEG
1 2 3 4 5 6
A 0.1M Tris-HCl 8.4
0.2 Sodium acetate
trihydrate
PEG=22%
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
0.2 Sodium acetate
trihydrate
PEG=24
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
0.2 Sodium acetate
trihydrate
PEG=26
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
0.2 Sodium acetate
trihydrate
PEG=28
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
0.2 Sodium acetate
trihydrate
PEG=30
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.4
0.2 Sodium acetate
trihydrate
PEG=32
1:1 protein: buffer
Clear
B
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=22
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=24
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=26
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=28
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=30
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=32
1:1 protein: buffer
Crystal-used for final
XRD
C 0.1M Tris-HCl 8.6
0.2 Sodium acetate
trihydrate
PEG=22
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2 Sodium acetate
trihydrate
PEG=24
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2 Sodium acetate
trihydrate
PEG=26
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2 Sodium acetate
trihydrate
PEG=28
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.6
0.2 Sodium acetate
trihydrate
PEG=30
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.6
0.2 Sodium acetate
trihydrate
PEG=32
1:1 protein: buffer
Crystals
D 0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=22
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=24
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=26
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=28
1:1 protein: buffer
Clear
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=30
1:1 protein: buffer
Crystals
0.1M Tris-HCl 8.5
0.2 Sodium acetate
trihydrate
PEG=32
1:1 protein: buffer
Crystals
Chapter 3 Results
84
3.3.5 The Overall Structure of C. jejuni Hcp
The structure of Hcp from C. jejuni was solved by molecular replacement and was
refined to a 2.8 Å resolution (Table 3.5). Overall structure shows six molecules which
form a hexamer ring in asymmetric unit with a diameter of approx. 80 Å and internal
pore of 40Å (Fig. 3.22). Each monomer in a hexamer ring comprising of 1) a tight β-
barrel domain (two β sheets) 2) one turn helix (H1) and 3) 11-residue α-helix (H2). The
β-barrel domain is (approx. 12 Å diameter) formed by 8 strands of antiparallel β strands
(β1- β8) and has both hydrophobic and hydrophilic residues. Four β strands i.e., β2, β3,
β6 and β7 of each monomer form the inner surface of the hexamer ring. The region
from Val44 to Thr49 (β2) of one monomer interacts with residues Asn122 to Met127
(β8) of the adjacent monomer to form a ring. The beta barrel is connected to a 5-residue
one turn helix H1 (Glu24 to Ile27) which act like a cap over Helix 2. H2 (11 residue
Helix) from Ser77 to Lys87 act as interlocking element between chains of the hexamer
rings because on one hand it interacts with β strands (β6, β 7) with in same chain (by
Val78, Leu81, Tyr82, Leu85) and on other hand with the β strands (β8) of adjacent
chain (by Pro79, Asn83, Tyr86, Lys87). Loop 3 between β2 and β3 is an extended loop
that comprises of 17 residues (Pro51-Pro67) and protrudes approximately 25 Å from
the core beta barrel.
Chapter 3 Results
85
a)
b)
Fig. 3.22 Overall structure of the Hcp-Cj from C. jejuni Cartoon representation of
the Hcp monomer (a) and hexameric ring (b)
Chapter 3 Results
86
Table 3.5 Data collection and refinement statistics.
Hcp_CJ
Data Collection Space group P212121
Cell Dimensions a,b,c (Å) 92.37 91.92 165.74
α,,β,γ(o) 90 90 90
Resolution (Å) 50.0-2.6 (2.64-2.6) Rsym/Rmerge 0.12 (0.56)
I/ sI 15.4 (1.9)
Completeness (%)* 87.5 (83.1)
Redundancy* 2.7 (2.7)
No. reflections 180663(73986)
Refinement Resolution (Å) 19.9-2.6 (2.64-2.6) R work/ R free 0.21/0.25
No. atoms Proteins 7174
Water 109
B-factors Proteins 65
Water 57.8
R.m.s deviations Bond lengths (Å) 0.009
Bond angles (o) 1.21
*Values in parentheses are for highest-resolution shell.
Chapter 3 Results
87
3.3.6 Comparison with Hcp-Cj with Known Crystal Structures of Hcp
A total of six Hcp crystal structures are available in protein data bank (PDB) so far i.e.,
Pseudomonas aeruginosa Hcp1 (PDB code: 1Y12), Hcp3 (PDB code: 3HE1),
Edwardsiella tarda (PDB code: 3EAA), enteroaggregative Escherichia coli (PDB
code: 4HKH), Burkholderia pseudomallei (PDB code: 3WX6) and Acinetobacter
baumannii (PDB code: 4W64). The Hcp protein of C. jejuni showed limited sequence
identities to the six other Hcps ranging from 8.49% to 46.5% (Table 3.6). However, the
crystal structures alignment showed that all of them shared the same basic architecture
of hexamer ring with RMSD values falling in between 1.90 Å and 4.84 Å. The main
differences in the secondary structures are i) the number of beta sheets, ii)
presence/absence of one turn helix and iii) especially the overhang loops L1,2 and L2,3
which vary greatly in length and composition (3.23 and 3.24). Conserved residues in
the hexamer ring of Hcp-Cj and other hcps were calculated using Clustal Omega and
Consurf. Few residues were found to be highly conserved among all Hcp proteins i.e.,
Gly28, S26, His35, Gly57, Thr71, Ala84 and Trp166. All of them are exposed except
Thr71 and Ala 84 which are buried and not solvent accessible. Residues Lys72, Asp75,
Glu142 were found to be highly conserve in all Hcp sequences but Hcp-Cj showed
variation at these points (Cys72, Asn75, Leu142). Slight conserved residues are Ile17,
Asn29, Ile39, Gly57, Pro79, Leu81, Gly88, Glu95, Lys114, Glur116 and Tyr148 (Fig.
3.25). Most of the conserved amino acids are on external side of the ring and exposed
while the residues in the inner side/channel of the ring shows more variable residues.
Chapter 3 Results
88
Fig. 3.23 Multiple sequence alignment of Hcp-Cj (Cj255) with its homologs i.e., 1Y12 (Pseudomonas aeruginosa Hcp1), 3HE1
(Pseudomonas aeruginosa Hcp3), 3EAA (Edwardsiella tarda Hcp), 4HKH (enteroaggregative Escherichia coli Hcp), 3WX6
(Burkholderia pseudomallei Hcp) and 4W64 (Acinetobacter baumannii Hcp).
Chapter 3 Results
89
a) b)
Fig. 3.24 Structural alignment (a) showing that Hcp-Cj (with homolog protein) vary greatly in length and composition especially
the overhang loops L1,2 and L2,3 [Green: Hcp_Cj, Magenta: EvpC (3EAA), Brown: B. pseudomallei (3WX6), Hot pink: E. coli
(4HKH), Yellow: P. aeruginosa Hcp3(3HE1), Cyan: P. aeruginosa Hcp1 (1Y12), Blue: A. baumannii (4W64)]. b) Showing residues
30R and 31Y which were mutated to Alanine
Chapter 3 Results
90
Fig. 3.25 Conserved residues on the Hcp surface. Deep red color represents highly conserved residues and blue represent variable
residues. External surface of the hexamer is moderately conserved (a, b, e) as whereas the internal surface has comparatively more
variable residues (d). Conserved region mainly lies in the beta sheets and helix (c)
Chapter 3 Results
91
Table 3.6 Sequence and structural comparison of Hcp-Cj with its homologs
C. jejuni
Hcp-Cj
P. aeruginosa
Hcp3
(3HE1)
P. aeruginosa
Hcp1
(1Y12)
A. baumannii
(4W64)
EvpC
(3EAA)
E. coli EAEC
042 pathovar
(4HKH)
B. pseudomallei
(3WX6)
Sequence comparison
Sequence
length (aa)
171 173 162 171 163 163 169
Sequence
identity
- 46.55% 8.49% 2.85% 11.17% 10.35% 11.90%
Size(kDa) 18.75 19.18 17.41 19.08 17.86 18.85 18.74
pI 5.78 5.49 6.29 6.59 5.71 5.67 5.68
Signature
features
(Prosite
prediction)
N-myristoylation
site (4)
Casein kinase II
phosphorylation
(6)
N-glycosylation
site (1)
Protein kinase C
(2)
Microbodies C-
terminal
targeting signal
(1)
N-
myristoylation
site (4)
Casein kinase II
phosphorylation
(6)
Protein kinase
C (1)
cAMP-
dependent
protein kinase
phosphorylation
site (1)
N-
myristoylation
site (5)
Casein kinase II
phosphorylation
(3)
N-glycosylation
site (1)
Protein kinase C
(3)
N-
myristoylation
site (3)
Casein kinase II
phosphorylation
(3)
N-glycosylation
site (2)
Protein kinase
C (4)
cAMP-
dependent
protein kinase
phosphorylation
site (1)
N-
myristoylation
site (3)
Casein kinase II
phosphorylation
(1)
Protein kinase
C (4)
Casein kinase II
phosphorylation
(2)
N-glycosylation
site (1)
Protein kinase
C (3)
Tyrosine
kinase
phosphorylation
site (1)
N-
myristoylation
site (4)
Casein kinase II
phosphorylation
(3)
N-glycosylation
site (1)
Protein kinase C
(1)
Amidation site
(1)
Chapter 3 Results
92
C. jejuni
Hcp-Cj
P. aeruginosa
Hcp3
(3HE1)
P. aeruginosa
Hcp1
(1Y12)
A. baumannii
(4W64)
EvpC
(3EAA)
E. coli EAEC
042 pathovar
(4HKH)
B. pseudomallei
(3WX6)
Crystal structure comparison
Rmsd*
-- 1.02 4.84 4.18 4.24 2.77 1.90
Space
group
P212121 P321 P6 P6 P6 P2 P6
Resolution
(Å)
2.8 2.098 1.95 1.55 2.8 3.5 2.7
No of Beta
strands
8 11 10 10 11 9 10
Alpha
helix (No.)
11aa helix (1)
One turn helix
(1)
12aa helix (1)
One turn helix
(2)
11 aa alpha
helices (1)
10 aa alpha
helix (1)
One turn
helix(1)
11 aa alpha
helix (1)
One turn helix
(1)
12aa helix (1) 12aa helix (1)
One turn helix
(1)
Inner
channel of
hexamer
40 Å 40 Å 40 Å 40 Å 40 Å 40 Å 40 Å
Diameter
of
hexamer
85 Å 90 Å 85 Å 80 Å 80 Å 80 Å 80 Å
Chapter 3 Results
93
3.3.7 Functional Analysis of Secretory Hcp Protein
3.3.7.1 Cytotoxicity towards Prokaryotic Cells
To study the role of secreted Hcp-Cj in providing any competitive advantage to T6SS
harboring C. jejuni, T6SS C. jejuni strains and E. coli (DH5α) were grown in the
presence of purified Hcp-Cj. No significant change in growth (student’s t-test; P >0.05)
was observed in any of the test bacteria showing that the protein is not bactericidal to
other prokaryotic cells (Fig. 3.26)
3.3.7.2 RBC Lysis Assay
To study the effect of Secreted Hcp-Cj protein on viability of Sheep’s red blood cells,
RBC lysis assay was performed. No significant difference in O.D. of the cell
supernatant in negative control, Hcp-Cj (recombinant) and mutant Hcp-Cj (Hcp-R30A
and Hcp-Y31A) exposure group (student’s t-test; P>0.05) was observed indicating that
the Hcp-Cj protein did not cause lysis of sheep erythrocytes (Fig. 3.27).
3.3.7.3 Cytotoxicity towards Eukaryotic Cells (HepG2)
Purified Hcp-Cj (recombinant type) exposure caused significant reduction in cell
viability of HepG2 cells as to 41.8% as compared to 100% survival in untreated control
group. Mutant Hcp-R30A showed significant increase in cell viability i.e., 47.3%
(student’s t-test; P<0.01) as compared to recombinant type Hcp-Cj. However, mutant
Hcp-Y31A didn’t show significant difference in cytotoxicity as compared to
recombinant Hcp protein as shown by Fig. 3.28.
Chapter 3 Results
94
Fig. 3.26 Effect of Hcp exposure on the growth of T6SS positive (strain ID 77,
255); T6SS negative (strain ID 301, Akc27) and Dh5α. Bacterial cells unexposed to
Hcp were used as control. No significant change in growth (student’s t-test; P>0.05)
was observed in any of the test bacteria in response to Hcp exposure.
Fig. 3.27 Hemolysis assay depicting that exposure of recombinant type hcp,
HcpR30A mutant and HcpY31A mutant protein didn’t caused lysis of Sheep
erythrocytes. Control group show lysis of RBC by 1% SDS. No significant difference
in O.D. of the cell supernatant in negative control, Hcp-Cj (rHcp) and mutant Hcp-Cj
(Hcp-R30A and Hcp-Y31A) exposure group (student’s t-test; P>0.05) was observed.
Chapter 3 Results
95
a)
b)
Fig. 3.28 Cytotoxicity of recombinant and mutant Hcp-Cj towards HepG2 cells.
A) Showing reduction in HepG2 cells viability (%) on exposure to recombinant type
and mutant Hcp-Cj. B) Microscopic image of untreated control (NTC) and treated (Hcp,
exposed) HepG2 cells. Mutant Hcp-R30A showed significant increase in cell viability
i.e., (student’s t-test; P<0.01) as compared to recombinant type Hcp-Cj.
Chapter 3 Results
96
3.3.7.4 Motility Assay
Motility of all T6SS harboring C. jejuni, T6SS negative isolates and control E. coli
(DH5α) remained unaffected by the exposure to both mutant and recombinant type
Hcp-Cj (Hcp-R30A and Hcp-Y31A) proteins Fig. 3.29 (student’s t-test; P >0.05).
3.3.7.5 Biofilm Assay
The effect of secretory Hcp-Cj on biofilm forming ability of both T6SS positive and
negative strains was studied which showed that establishment of biofilm was not
dependent on presence or absence of Hcp-Cj in both types of strains. However, volume
of biofilm formation was significantly enhanced in all C. jejuni (student’s t-test;
P<0.01) isolates. The effect of Hcp-Cj exposure and reduction in biofilm formation was
more pronounced in T6SS positive isolates as compared to T6SS negative isolates
(student’s t-test; P<0.05). This is likely because all the T6SS‐positive strains were weak
biofilm formers in the absence of Hcp as compared to T6SS‐negative strains (Fig. 3.30
a, b). A change in biofilm formation was observed in HcpR30A and HcpY31A mutants
as compared to recombinant type Hcp-Cj; however, this difference was not statistically
significant.
Chapter 3 Results
97
.
Fig. 3.29 Motility assay showing that recombinant and mutant Hcp-Cj didn’t
cause significant change in zone of motility of both type six positive (77, 255) and type
six negative strains (301, Akc27). No significant change in motility was observed in
response to Hcp exposure (student’s t-test; P >0.05)
.
Chapter 3 Results
98
a)
b)
Fig. 3.30 Effect of recombinant and mutant Hcp-Cj on Biofilm formation in C. jejuni.
a) Biofilm formation was significantly enhanced on exposure to Hcp-Cj as compared
to unexposed cells (student’s t-test; *P<0.05, **P<0.01); b) No significant difference
in biofilm formation on exposure to mutant and recombinant type Hcp-Cj was observed
(student’s t-test; P>0.05).
Chapter 3 Results
99
3.4 In silico Drug Target Identification of C. jejuni
Insilico drug designing using genomics, proteomes, microarray, and metabolomics data
provides an alternate strategy to identify novel and essential drug target in pathogenic
bacteria to combact multidrug (Zhang et al., 2005). In the present study a combination
of subtractive proteomics and comparative metabolic pathway analysis was done to
identify potential drug targets in C. jejuni (11168) to develop alternative treatment for
multidrug resistant isolates.
3.4.1 Essential Non-homology Protein in C. jejuni
The first step involved elimination of all those protein in C. jejuni which shared
homology to human proteome in order to prevent potential side effects of the drug
designed against these targets. The proteome of C. jejuni 11168 consisting of 1722
proteins was retrieved and subjected to BLASTP against H. sapiens proteome. Out of
which 235 proteins, which showed significant similarity with that of H. sapiens were
excluded (E-value cutoff of 10-3). All the non-homologous proteins (n=1487) were then
filtered based on their essentiality using DEG server to identify proteins in C. jejuni
which are essential for survival and are evolutionary conserved. A total of 173 proteins
showed hits against DEG database were regarded to be essential for C. jejuni whereas
the remaining proteins 1314 proteins with no hits were excluded from further analysis
as they were nonessential.
3.4.2 KEGG Pathway Analysis
Non-homologous essential proteins were then analyzed for their role in metabolic
pathways using KEGG Metabolic pathway analysis as targeting such proteins will
affect the growth of bacteria. Eighty-seven protein sequences were found to be
involved the metabolic pathways of C. jejuni out of which 68 proteins belonged to
pathway which are common in Human and C. jejuni. Whereas 19 proteins belonged to
unique pathways (only present in C. jejuni). i.e., Beta-lactam resistance, Bacterial
secretion system, Two-component system, Cationic antimicrobial peptide (CAMP)
resistance, Methane metabolism flagellar assembly, Biosynthesis of secondary
metabolites, Microbial metabolism in diverse environments (Fig. 3.31). Proteins
involved in metabolic pathways were selected for further analysis.
Chapter 3 Results
100
Fig. 3.31 Number of essential non-homologous proteins of C. jejuni involved in
common (blue) and unique pathways determined through KEGG Pathway analysis.
Chapter 3 Results
101
3.4.3 Drugability Potential of the Shortlisted Proteins
The shortlisted protein sequences tested for their drugability potentially using Drug
bank database to study whether they can act as drug targets. This resulted in
identification of 38 proteins which showed significant similarity with the available
targets in the DrugBank database. Out of these 7 drug targets had FDA approved drugs,
however drugs for remaining 31 drug targets are still under experimental investigation
(Table 3.7).
3.4.4 Prioritization of Druggable Targets
Druggable targets were prioritized by functional analysis which showed that 28 of
proteins were enzymes, 4 were ribosome associated proteins, 3 were involved in
transcription and 2 were penicillin binding protein and 1 was ATP binding protein. In
the present study, all the proteins (except rpoB and was thus eliminated from further
analysis) had molecular weight less than 110 kDa. Only one out of 38 protein targets
i.e., kpsT was identified as virulence factor protein using Virulence Factor DataBase
(VFDB) (Chen et al., 2012). Most of druggable targets in this study belong to cytoplasm
and 5 proteins were associated with cytoplasmic membrane and remaining 1 had
unknown location. Out of 5 cytoplasmic membrane associated protein, three had
transmembrane helices. Of the target three had experimentally resolved or crystal
structure, whereas structures of 31 targets have been so far predicted by homology
model. Structure of two drug target is still unknown i.e., ispH and glyS. Non-homology
analysis of drug target against chicken proteome was indicated that 33 drug targets were
unique to C. jejuni and absent in chicken proteome. Only 10 drug targets were found
to be non-homologous to human gut microflora thus after prioritization process, 10
proteins out of 38 druggable target were shortlisted as the most potential drug targets
(Table 3.8). The proteins include acnB; bifunctional aconitate hydratase 2/2-
methylisocitrate dehydratase (COG1049 ), frdC; fumarate reductase subunit C
(COG2009), folK; 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
pyrophosphokinase (COG0801), ispDF; bifunctional 2-C-methyl-D-erythritol 4-
phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
(COG0245,COG1211), nadE; NAD synthetase (COG0171), pbpB; penicillin-binding
Chapter 3 Results
102
protein (COG0768), pbpC; penicillin-binding protein, pycB; pyruvate carboxylase B
subunit (COG5016), cj0915 hydrolase (COG1607), cj0353c phosphatase (COG0248).
All these proteins were enzymes except pbpB and pbpC (Table 3.8). A statistical
summary of drug target identification of C. jejuni is shown in (Tablen3.9).
Chapter 3 Results
103
Table 3.7 Druggable target of C. jejuni before prioritization
Sr.
No
Protein Name COG DrugBank
ID
Name of drug Drug group
1 acnB COG1049 DB04351 Aconitate Ion Experimental
2 aroA COG0128 DB04328
DB04539
Shikimate-3-Phosphate
Glyphosate
Experimental
Experimental
3 aroB COG0337 DB02592 Carbaphosphonate Experimental
4 dxr COG0743
COG0331
DB02496
DB02948
DB03649
DB04272
1-Deoxy-D-xylulose 5-phosphate
Fosmidomycin
[{(5-Chloro-2-Pyridinyl) Amino} Methylene]-1,1-
Bisphosphonate
Citric Acid
Experimental
Experimental
Experimental
Nutraceutical
5 fabd COG0331 DB07344 3,6,9,12,15-Pentaoxaheptadecan-1-OL Experimental
6 fba COG0191 DB03026 Phosphoglycolohydroxamic Acid Experimental
7 fbp COG0158 DB00131
DB02778
Adenosine monophosphate
2,5-Anhydroglucitol-1,6-Biphosphate
Approved, nutraceutical
Experimental
8 fmt COG0223 DB04464 N-Formylmethionine Experimental
9 frda COG1053 DB07669 2,3-Dimethyl-1,4-Naphthoquinone Experimental
10 frdc COG2009 DB07669 2,3-Dimethyl-1,4-Naphthoquinone Experimental
11 folK COG0801 DB02119 6-Hydroxymethyl-7, 8-Dihydropterin Experimental
12 galU COG1210 DB01643 Thymidine-5'-Phosphate Experimental
14 ispDF COG0245
COG1211
DB02552 Geranyl Diphosphate Experimental
15 ispH COG0761 DB01785
DB04714
Dimethylallyl Diphosphate
Isopentenyl Pyrophosphate
Experimental
Experimental
16 kpsT COG1134 DB00864 Tacrolimus Approved, investigational
Chapter 3 Results
104
17 murB COG0812 DB03147 Flavin adenine dinucleotide Approved
18 murC COG0773 DB01673
DB03909
DB04395
Uridine-5'-Diphosphate-N-Acetylmuramoyl-L-Alanine
Adenosine-5'- [Beta, Gamma-Methylene] Triphosphate
Phosphoaminophosphonic Acid-Adenylate Ester
Experimental
Experimental
Experimental
19 murl COG0796 DB08698 1-[(3S)-5-Phenyl-3-Thiophen-2-YL-3H-1,4-Benzodiazepin-2-
YL] Azetidi-3-OL
Experimental
20 nadE COG0171 DB04099 Deamido-Nad+ Experimental
21 nrdF COG0208 DB04077 Glycerol Experimental
22 nusB COG0781 DB04272 Citric Acid Nutraceutical
23 pbpA COG0744 DB00229
DB00267
DB00301
Cefotiam
Cefmenoxime
Flucloxacillin
Approved
Approved
Approved
25 pbpB COG0768 DB00535 Cefdinir Approved
25 pbpC COG0768 DB00303
DB00671
DB00142
Ertapenem
Cefixime
L-Glutamic Acid
Approved, investigational
Approved
Nutraceutical
26 PFS COG0775 DB07463 (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d] pyrimidin-7-yl)
methyl]-4-[(butylsulfanyl)methyl] pyrrolidin-3-ol
Experimental
27 pheA COG1605
COG0077
DB08648 8-Hydroxy-2-Oxa-Bicyclo [3.3.1] NON-6-ENE-3,5-
Dicarboxylic Acid
Experimental
28 purQ COG0047 DB00130 L-Glutamine Approved, investigational,
nutraceutical
29 pycB COG5016 DB02637
DB03801
DB04553
Oxaloacetate Ion
Lysine N-Carboxylic Acid
2-Oxobutanoic Acid
Experimental
Experimental
Experimental
30 rplC COG0087 DB01256 Retapamulin Approved
Chapter 3 Results
105
31 rpsF COG0087 DB08185 2-MethylThio-N6-Isopentenyl-Adenosine-5'-Monophosphate Experimental
32 rpsH COG0085 DB08185 2-MethylThio-N6-Isopentenyl-Adenosine-5'-Monophosphate Experimental
33 rpsN COG0199 DB08185 2-MethylThio-N6-Isopentenyl-Adenosine-5'-Monophosphate Experimental
34 thisD COG0351 DB02022 4-Amino-5-Hydroxymethyl-2-Methylpyrimidine Experimental
35 tyrS COG0162 DB03978 Tyrosinal Experimental
36 valS COG0525 DB00161 L-Valine Approved, nutraceutical
37 CJ0915
Hydrolase
COG1607 DB01992 Coenzyme A Nutraceutical
38 Cj0353c
Phosphatase
COG0248 DB03382 S-Oxy Cysteine Experimental
Chapter 3 Results
106
Table 3.8 List of Druggable target of C. jejuni after prioritization
Sr.
No
.
Protein
Name
DrugBank
ID
Name of Drug Group of drugs Functional
category
Cellular
localization/
Trans-
membrane
domain
KEGG
Unique/
common
pathway
Availability of 3D
Structure
1 acnB DB04351 Aconitate Ion Experimental Enzyme Cytoplasmic CPP Homology model
2 frdc DB07669 2,3-Dimethyl-1,4-
Naphthoquinone
Experimental Enzyme Cytoplasmic
membrane
5 TMMH
UPP Homology model
3 folK DB02119 6-Hydroxymethyl-7, 8-
Dihydropterin
Experimental Enzyme Cytoplasmic CPP Homology model
4 ispDF DB02552 Geranyl Diphosphate Experimental Enzyme Cytoplasmic UPP Crystal structure
5 nadE DB04099 Deamido-Nad+ Experimental Enzyme Cytoplasmic CPP Crystal structure
6 pbpB DB00535 Cefdinir Approved Penicillin
Binding
Protein
Cytoplasmic
membrane
1 TMMH
UPP Homology model
7 pbpC DB00303
DB00671
DB00142
Ertapenem
Cefixime
L-Glutamic Acid
Approved,
Approved,
Nutraceutical
Penicillin
Binding
Protein
Cytoplasmic UPP Homology model
8 pycB DB02637
DB03801
DB04553
Oxaloacetate Ion
Lysine Nz-Carboxylic
Acid
2-Oxobutanoic Acid
Experimental
Experimental
Experimental
Enzyme Cytoplasmic CPP Homology model
9 CJ0915
Hydrolase
DB01992 Coenzyme A Nutraceutical Enzyme Unknown CPP Crystal structure
10 Cj0353c
Phosphatase
DB03382 S-Oxy Cysteine Experimental Enzyme Cytoplasmic CPP Homology model
Chapter 3 Results
107
Table 3.9 Statistical summary of drug target identification of C. jejuni.
Total Proteins 1722
Non-homologous proteins (to human proteome) 1487
Essential and Non-homologous proteins 174
Essential and Non-homologous proteins in KEGG pathway 88
Unique pathway proteins 19
Druggable targets 39
Chapter 3 Results
108
3.5 Control of C. jejuni in Poultry by pH Sensitive Plant Extract
Encapsulated Alginate Chitosan Nanoparticles
C. jejuni infections are mainly caused by consumption of undercooked poultry meat
and reduction of C. jejuni load in the intestines/carcass of chickens can lead to drastic
decrease in campylobacteriosis case (Rosenquist et al., 2003; EFSA, 2011). Therefore,
this section of the study was designed to use of nano-encapsulated natural antimicrobial
plant extract for targeted release in the chicken intestine to reduce the load of C. jejuni
in poultry.
3.5.1 Screening of Plant for Anti-campylobacter Activity
Five medicinal plants i.e., Berberis lycium (bark), Trachyspermum annum (seeds),
Nigella sativa (Seeds), Camellia sinensis (leaves), Mentha longifolia (leaves) were
screened for their antibacterial activity against C. jejuni. Among all these plant
materials, T. annum (seeds) showed best anti-campylobacter activity as indicated by
larger zone of inhibition (28.5mm) compared to that of M. longifolia, B. lycium, N.
sativa and C. sinensis respectively. Therefore, T. annum (seeds) was selected for further
studies (Fig. 3.32).
3.5.2 Active Anti-campylobacter fraction of Trachyspermum ammi
All six fractions i.e., methanolic (MF), n-hexane (HF), chloroform (CF), ethyl acetate
(EF), n-butanol (BF) and aqueous fraction (AF) were then evaluated for their anti-
campylobacter activity. Methanolic, n-hexane, ethyl acetate and butanol fraction
showed anti-campylobacter activity with MIC value of 0.125, 0.0362, 0.5, 0.25 mg/ml
respectively. Hexane fraction was found to be the most active as indicated by lowest
MIC (Fig. 3.33).
3.5.3 Influence on Bacteria Cell Survival
The influence of exposure of hexane fraction of Trachyspermum annum (seeds), on the
bacteria survival was studied for a period of 4 hours. The number of colony forming
units (CFU) decreased with increasing time of exposure. During first 150 minutes of
exposure the bacterial count decreased from 107 to 103 and after which no colonies were
observed indicating complete killing of all C. jejuni cells (Fig. 3.34).
Chapter 3 Results
109
Fig. 3.32 Anti-campylobacter activity of crude extract of A) positive control
Ampicillin, B) Trachyspermum annum (28.5mm), C) Mentha longifolia (17mm), D)
Camellia sinensis (23mm) E) Berberis lycium (26.5mm) F) Nigella sativa (25.5mm).
T. annum (seeds) showed best anti-campylobacter activity as indicated by largest zone
of inhibition.
Fig. 3.33 MTT assay showing the anti-campylobacter activity of different fraction
of Trachyspermum annum (seeds). Four fractions were found to be active with i.e.,
methanolic fraction (MF), hexane fraction (HF), butanol fraction (BF) and ethyl acetate
fraction (EF) with minimum inhibitory concentration of 0.125, 0.0362, 0.25 and 0.5
mg/ml respectively. Hexane fraction was found to be the most active as indicated by
lowest MIC i.e. 0.0362 mg/ml. Untreated bacterial cultures were used as positive
control.
Chapter 3 Results
110
Fig. 3.34 Time dependent cell survival assay a) graph showing log reduction in
CFU/ml on exposure to hexane fraction of T. annum. The bacterial count decreased
from 107 to 103 during first 150 minutes of exposure and 100% killing was observed at
180 min. Un-treated bacterial cultures were used as positive control.
Chapter 3 Results
111
3.5.4 Gas Chromatography-Mass Spectroscopy Analysis
The GC-MS analysis of n-hexane fraction of Trachyspermum ammi seeds was done to
identify the components of the active hexane fraction. The analysis showed that it is
composed of four major constituent giving distinct peaks at retention time of 2.23, 2.54,
4.08 and 4.14 minutes (Fig. 3.35). The mass spectra of each peak were compared with
NIST 02 spectral library for identification and identified as Mitozolomide with
retention peak of 2.23, 1-4 Cyclohexadiene with retention peak of 2.54, Thymol with
retention peak of 4.08 and 4 Hydroxy, 3 methyl acetophenone with retention peak of
4.14 (Fig. 3.36)
Chapter 3 Results
112
Fig. 3.35 The GC analysis of n-hexane fraction of Trachyspermum ammi seeds
showing four major peaks i.e. at 2.23, 2.54, 4.08 and 4.151 minutes.
Chapter 3 Results
113
a)
b)
Fig. 3.36 a) Mass spectral analysis of peaks with retention time of 2.23 minutes
which was identified as 4—Cyclohexadiene by comparing it with NIST 02 spectral
library b) Mass spectral analysis of peaks with retention time 2.54 minutes which was
identified as Mitozolomide by comparing it with NIST 02 spectral library
Chapter 3 Results
114
c)
d)
Fig. 3.36 c) Mass spectral analysis of peaks with retention time of 4.08 minutes
which was identified as Thymol by comparing it with NIST 02 spectral librar. d) Mass
spectral analysis of peak with retention time of 4.151 minutes which was identified as
4 Hydroxy, 3 methyl acetophenone by comparing it with NIST 02 spectral library.
Chapter 3 Results
115
3.5.5 Characterization of Plant Extract Loaded Alginate Coated Chitosan
Nanoparticles
Thymol, one of the constituent of T. ammi hexane fraction, has been reported earlier as
a strong antibacterial agent. But due its hydrophobic nature it is difficult to administer
orally in poultry for control of C. jejuni, and furthermore its activity is reduced in
chicken gut as it is degraded at acidic pH of chicken gizzard. To overcome this problem,
alginate coated chitosan nanoparticles were successfully prepared for intestinal delivery
of plant extract (hexane fraction) and results of their morphological characterization
(scanning electron microscopy and atomic force microscopy), composition (fourier
transform infrared spectroscopy), release profile, encapsulation efficiency and
cytotoxicity are as follows.
3.5.5.1 Scanning Electron Microscopy
Scanning electron microscopy (SEM) analysis was done to study the morphology and
size of the nanoparticles. Our results showed that all the prepared nanoparticle i.e.,
empty chitosan nanoparticles (CNP), alginate coated chitosan nanoparticles (CANP),
plant extract loaded chitosan alginate nanoparticles (PE-CANP) were less than 100 nm
in size (Fig. 3.37).
Both empty chitosan nanoparticles (CNP) and alginate coated chitosan nanoparticles
(CANP) were homogenous as compared to plant extract loaded chitosan alginate
nanoparticles (PE-CANP) in which some aggregates as visible. With encapsulation of
plant extract the average size of alginate coated chitosan nanoparticle increase from
54.68nm to 68.78nm.
Chapter 3 Results
116
a)
b)
Chapter 3 Results
117
c)
Fig. 3.37 Scanning Electron Microscopy (SEM) images of a) empty chitosan
nanoparticles (CNP) b) alginate coated chitosan nanoparticles (CANP) c) plant extract
loaded chitosan alginate nanoparticles (PE-CANP) showing that the size of the
nanoparticles was below 100nm and nanoparticles were evenly distributed
Chapter 3 Results
118
3.5.6.2 Atomic Force Microscopy
The 3D imaging of empty chitosan nanoparticles (CNP), alginate coated chitosan
nanoparticles (CANP), plant extract loaded chitosan alginate nanoparticles (PE-CANP)
by Atomic Force Microscopy (AFM) revealed that all nanoparticles were
homogenously distributed. The maximum height of chitosan nanoparticle (47nm)
increased with alginate coating (57nm) and encapsulation of plant extract (73nm), thus
verifying the similar trend observed in SEM results (Fig. 3.38 a-c).
3.5.6.3 Encapsulation Efficiency
The encapsulation efficiency (EE) of PE-CANP nanoparticles was estimated to be 85%
% which showed that a very high amount of plant extract was loaded in the alginate
coated chitosan nanoparticles.
3.5.6.4 Cytotoxicity Assay
To assess the cytotoxicity of CNP, CANP and PE-CANP nanoparticles towards SH-
SY5Y cells, MTT [3-(4, 5-Dimethylthiazol-2yl)-2, 5-Diphenyltetrazolium Bromide]
assay was used. Results showed that all the tested nanoparticles reduced the cell
viability to some extent, but it was not significant (Fig. 3.39).
3.5.6.5 pH Dependent Release Profile
The release of plant extract at acidic pH (3.0) and neutral pH (7.0) by PE-CANP was
study for the period of 24 h. to determine its behavior at physiological pH of chicken
crop and colon respectively. At pH 7.0, PE-CANP released plant extract at a very fast
rate in the first 4h (i.e. 40% of plant extract was released) after which it become steady
reaching a maximum of 55% after 24h showing control release. However, insignificant
amount of plant extract (10%) was releases at acidic pH of 3.0 (Fig. 3.40).
Chapter 3 Results
119
a)
b)
c)
Fig. 3.38 Atomic force microscopic images showing surface topography and 3-
Dimensional (3D) structures of a) Chitosan nanoparticle (CNP) b) Alginate coated
chitosan nanoparticles (CANP) c) Alginate coated chitosan nanoparticle loaded with
plant extract (PE-CANP). All nanoparticles were homogenously distributed.
Chapter 3 Results
120
Fig. 3.39 Cytotoxicity assay of plant extract (PE), empty alginate coated chitosan
nanoparticles (CANP) and plant extract loaded chitosan alginate nanoparticles (PE-
CANP) using Human neuroblastoma cells (SH-SY5Y). Untreated cells were used as
negative controls.
Fig. 3.40 pH dependent release profile showing percentage release of plant extract
from Alginate coated chitosan nanoparticles (PE-CANP) at acidic (3.0) and neutral
(7.0) pH. At neutral pH plant extract at a very fast rate in the first 4h, however
insignificant amount of plant extract was released at acidic pH.
Chapter 3 Results
121
3.5.6.6 Fourier-Transform Infrared Spectroscopy Analysis (FTIR)
In the FTIR spectra of plant extract (PE), empty alginate coated chitosan nanoparticles
(CANP) and plant extract encapsulated chitosan alginate nanoparticles (PE-CANP) are
shown in Fig. 3.42 (a-c). Plant extract (PE) spectra showed medium grade peaks at
2917 and 2856 corresponding to C-H stretching of alkane. Two strong peaks
representing C=C stretching of aromatic ring were observed at 1566 and 1599 cm-1.
Peaks at 1382, 1150 and 795 cm-1 correspond to C-H stretching of alkane, C-O
stretching (alcohol or phenol) C-H bending of alkene respectively (Fig. 3.41 a).
In the FTIR spectra of Alginate coated chitosan nanoparticles (CANP) following peaks
were observed i.e., 3444, 2927, 2858, 1654, 1388, 1021, and 700 cm-1 that correspond
to O-H stretching (representing alcohol or phenol), CH stretching of alkanes, -C=C-
stretch of alkynes, C=N stretching, alkyl amine, CH bending of alkene respectively
(Fig. 3.41 b).
The FTIR spectra plant extract encapsulated chitosan alginate nanoparticles (PE-
CANP) showed peaks observed in both CANP and PE spectra. Peaks at 3418 (O-H
stretching), 2919 (CH stretching of alkanes), 2855 (CH stretching of alkanes), 1645 (-
C=C- stretch of alkynes), 1379 (C=N stretching), 1083 (C-O stretching of alcohol or
phenol) and 541 (CH stretching of alkene) were similar to those observed in CANP
representing the same functional groups. The peaks in PE-CANP spectrum at 1547
(C=C stretching of aromatic ring), 1154(C-O stretching of alcohol or phenol), 799 cm-
1 (C-H bending of alkene) were also observed in plant extract (PE) with a slight shifting
in their spectral position (Fig. 3.41 c). The results indicated that plant extract is
completely encapsulated in alginate coated chitosan nanoparticle (CANP).
Chapter 3 Results
122
a)
b)
Chapter 3 Results
123
c)
Fig. 3.41 Fourier-transform infrared spectroscopy analysis showing spectra of a)
Plant extract (PE) b) Alginate coated chitosan nanoparticles (CANP) c) Alginate coated
chitosan nanoparticle loaded with plant extract (PE-CANP).
Chapter 3 Results
124
3.5.7 In-vivo Trial in Chicken
In-vivo trial in chicken was done to test the effectiveness of the prepared plant extract
loaded alginate coated chitosan nanoparticles. Significant reduction in CFU count of C.
jejuni in fecal sample at, 7th day of infection, was observed among all treated groups
i.e., 1.5 log reduction in CANP group (empty alginate coated nanoparticles as feed
additive) (student’s t-test; P<0.01),4 log in PE group (Plant extract as feed additive)
(student’s t-test; P <0.005), 2 log reduction in PE-CANP (Plant extract encapsulated
alginate coated chitosan nanoparticles as feed additive) (student’s t-test; P<0.01) as
compared to control group (with no feed additive). After 14-day post infection the CFU
count/g in fecal sample remained the same in CANP group, whereas it increased by 1.5
logs (of CFU count/g in fecal sample) in case of PE-CANP group and by 3 logs in PE
group (Fig. 3.42). No significant change in feed to gain ratio (FCR) was observed
among all group at both 7 and 14th day of sampling (Fig. 3.43).
At day 21st post infection the chickens were euthanized, and caecum samples were
collected. The CFU counts per gram of caecal content was recorded in each group
which showed that the CFU count/g reduced by 4 log in CANP group (student’s t-test;
P<0.01), 1.5 log in PE group (student’s t-test; P<0.05,) and maximum reduction was
observed in PE-CANP group i.e., by 6 log (student’s t-test; P<0.005) (Fig. 3.44). No
significant change in feed to gain ratio (FCR) was observed among all group at 21st day
of sampling (student’s t-test; P>0.05) (Fig. 3.45).
Chapter 3 Results
125
Fig. 3.42 Log reduction in C. jejuni CFU/g of chicken fecal samples at day 7 and
14 post infection in CANP (empty alginate coated chitosan nanoparticles), PE group
(Plant extract as feed additive), PE-CANP (Plant extract encapsulated alginate coated
chitosan nanoparticles as feed additive). Significant reduction at 7 and 14-day post in
CFU count/g in fecal sample was observed as compared to untreated control group.
(student’s t-test; ***P<0.005, **P<0.01).
Fig. 3.43 Average feed to gain ratio of chickens at day 7 and 14 post infection in
CANP group (empty alginate coated chitosan nanoparticles), PE group (Plant extract
as feed additive), and PE-CANP group (Plant extract encapsulated alginate coated
chitosan nanoparticles as feed additive). No significant change in feed to gain ratio
(FCR) was observed at both 7 and 14th day of sampling.
Chapter 3 Results
126
Fig. 3.44 Log reduction in C. jejuni CFU/g of chicken caecum at day 21st post
infection in CANP (empty alginate coated chitosan nanoparticles), PE group (Plant
extract as feed additive), PE-CANP (Plant extract encapsulated alginate coated chitosan
nanoparticles as feed additive), and Control group (with no feed additive) (student’s t-
test;*P<0.05, **P<0.01, ***P<0.005).
Fig. 3.45 Average feed to gain ratio of chickens at day 7 and 14 post infection in
CANP group (empty alginate coated chitosan nanoparticles), PE group (Plant extract
as feed additive), and PE-CANP group (Plant extract encapsulated alginate coated
chitosan nanoparticles as feed additive), Control group (with no feed additive). No
significant change in feed to gain ratio (FCR) was observed (student’s t-test; P>0.05)
(Fig. 3.45).
Chapter 3 Results
127
3.6 Metallic Nanoparticle as Control of C. jejuni Biofilms
C. jejuni persist in harsh environment i.e. food processing plant and water, for relatively
longer periods due to its ability of surface attachment and biofilms formation (Buswell
et al., 1998; Kalmokoff et al., 2006). In the present study the anti-campylobacter and
anti-biofilm activity of three different metal oxide nanoparticles was evaluated i.e.,
TiO2 based, Ferrite based and Zinc Oxide for their potential application as coating
material in food processing units.
3.6.1 TiO2-Ag-Graphene Nanocomposites
3.6.1.1 Minimal Inhibitory Concentration
Doping of both silver (Ag-TiO2) and Silver-Graphene (Ag-Graphene-TiO2) composites
increased the anti-campylobacter activity of TiO2 nanoparticles as indicated by a
decrease in MIC from 1 µg/ml to 0.1 and 0.01 µg/ml respectively. Silver-Graphene-
TiO2 composites were found to be most effective against C. jejuni as indicated by the
lowest MIC value i.e., 0.01 µg/ml.
3.6.1.2 Cell Survival
Cell survival assay of C. jejuni in response to exposure to TiO2, Ag-TiO2, Graphene-
TiO2 and Silver-Graphene-TiO2 composites showed that viable cell count (CFU)
decreased in response to exposure to all these nanoparticles (Fig. 3.46). TiO2
nanoparticles exposure resulted in 1 log reduction in viable bacterial colonies compared
to that of 1.5 log reduction in response to Silver/TiO2 and TiO2/Graphene
nanocomposites exposure. Silver-Graphene-TiO2 composites were most lethal of all the
nanoparticles, indicated by a 2-log reduction in CFU count of C. jejuni.
3.6.1.3 Hydrophobicity and Auto-aggregation
Auto aggregation of C. jejuni decreased significantly when exposed to sub lethal doses
of Silver doped TiO2 (Ag-TiO2) (student’s t-test; P<0.01) and Silver-Graphene-TiO2
composites (student’s t-test; P<0.005), whereas TiO2, and Graphene-TiO2 had no effect
on auto aggregation (Fig. 3.47). A significant decrease in hydrophobicity of bacterial
cell was observed after silver-Graphene-TiO2 composites exposure.
Chapter 3 Results
128
Fig. 3.46 Influence of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG) and
Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles on the growth of C. jejuni. Untreated
bacterial cells were used as control.
Fig. 3.47 Effect of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG) and
Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles on hydrophobicity and aggregation of
C. jejuni. Untreated bacterial cells were used as control. Silver doped TiO2 (Ag-TiO2)
and Silver-Graphene-TiO2 composites caused significant reduction in hydrophobicity
and aggregation (student’s t-test; **P<0.01, ***P<0.005).
Chapter 3 Results
129
3.6.1.4 Motility Assay
Exposure to all the TiO2 based nanoparticles lead to decrease in bacterial motility. More
than 60% reduction in motility was observed in the presence of Silver doped TiO2 (Ag-
TiO2) (student’s t-test; P<0.005) and Silver-Graphene-TiO2 composites (student’s t-
test; P<0.005) compared to strong migration in control (Fig. 3.48).
3.6.1.5 DNA and Protein Leakage
To study the mechanism of action of Silver-Graphene-TiO2 composites cytoplasmic
leakage assay was done. The results showed that both DNA and proteins were released
from C. jejuni cells in response to exposure of lethal dose of Silver-Graphene-TiO2
composites as shown in Fig. 3.49.
3.6.1.6 Anti-biofilm Activity
Biofilm formation was significantly decreased in response to all TiO2 based
nanoparticles. Silver-Graphene-TiO2 composites (student’s t-test; P<0.005) resulted in
a 4-fold reduction in biofilm formation (Fig. 3.50).
3.6.1.7 Cytotoxicity Assay
Cytotoxicity of all TiO2 based nanoparticles was studied against Human neuroblastoma
cell line (SH-SY5Y). Although slight variation in cell viability was observed between
the different type of nanoparticles and no significant cytotoxicity was observed as the
percentage viability for all the samples were well above 70% (Fig. 3.51).
Chapter 3 Results
130
Fig. 3.48 Effect of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG) and
Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles on C. jejuni motility. Untreated
bacterial cells were used as control. All nanoparticles significantly reduced the
motility of C. jejuni (student’s t-test; *P<0.05, **P<0.01, ***P<0.005).
Fig. 3.49 Inhibition of biofilm activity of C. jejuni by TiO2, TiO2-graphene
(TiO2/GR), Ag-TiO2 (TiO2/AG) and Ag/TiO2-graphene (TiO2/GR/AG nanoparticles.
All nanoparticles significantly reduced biofilm formation in C. jejuni (student’s t-test;
**P<0.01, ***P<0.005).
Chapter 3 Results
131
Fig. 3.50 Leakage of DNA and protein in response to 2 and 4 h exposure of
Ag/TiO2-graphene (TiO2/GR/AG nanoparticles) expressed in terms of cytoplasmic
leakage index. Untreated bacterial cells were used as control. Both DNA and proteins
were released from C. jejuni cells in response to exposure of lethal dose of Silver-
Graphene-TiO2 composites.
Fig. 3.51 Cytotoxicity of TiO2, TiO2-graphene (TiO2/GR), Ag-TiO2 (TiO2/AG)
and Ag/TiO2-graphene (TiO2/GR/AG) nanoparticles towards Human neuroblastoma
cells (SH-SY5Y). Untreated cells were used as control. No significant cytotoxicity was
observed
Chapter 3 Results
132
3.6.2 Erbium doped Lithium Nickel Ferrite Nanoparticles
3.6.2.1 Minimal Inhibitory Concentration
The broad spectrum antibacterial activity of different size erbium doped Li-Ni ferrite
nanoparticles was evaluated against clinical multidrug resistant strains of V. cholerae,
enteropathogenic E. coli, S. aureus, and C. jejuni. Minimum inhibitory concentration
of nanoparticles increased with increase in size of nanoparticles (R≥0.83) against all
test bacteria (Fig. 3.52). The effect of size dependency was most pronounced against C.
jejuni (R=0.997). The MIC of the smallest size erbium doped Li-Ni ferrite nanoparticles
i.e., 24 nm was measured to be 0.0162, 0.0162, 0.0625 and 0.0312 mg/ml for C. jejuni,
V. cholera, EPEC and S. aureus respectively.
3.6.2.2 Cell Survival
To further investigate the effect of erbium doped Li-Ni ferrite nanoparticles (24 nm) on
cell viability survival assay was done which showed that viable cell count (CFU) of C.
jejuni decreased in response to exposure of nanoparticles by 2.5 log reduction in CFU
(Fig. 3.53) (student’s t-test; P<0.01)
3.6.2.3 DNA and Protein Leakage
To study the mechanism of action of erbium doped Li-Ni ferrite nanoparticles
cytoplasmic leakage assay was done. The results showed that both DNA and proteins
were released from C. jejuni cells in response to exposure of lethal dose of erbium
doped Li-Ni ferrite as shown in Fig. 3.54.
3.6.2.4 Motility Assay
Exposure to erbium doped Li-Ni ferrite nanoparticles didn’t affected the motility of C.
jejuni cells as no difference in zone of motility was observed.
Chapter 3 Results
133
Fig. 3.52 Size dependent antibacterial activity of Erbium doped Li-Ni ferrite
nanoparticles shown in terms of Minimum inhibitory concentration (MIC).
Fig. 3.53 Influence of Erbium doped Li-Ni ferrite nanoparticles on the growth of
C. jejuni. Untreated bacterial cells were used as control. C. jejuni growth (CFU /ml)
was significantly decreased in response to exposure of nanoparticles (student’s t-test;
P<0.01).
Chapter 3 Results
134
Fig. 3.54 Leakage of DNA and protein in response to 2 and 4 h exposure of
Ag/TiO2-graphene (TiO2/GR/AG nanoparticles) expressed in terms of cytoplasmic
leakage index. Untreated bacterial cells were used as control. Both DNA and proteins
were released from C. jejuni cells in response to exposure of lethal dose of erbium
doped Li-Ni ferrite.
Chapter 3 Results
135
3.6.2.5 Anti-biofilm Activity
Anti-biofilm activity of erbium doped Li-Nickel ferrite was evaluated using micro titer
well plate method which showed that biofilm formation of C. jejuni was greatly reduced
by more the 3 folds as indicated in Fig. 3.55 (student’s t-test; P<0.005).
3.6.2.6 Cytotoxicity Assay
Cytotoxicity assay of different sized erbium doped Li-Nickel ferrite nanoparticles
against Human neuroblastoma cell line (SH-SY5Y) showed that no significant
cytotoxicity was observed as the percentage viability of cells exposed to all the different
sized Erbium doped Lithium Nickel ferrite nanoparticle (3.56).
Chapter 3 Results
136
Fig. 3.55 Inhibition of biofilm activity of C. jejuni by erbium doped Li-Ni ferrite
nanoparticles. Untreated bacterial cells were used as control. Biofilm formation of C.
jejuni was greatly reduced in response to erbium doped Li-Ni ferrite nanoparticles
treatment (student’s t-test; P<0.005).
Fig. 3.56 Cytotoxicity of different sized erbium doped Li-Ni ferrite nanoparticles
towards Human neuroblastoma cells (SH-SY5Y). Untreated cells were used as control.
No significant cytotoxicity was observed.
Chapter 3 Results
137
3.6.3 Zinc Oxide Nanoparticles
3.6.3.1 Minimal Inhibitory Concentration
ZnO nanoparticles were tested for its broad spectrum antibacterial activity against three
gram-negative bacteria (Enteropathogenic E. coli, C. jejuni and V. cholera), and a
gram-positive bacterium (methicillin resistant Staphylococcus aureus). The results
showed that NPs were effective against all tested microorganism (3.57). However, the
ZnO nanoparticles were most effective against C. jejuni as shown by lowest MIC of
0.156mM as compared to other bacteria i.e., Enteropathogenic E. coli (0.156mM), V.
cholerae (MIC = 0.312mM) and S. aureus (0.625mM).
3.6.3.2 Cell Survival
To investigate the effect of ZnO nanoparticles on cell viability survival assay was done.
Results showed that viable cell count (CFU) of C. jejuni decreased by 2 logs in response
to exposure of 4h to ZnO nanoparticle (Fig. 3.58) (student’s t-test; P<0.01).
3.6.3.3 Anti-biofilm Activity
Anti-biofilm activity of ZnO nanoparticles was evaluated using micro titer well plate
method which showed that biofilm formation of C. jejuni was greatly reduced by 4
folds as indicated in Fig. 3.59 (student’s t-test; P<0.005).
3.6.3.4 Cytotoxicity Assay
Cytotoxicity of ZnO nanoparticles was studied against Human neuroblastoma cell line
(SH-SY5Y). No significant cytotoxicity was observed as the percentage viability of
cells exposed to all tested nanoparticle (Fig. 3.60).
Chapter 3 Results
138
Fig. 3.57 Determination of Minimum Inhibitory Concentration of ZnO
nanoparticles using tetrazolium chloride based micro-dilution method. The
nanoparticles were most effective against C. jejuni as shown by lowest MIC of
0.156mM.
Fig. 3.58 Influence of ZnO nanoparticles on the growth of C. jejuni. Untreated
bacterial cells were used as control. C. jejuni growth (CFU /ml) was significantly
decreased in response to exposure of nanoparticles (student’s t-test; P<0.01).
Chapter 3 Results
139
Fig. 3.59 Inhibition of biofilm activity of C. jejuni by ZnO nanoparticles.
Untreated bacterial cells were used as control. Biofilm formation of C. jejuni was
greatly reduced in response to ZnO nanoparticles treatment (student’s t-test; P<0.005).
Fig. 3.60 Cytotoxicity of ZnO nanoparticles towards Human neuroblastoma cells
(SH-SY5Y). Untreated cells were used as control. No significant cytotoxicity was
observed.
Chapter 4 Discussion
140
Chapter 4
Discussion
Chapter 4 Discussion
141
Globally, diarrhoea is considered as the second leading cause of death among children
less than five years of age. Diarrhoea alone is responsible for death of 2,195 children
per day which is far more compared to that caused by AIDS, malaria, and measles
combined (Wardlaw et al., 2010). Approximately 80% of the child mortalities due to
diarrhoeal illness occur in South Asia and Africa (Wardlaw et al., 2010). In Pakistan
the annual mortality due to diarrhoea has been estimated to be 55,500 among children
(GDB, 2017). Campylobacter jejuni is one of the four main global causes of diarrhoeal
diseases and is recognized as the most common cause of bacterial associated acute
diarrhoea (WHO, 2012; Platts-Mills et al., 2015).
C. jejuni has been classified by ‘WHO’ as “High priority pathogens” due to emergence
of multidrug resistance, thus making surveillance necessary for the control of disease
(WHO, 2017b). The prevalence of multidrug resistance isolates of C. jejuni has been
under reported in developing countries like Pakistan, as compared to developed
countries, due to lack of proper surveillance program. The first aim of the present study
was to determine the prevalence of C. jejuni, its antimicrobial resistance profiling and
trace the potential sources of transmission of C. jejuni isolated from human clinical
cases in Pakistan. In our study C. jejuni was found to be present in 82 samples (n=150)
indicating a relative very high isolation rate of 54.6% compared to previously reported
rates in Pakistan of 11.3-29.5% during the period of 1993-2013 (Khalil et al., 1993; Ali
et al., 2003; Ibrahim et al., 2004; Siddiqui et al., 2015a). Overall 75% of isolates were
resistant to more than eight of the antibiotics. This increase in prevalence of C. jejuni
could be attributed to many reasons including the increase in antibiotic resistant strains
in the population in the past few years. To validate this hypothesis, we compared the
antibiotic resistance profile of C. jejuni to that of previously reported isolates from our
laboratory in year 2011-2012 (Siddiqui et al., 2015a). The results indicated an increased
rate of resistance to all the tested antibiotics. The percentage of resistant isolates to
ampicillin increased from 40% to 96%, streptomycin from 53% to 91%, ciprofloxacin
20% to 69%, erythromycin 27% to 96%, tetracycline 27% to 87%, sulphomethoxazole
+ trimethoprin 40% to 87%, gentamycin from 7% to 79%, chloramphenicol 20% to
36% and nalidixic acid 13% to 79% (Siddiqui et al., 2015a). Poultry related C. jejuni
isolates have earlier been reported to show higher resistance to antibiotics due to their
indiscriminate use as a growth promoter used in livestock feed (Thomas et al., 1998;
Chapter 4 Discussion
142
Luangtongkum et al., 2009). The high resistance profile observed in this study is
relatively similar to those reported in poultry isolates, as compared to earlier reported
clinical isolates, suggesting the possible transmission of such isolates from poultry to
humans (Wardak et al., 2007; Siddiqui et al., 2015b; Nguyen et al., 2016; Nisar et al.,
2017).
Antibiotics belonging to β-Lactams class have been used as preferable therapy due to
their high efficacy and low toxicity to humans (Wang et al., 2017). The choice of β-
Lactams is reduced to carbapenem when infections are caused by extended-spectrum
β-Lactamase (ESBL) producing organisms (Paterson et al., 2004; Vardakas et al.,
2012). Such extended-spectrum β-Lactamase (ESBL) producing isolates have also been
reported in C. jejuni but studies so far none have reported to be resistant to carbapenem
(Siddiqui et al., 2015a). In the present study 7.3% C. jejuni were found to show
resistance to Imipenem (member of carbapenem family) by combined disk method and
PCR based methods. This is the first report on emergence of Imipenem resistant isolates
among C. jejuni in clinical samples and hence may affect the treatment and subsequent
recovery among patients.
Tracing the potential source of C. jejuni infection can help develop better and effective
preventive strategies for campylobacteriosis. Genotyping of C. jejuni isolates by MLST
has been commonly employed for the clonal clustering of strains based on potential
source; however, it does not take into account genetics adaptation to specific
environment/niche. A source predictive Multiplex PCR, based on adaptive genotypes
identified by microarray analysis, has been developed by Stabler et al. (2013) to cluster
C. jejuni isolates into livestock and non-livestock groups. One of the objectives of the
current was to employ this multiplex source predictive PCR to assign strain clusters to
all the C. jejuni isolates. Overall 57.3% of the isolates belonged to C1 to C6 which
have been previously described as livestock-associated cluster comparatively 42.8% of
isolates belonging to C7 to C9 were predicted to be of non-livestock /environmental in
origin (Champion et al., 2005; Stabler et al., 2013). The MAR index is a health risk
assessment tool, used to identify whether the isolates are linked to a source with high
or low antibiotic exposure. High values indicate ‘higher-risk’ source of isolate (Davis
Chapter 4 Discussion
143
and Brown, 2016). Interestingly, in the present study isolates belonging to livestock
cluster had high MAR index (p<0.001) as compared to non-livestock suggesting
presence of more multidrug resistance among livestock origin isolates. Livestock is a
major part of agriculture sector in Pakistan and contributes a total of 11% to the
country’s agricultural gross domestic product (AGDP). However, with current farming
practices i.e. use of antimicrobials to cure and prevent disease as well as promote
growth has been extensive leading to a rise in multi-drug resistance in associated
microbiota including C. jejuni (Siddiqui et al., 2015a; Rehman et al., 2017). The
association of more resistant C. jejuni to livestock clades in the present study depicts
the ability for such strains to persist and spread, through the food chain, from animals
to human. High prevalence of antibiotic resistance and linkage of isolates, with high
MAR index, to livestock clade observed in the present study provide evidence of
possible transmission of C. jejuni from animals to human, thus posing serious health
concern.
C. jejuni is considered as a fragile microorganism outside its favorable niche or host
and lacks the usual stress response machinery present in other gut pathogen (i.e.,
Salmonella or E. coli) (Ramos et al., 2001; Park, 2002). However, it is still able to
persistence in the harsh environment such as acidic pH (in host gut and poultry
processing plants), cold and heat shocks (in poultry processing plants and in natural
water reservoirs) oxidative and nitrosative stresses (in the environment) and starvation
(in host and in environment) and is eventually transmitted via food chain to humans.
The mechanism by which C. jejuni withstand theses stresses is still unknown. Secretion
systems in many pathogenic and non-pathogenic bacteria provide selective advantage
and help withstand environmental stresses. Among all secretion system the type six
secretion system (T6SS) has been linked to virulence, inter-bacterial communication,
symbiosis, biofilm formation, antipathogenesis and environmental stress response in
many Gram-negative bacteria (Jani and Cotter 2010; Lertpiriyapong et al., 2012). The
T6SS has been recently discovered in C. jejuni and is associated with bloody diarrhoeal
cases (Harrison et al., 2014). The T6SS in C. jejuni is unique from other T6SSs as it is
seemingly not essential for bacterial survival or growth, even though it is active.
Moreover, it lacks the T6 secretion ATPase, ClpV, which is thought to provide energy
to the T6SS machinery (Bonemann et al., 2009). Little is known about the functioning
Chapter 4 Discussion
144
of T6SS in C. jejuni and its role in stress adaptation. Therefore, the second aim of the
present study was to study the role of type six secretion system in stress adaptation in
general i) by comparing biofilm formation of T6SS positive and negative isolates in
response to stresses; more specifically ii) by determining the structure and function of
Hcp protein (Hall mark protein of T6SS).
The effect of sub lethal stresses of pH (4.5), temperature (55ºC), and oxidative stress
(8mM) on motility, hydrophobicity, auto aggregation and biofilm formation of T6SS
positive and negative isolates was evaluated. Oxidative stress plays a key role in
enhancement / stimulation of biofilm formation in various bacterial species. Under
normal environmental conditions such as water and air C. jejuni faces unavoidably
harsh oxygen stress. This oxidative stress has been previously reported to enhance
sessile cells and stimulate biofilm formation (Reurer et al., 2010; Turonova et al., 2015;
Oh et al., 2016). Our results are in accordance with these studies as marked increase in
auto aggregation and hydrophobicity was observed in response to oxidative stress,
which leads to enhancement of biofilm formation in T6SS positive groups. However,
the effect of oxidative stress on auto aggregation and hydrophobicity was less
pronounced in T6SS negative group which lead to insignificant change in biofilm
formation. C. jejuni grows optimally at body temperature of human and birds i.e., 37
ºC and 42 ºC respectively. However, occurrence of C. jejuni infection in human due to
ingestion of under cooked meat and vegetables suggests its survival under heat stress.
In the present study biofilm formation was significantly more enhanced in T6SS
positive isolates as compared to T6SS negative isolates under heat stress as was
observed in case of oxidative stress. This is in accordance with the previous studies
which have shown that oxidative stress response in C. jejuni is co-regulated with that
of temperature stress via enhancement of catalase activity (Hazeleger et al., 1998). C.
jejuni, like other food borne pathogens, encounter acid stress during food
processing/preservation and in host stomach. In C. jejuni oxidative stress genes (such
as dps, sodB, trxB, and ahpC) also help it to survive under acidic stress (Birk et al.,
2012). In our study the biofilm formation was enhanced in both T6SS positive and
negative isolates as under acidic pH (4.5) stress. However, this sub lethal stress doesn’t
seem to cause any differential effect on any of the studied properties among T6SS
positive and negative groups. T6SS has been known to be down regulated under acidic
Chapter 4 Discussion
145
pH which can be reason that no difference in biofilm formation under acidic pH was
observed among T6SS positive and negative strains (Siddiqui et al., 2015b). To test this
hypothesis the structure and function of hemolysin co-regulatory protein (Hcp) as
secretory effect and role in biofilm formation was evaluated along with its virulence
potential.
Of the 13 core T6SS proteins, the hemolysin coregulated protein (Hcp) is considered
the hallmark of a functional system. Hcp is essential for both T6SS assembly and
function, with roles as structural and effector proteins (Mougous et al., 2006; Hood et
al., 2010; Lim et al., 2015). Many gram-negative bacteria possess more than one type
of Hcp that encodes either a structural or an effector protein; however, C. jejuni has
only one Hcp protein proposed to play both functions (Zhou et al., 2012). Functional
studies have shown that Hcp in C. jejuni mediates in vivo colonization by enhancing
adhesion and invasion into the eukaryotic host cell and providing resistance to bile salts
and deoxycholic acids (Lertpiriyapong et al., 2012; Bleumink-Pluym et al., 2013).
Furthermore, it enhances contact-dependent hemolysis (Bleumink-Pluym et al., 2013).
Previous functional studies on Hcp in C. jejuni have used Hcp mutant strains to shut
down T6SS functioning. Therefore, it is difficult to analyze the potential effector role
of Hcp based on previous findings. Six crystal structures of Hcp have been determined
to date, sharing overall similar hexametric ring architecture but varying greatly in their
functional ability (Mougous et al., 2006; Osipiuk et al., 2011; Douzi et al., 2014; Lim
et al., 2015; Jobichen et al., 2015; Ruiz et al., 2015) In the present study crystal structure
of Hcp-Cj along with its role in virulence and biofilm formation was determined. Hcp-
Cj showed limited sequence identity with the six other structurally characterized Hcp
proteins. However, structural alignment of Hcp-Cj shows a common hexameric ring
structure, with RMSD values between 1.9 Å and 4.8 Å. The main differences in the
secondary structures are the number of β sheets, the presence/absence of a one-turn α
helix, and the presence of overhang loops L1, 2 and L2, 3 which vary greatly in length
and composition (Noreen et al., 2018). Most of the conserved amino acids are located
on the external side of the ring and are exposed, whereas the residues in the inner
side/channel of the ring are more varied. Diversity among the different Hcp sequences,
especially in the inner side of the ring, suggests that these bacteria secrete different
proteins with different effector functions likely in response to different signals (Osipiuk
Chapter 4 Discussion
146
et al., 2011).Through these structural analyses, we show that Hcp-Cj belongs to Hcp
protein subclass II, along with Hcp3 of Pseudomonas aeruginosa, and that the
remaining Hcps with resolved structures belong to subclass I (Osipiuk et al., 2011).
Hcp protein in some bacteria e.g. P. aeruginosa V. cholerae, A. hydrophila, and B.
pseudomallei has been associated with providing selective advantage to bacteria by
killing other competing bacteria. In this study; Hcp-Cj was found to have no cytotoxic
effect on prokaryotic cells which is in accordance with previous functional assays, with
no selective growth advantage noted for the C. jejuni 108 strain in the presence of a
functional T6SS system (Bleumink-Pluym et al., 2013). Hcp in different bacteria are
associated with eukaryotic cell lysis and death (Suarez et al., 2007; Hood et al., 2010;
Zhou et al., 2012). Therefore, we next examined the effect of secreted Hcp-Cj protein
on the viability of red blood cells (RBC) and our results showed that Hcp-Cj was unable
to induce hemolysis in sheep erythrocytes. Although previous reports showed that the
presence of Hcp enhances the hemolytic ability of T6SS harboring C. jejuni, this
activity was not shown using culture supernatant, and suggests perhaps a contact-
dependent structural role of Hcp (Bleumink-Pluym et al., 2013). However, in the
present study, exposure of recombinant Hcp-Cj to HepG2 cells caused a significant
reduction in cell viability, suggesting a cytotoxic function. Furthermore, a structure-
based, point mutation in Hcp-Cj at Arg30 (Arg30Ala) resulted in a significant increase
in cell viability (P<0.01) as compared to recombinant-type Hcp-Cj, indicating the
importance of the loop region in inducing cytotoxicity (Noreen et al., 2018). Previous
studies have shown that the T6SS-positive C. jejuni 108 strain was unable to cause cell
lysis of Caco-2 intestinal epithelial cells, with the bacteria remaining trapped in the
endo-lysosomal compartment (Bleumink-Pluym et al., 2013; Bouwman et al., 2013).
The cytotoxicity observed in the present study may reflect the function of secreted Hcp-
Cj; indeed, others have reported that secretory Hcp1 from the meningitis-causing E.
coli K1 strain (sequence identity >57% with Hcp-Cj) causes cytotoxicity in human
brain microvascular endothelial cells (Zhou et al., 2012). Therefore, it can be
hypothesized that secreted Hcp-Cj binds to the surface of HepG2 cells, thereby
triggering cell apoptosis as reported earlier (Suarez et al., 2007; Zhou et al., 2012). Hcp
plays a significant role in the motility of several bacteria; however, in this study no
Chapter 4 Discussion
147
change in the motility of C. jejuni strains was observed in response to Hcp-Cj exposure
(Das et al., 2002; Sha et al., 2013).
The T6SS enhances environmental adaptation and the survival of gram-negative
bacteria (Ho et al., 2014). Biofilm formation helps bacteria contend with harsh
environmental stressors in natural, clinical and industrials setups (Nguyen et al., 2012;
Turonova et al., 2015). The T6SS has a diverse impact on biofilm formation in various
bacteria; in some bacteria, it enhances biofilm formation (Acinetobacter baumannii;
Avian-pathogenic Escherichia coli, Acidovorax citrulli, enteroaggregative Escherichia
coli); in others, it aids in biofilm maturation (Pseudomonas fluorescens) or has no effect
(Vibrio alginolyticus) (de Pace et al., 2011; Tian et al., 2015; Gallique et al., 2017; Kim
et al., 2017). The role of T6SS in C. jejuni biofilm formation had yet to be reported,
which led us to study the effect of secretory Hcp-Cj on biofilm formation in both T6SS-
positive and -negative strains. We found that the establishment of biofilm was
independent of the presence or absence of Hcp-Cj in both strains. However, the volume
of biofilm formation was significantly enhanced in all C. jejuni isolates (P < 0.01). The
effect of Hcp-Cj exposure and the reduction in biofilm formation was more pronounced
in T6SS-positive isolates as compared with T6SS-negative isolates (P < 0.05). This is
likely because all the T6SS-positive strains were weak biofilm formers in the absence
of Hcp as compared to T6SS-negative strains. A change in biofilm formation was
observed in HcpR30A and HcpY31A mutants as compared to recombinant-type Hcp-
Cj; however, this difference was not statistically significant. The T6SS in many bacteria
is known to be involved in biofilm formation but the mechanistic bases have not been
described yet. Hcp has been recently shown to be secreted and accumulation in sister
cells in a manner similar to auto-inducer accumulation in quorum sensing (Vettiger and
Basler, 2016; Gallique et al., 2017). Hcp-Cj may possibly act in the same way as auto-
inducers for biofilm formation, however; additional experiments are required to
validate this hypothesis (Noreen et al., 2018).
Infections caused by C. jejuni in humans are generally self-limiting and the
administration of antibiotics in required only in children and immune-compromised
patients. However, extensive use of antibiotics especially in poultry has led to
emergence of multidrug resistant C. jejuni among both chicken and clinical samples
Chapter 4 Discussion
148
(Moore et al., 2006; Kittl et al., 2011; FoodNet, 2012). C. jejuni strains resistant to the
two-recommended drugs of choice i.e., erythromycin and ciprofloxacin have been
reported from various parts of the world (Sharma et al., 2003; Moore et al., 2006;
Feizabadi et al., 2007; Mattheus et al., 2012; Siddiqui et al., 2015a). Such resistant
strains not only delay the recovery process but also lead to increase in possibility of
sequels. Therefore the third aim of the present study was to develop control strategies
which can provide alternate solution at three different levels i.e., 1) in-silico drug target
identification for development of drug against MDR C. jejuni in future, 2) nano-carrier
based targeted delivery of natural anti-campylobacter products as an on-farm control
strategy to reduce load of C. jejuni among chicken and 3) metallic nanoparticles as a
coating material for control of C. jejuni biofilms.
New antibiotics/drugs development process is costly, laborious and eventually lead to
development of resistance in bacteria against them (Katz et al., 2006; Nicolle, 2006).
An alternate strategy is to identify novel and essential drug target which are important
for survival of pathogenic bacteria as such genes have high rate of evolutionary
conservation (Rocha and Danchin, 2003; Gustafson et al., 2006; Deng et al., 2011).
Computational analysis of the available genomics, proteomes, microarray, and
metabolomics data of the specific pathogen is done to identify and characterize unique
and essential protein targets sites (Zhang et al., 2005). The present study uses a
combination of subtractive proteomics and comparative metabolic pathway analysis
approach to identify potential drug targets in C. jejuni (11168) which may lead to
development of novel and highly specific drugs to control infections with least side
effects on host (Barh and Kumar, 2009; Rathi et al., 2009; Butt et al., 2012; Ahn et al.,
2014). Overall 10 proteins were shortlisted as the most potential drug targets which are
not only essential for the survival of C. jejuni but also share no homology to human and
chicken proteomes. Furthermore, with least homology to human gut flora these targets
will help to develop more specific and effective drug with minimum side effects on
human health (Raman et al., 2008; Shanmugham and Pan, 2013).
Human campylobacteriosis can mainly originate through consumption of undercooked
food (especially poultry meat), unpasteurized milk, contaminated water and contact
with either infected animal or person (Friedman, 2000; Domingues, 2012). Intake of
Chapter 4 Discussion
149
contaminated undercooked poultry has been considered as the major cause of
Campylobacteriosis in humans (Friedman et al., 2000). Quantitative risk assessment
has shown that 2-3 log reduction of C. jejuni load in the intestines/carcass of chickens
would lead to 90% decrease in campylobacteriosis case as it is the only amplifying
point of C. jejuni in the whole food chain (Rosenquist et al., 2003; EFSA, 2011).
Therefore, most of the approaches have been designed to control Campylobacteriosis
are targeted to reduce the load of C. jejuni in poultry, however till date, there is no safe,
effective, reliable, and practical intervention measure available to reduce C. jejuni
colonization in poultry (Lin, 2009; Ghareeb et al., 2013).
Over the past few decades there has been decreased acceptability among consumers of
administration of synthetic additives in food chain which has led to development and
use of natural antimicrobial compounds as animal feed additive (Verbeke et al., 2007;
Brenes and Roura, 2010; Navarro et al., 2015). Therefore, in the present study several
plant extracts, which are been reported to be used in traditional medicine, were screened
for their anti-campylobacter activity i.e., Berberis lycium (bark), Trachyspermum
annum (seeds), Nigella sativa (seeds), Camellia sinensis (leaves), Mentha longifolia
(leaves). Out of these plants Trachyspermum ammi showed excellent antibacterial
activity and its hexane fraction caused complete cell death of C. jejuni within 4h of
exposure. The hexane fraction was found to be composed of four major components by
GC-MS analysis i.e. Mitozolomide, 1-4 Cyclohexadiene, Thymol, and Hydroxy, 3
methyl acetophenone. Of all these compounds thymol (2-isopropyl-5-methylphenol),
which was found to be the most abundant content in hexane fraction, has been reported
earlier as a strong antimicrobial against different pathogenic bacteria as it binds to with
bacterial membrane proteins and causes cell lysis (Shah et al., 2012). Thymol is also
classified as ‘generally recognized as safe’ (GRAS) by the U.S. Food and Drug
Administration (FDA) and is also biodegradable. Therefore, thymol has wide
application in the medical, food and agricultural setups. Due to low water solubility
(hydrophobicity) it is difficult to administer orally in poultry, and furthermore the
thymol is hydrolyzed at acidic pH thereby making it impossible to reach chicken in its
100% activity form. To overcome the problem in this study, the hexane fraction of
Trachyspermum ammi was encapsulated in alginate coated chitosan nanoparticles.
Chitosan is a biodegradable polymer which has been recently used as nanocarrier
Chapter 4 Discussion
150
system due to its muco-adhesive, broad spectrum antibacterial and biocompatible
nature (Rampino et al., 2013; Chaubey and Mishra, 2014; Piras et al., 2015). Such
nanocarrier system improves the solubility, stability, metabolism, and clearance of the
encapsulated drug/moieties. Muco-adhesive property of chitosan help prolongs
residence time of drug in the intestine thus enhancing its antibacterial effect. However,
chitosan is soluble at acidic pH thus most of the drug is lost in stomach if administered
orally. Therefore, in the present study chitosan nanoparticles were coated with alginate
which is stable at acid pH. Our nanocarrier system i.e., alginate coated chitosan
nanoparticles were designed for targeted delivery of hexane fraction of T. ammi into
the chicken caecum without loss of its activity in gizzard. In the present study the plant
extract was encapsulated in chitosan nanoparticle which was then coated with alginate
and their size was confirmed using SEM and AFM. Previous studies in which alginate
coated chitosan nanoparticle have been reported to be of larger in size ranging from
213-404 nm, in contrast to this study both empty and plant extract encapsulated CANP
were less than 100 nm in diameter (Li et al., 2008; Barge et al., 2013; Wang et al.,
2017). However, the size of PE-CNP increased with the coating of alginate from
54.68nm to 68.78 nm which is in accordance with that reported by Barge et al., 2013.
FTIR spectroscopy was done to confirm the successful encapsulation of plant extract
and to study its interaction with the nanocarrier system. The FTIR spectrum for
Chitosan alginate nanoparticles (CANP) observed in the present study was in
accordance with previous studies (Körpe et al., 2014; Bhunchu et al., 2015). In case of
plant extract the spectrum resembled that of thymol as reported by Valderrama and
Rojas De (2017). The PE-CANP showed peaks corresponding to both CANP and plant
extract indicating successful encapsulation. As there was no additional peak observed
it was suggested that there was no interaction between plant extract and CANP. The
encapsulation efficiency of CANP was observed to be 85% indicating the chitosan
alginate complex as excellent encapsulation material for hydrophobic plant extract
(Natrajan et al., 2015). The in vitro release of plant extract from CANP at neutral pH
(7.0) was much faster than that at acidic pH (3.0) for the period of 24 h. At pH 7.0 initial
burst release of plant extract was observed up to 4 h (which accounts for 40% of the
total encapsulated amount) followed by a sustained release phase for the next 20 h. Less
than 12 % of the plant extract was released at acidic pH due to the fact that alginate
Chapter 4 Discussion
151
forms a tight crosslinking network at low pH (Vandenberg and De La Noue 2001; Coppi
et al., 2002;). Moreover, the reduced porosity of alginate coated chitosan nanoparticles
protects the encapsulated drug/compound thus accounting for acid environment
protection and control release in gastrointestinal tract (Katuwavila et al., 2016).
In-vivo trial in chicken showed significant reduction in CFU count of C. jejuni in fecal
sample at both 7th and 14th day of infection among all treated groups. Plant extract
initially showed 4 logs reduction in CFU/g of fecal sample at day7 post infection which
was decreased to 3 logs after 14 days. However, in case of PE-CANP (Plant extract
encapsulated alginate coated chitosan nanoparticles as feed additive) initially showed 2
log reduction which was increased to 3.5 logs after 14 days. This sustained reduction
indicates control/sustained release of plant extract from PE-CANP nanoparticles after
14 days. The blank CANP group (empty alginate coated nanoparticles as feed additive)
caused decrease in CFU/g of fecal sample but the effect remains the same after 7- and
14-day post infection indicating the intrinsic antimicrobial activity of chitosan alginate
complex (Jamil et al., 2016). Similar trend was observed after 21 days post infection in
whereby 6 logs reduction in CFU/g of caecal content was observed in PE-CANP group
whereas the efficiency of plant extract was reduced to 1.5 logs in PE group. Similar
control release of antibacterial essential oil has been reported earlier in in vitro studies;
however, this is the first study on in-vivo trail of nano-encapsulated plant extract
showing significant reduction in C. jejuni load in Chicken (Hsieh et al., 2006; Hosseini
et al., 2013; Jamil et al., 2016; Sotelo-Boyás et al., 2017).
Although C. jejuni is fastidious in nature but it possesses the ability to persist on food
and in the environment for relatively longer periods due to its ability of surface
attachment and biofilms formation (Buswell et al., 1998; Kalmokoff et al., 2006). In
poultry farms, C. jejuni adhere to door handles, utensils and other abiotic surfaces and
help transmission of bacteria from an infected flock to the next flock resulting in spread
of contamination. Similarly, biofilm formation by C. jejuni in chicken meat processing
setup also contributes towards persistence of bacteria in human food chain (Balogu et
al., 2014; Brown et al., 2014). In the present study the anti-campylobacter and anti-
Chapter 4 Discussion
152
biofilm activity of three different metal oxide nanoparticles was evaluated i.e., TiO2
based, Ferrite based and Zinc Oxide.
As most of objects/surfaces in the environment/food processing plants on which C.
jejuni form biofilm are exposed to visible light sources therefore visible-light-induced
photo catalysts can be considered as a useful coating material for disinfection.
Therefore, in the present study visible light induced Silver-Graphene-TiO2
(TiO2/Ag/Gr) and its parent derivative were evaluated for their ability to control both
growth and biofilm formation of C. jejuni. All the TiO2 based nanocomposites (TIO2,
TiO2/Ag, TiO2/Gr and TiO2/Ag/Gr showed broad spectrum antibacterial activity
against C. jejuni, V. cholerae, E. coli, and S. aureus which is in accordance with
previous studies (Maness et al., 1999). The effect of TiO2 and its derived nanoparticles
on the cell survival, membrane integrity, and cellular motility was evaluated to get an
insight into the mechanism of action against C. jejuni. Cell survival assay was carried
out against C. jejuni which showed that viable cell count (CFUs) decreased in response
to exposure of all the synthesized nanoparticles. TiO2 nanoparticles exposure resulted
in 1 log reduction in viable bacterial colonies as compared 1.5 log reduction by
Silver/TiO2 and TiO2/Graphene nanocomposites indicating that addition of Silver and
Graphene enhance the killing potential of TiO2. The enhancement in antibacterial
activity of TiO2 by addition of Silver ions can be due to reasons that (i) Ag ions directly
interacts with thiol group of vital enzymes and deactivates them (ii) Ag ions extend the
light absorption of TiO2 from UV into the visible range, indirectly inducing
photocatalytic antibacterial activity of TiO2 under visible light (Feng et al., 2000;
Harikishorea et al., 2014). Similarly, higher antibacterial effect of TiO2/Graphene
compared to pure TiO2 nanoparticles could be due to the fact Graphene not only extends
light absorption range but can also be used as electron acceptor and transporter resulting
thus producing more oxides and hydroxyl ions involved in the antibacterial activity
(Cao et al., 2013). Silver-Graphene-TiO2 composites was most lethal of all the
nanoparticles as indicated by 2 log reduction which can be contributed towards the
synergistic antibacterial effect of silver, graphene and titanium oxide. Cytoplasmic
leakage assay showed that the exposure to Silver-TiO2 and Silver-Graphene-TiO2
nanoparticles resulted in release of significant higher amount of both DNA and RNA
Chapter 4 Discussion
153
from C. jejuni cells. Similar results have been reported by Singh et al., (2016) whereby
silver nanoparticle resulted in cytoplasmic leakage in S. dysentriae.
In the present study the effect of TiO2 based nanoparticles on virulence properties of C.
jejuni i.e., autoaggregation, hydrophobicity and motility, was also investigated.
Autoaggregation and hydrophobicity are physicochemical surface properties of
pathogenic bacteria which are considered as virulence markers in virulence in several
Gram-negative bacteria (Menozzi et al., 1994; Chiang et al., 1995). Auto aggregation
plays an important role in host cell invasion and helps establish infection. In this study
autoaggregation capability of C. jejuni strain decreased significantly when exposed to
sub-lethal concentration of Silver doped TiO2 (Ag-TiO2) (p<0.01) and Silver-
Graphene-TiO2 composites (p<0.005) whereas TiO2, and Graphene-TiO2 had not effect
on auto aggregation. Hydrophobicity is another important cell surface hydrophobicity
and is positively correlated with autoaggregation (Saran et al., 2012). Silver-Graphene-
TiO2 composites exposure resulted in significant decrease in hydrophobicity of
bacterial cell thus reducing their ability to bind to host cell as well as in environment
rendering it vulnerable to host immune system and harsh environmental conditions
respectively. Motility plays a critical role in colonization of C. jejuni by allowing it to
penetrate mucus lining of gut and eventual invasion of intestinal epithelial cells. High
motility also helps bacteria to evade bile salt and the antimicrobial effect of the human
serum which may be detrimental to C. jejuni (Wassenaar et al., 1993; Guerry et al.,
2000). In the present study Silver doped TiO2 (Ag-TiO2) (p<0.005) and Silver-
Graphene-TiO2 composites decreased the motility of C. jejuni up to 60% indicating its
effect on the overall virulence potential of bacteria. Biofilm formation was significantly
decreased in response to all the synthesized nanoparticles. Silver-Graphene-TiO2
composites (p<0.005) resulted in 4 times reduction in biofilm formation.
Autoaggregation has been reported to be correlated with strength of biofilm production
(Abdel-Nour et al., 2014), similarly in our study the decrease in biofilm formation was
seen when autoaggregation was negatively affected by the nanoparticles. The present
study suggests that Silver-Graphene-TiO2 composites can be used as a safe and self-
cleaning antibacterial and coating agent to control spread of C. jejuni.
Chapter 4 Discussion
154
Ferrite nanoparticles are gaining importance as a promising candidate for the
biomedical applications such as magnetic hyperthermia (for cancer treatment), targeted
drug delivery and as antibacterial agents (Liu et al., 2000; Kim et al., 2008). Ferrite due
to its excellent magnetic properties can adhere to metallic objects and are therefore
attractive choice as coating materials in medical and food processing setup. Doping of
various transitions and rare earth metal ions at different sub lattices of the spinel lattice
not only improve the electromagnetic properties but also enhance their antibacterial
activities. Therefore, in the present study the antibacterial and anti-biofilm activity of
erbium doped Li-Ni ferrite nanoparticles was evaluated against C. jejuni. Erbium doped
Li-Ni ferrite nanoparticles showed broad spectrum activity against clinical multidrug
resistant strains of V. cholerae, enteropathogenic E. coli, S. aureus and C. jejuni. This
antibacterial activity was found to be size dependent as the minimum inhibitory
concentration of nanoparticles increased with increase in the size of nanoparticles
against all test bacteria. This suggests that the antibacterial activity is also contact
dependent because increase in the volume to surface ratio enhances the antibacterial
potency. The effect of size dependency was most pronounced against C. jejuni
(R=0.997). To study the mechanism of action of erbium doped Li-Ni ferrite
nanoparticles survival assay, motility cytoplasmic leakage assay was done. The results
showed that 2-log reduction in CFU of C. jejuni. Both DNA and proteins were released
from C. jejuni cells in response to exposure of lethal dose of erbium doped Li-Ni ferrite.
Several mechanisms of action of ferrites have been proposed which include 1) the
release of reactive oxygen species such as hydroxyl ions, peroxides and super-oxides
from ferrites, which penetrate the bacterial cell wall and cause cell death, and 2) the
penetration and release of toxic metals from nanoparticles (Velho-Pereira et al., 2015).
Our study supports both mechanism of action of ferrite. As Li-Ni ferrites was effective
against both facultative aerobic and microaerophilic bacteria suggesting that oxidative
stress is not alone responsible for the observed activity, NP might have released toxic
metals into the cell. Erbium doped Lithium-Nickel ferrite showed excellent anti-biofilm
activity against C. jejuni. This is the first report on the anti-biofilm activity of any type
of ferrites and indicates that Li-Ni can act as a good coating agent to reduce the biofilm
formation in food processing setup (Noreen et al., 2017).
Chapter 4 Discussion
155
Zinc oxide (ZnO) is s “Generally Recognized as Safe” by FDA (Food and Drug
Administration, USA) and is commonly used in food as additive (as source of zinc) or
preservative. Zinc Oxide has an intrinsic antibacterial ability which is further enhanced
by reducing their size to nanometer (less than 100nm) (Xie et al., 2011). Zinc
nanoparticles have high surface to volume ratio which increases its interaction with
bacterial cells thereby enhancing it antibacterial potential. In the present study the ZnO
nanoparticles showed broad spectrum antibacterial activities against both Gram-
positive and Gram-negative bacteria which is in accordance with the previous studies
(Jones et al., 2008; Liu et al., 2009). However, the ZnO nanoparticles were
comparatively more effective against C. jejuni having a lower MIC values (i.e., 0.156
mM) than that reported earlier (MIC=0.30 mM) (Xie et al., 2011). ZnO nanoparticles
used in the present study shown no significant cytotoxicity towards human cell line
which is in accordance with the previous reports (Reddy et al., 2007). The bactericidal
effect of ZnO nanoparticle was confirmed by decrease the viable cell count (CFU) of
C. jejuni by 2 logs within 4 h of exposure. The ZnO nanoparticles showed excellent
anti-biofilm activity against C. jejuni (4 folds reduction) at a very low concentration
(i.e., 0.078mM) as compared to a similar reduction in biofilm reported at a higher
concentration of nanoparticle (i.e., 0.30mM) (Lu et al., 2012). Therefore, the ZnO
nanoparticles evaluated in the present study can serve as an efficient antibacterial and
anti-biofilm material for control of biofilm formation of C. jejuni which will, in turn,
prevent its transmission in food chain.
4.1 Conclusions
From the present study it is concluded that i) Multidrug resistant C. jejuni strains with
high MAR index were associated with livestock sources implying the strict regulation
for use of these antibiotics as growth promoters in food animals and the veterinary
industry; ii) Secretory Hcp play a role in cytotoxicity towards eukaryotic cells and
enhances biofilm formation in C. jejuni, thereby aiding the bacterium survival in the
harsh environments; iii) Ten essential non-homologous drug targets were identified
using in silico approach which can be used in future to developed safe and effective
drug; Nano encapsulated hexane fraction of T. ammi (PE-CANP) reduced C. jejuni load
to 6 logs in chicken trial and can therefore be used as a good alternative to conventional
antibiotics; Silver/Graphene/TiO2, Li-Ni Ferrites and ZnO nanoparticle showed
Chapter 4 Discussion
156
promising antibacterial and anti-biofilm activity, thus can be used as coating material
for control of C. jejuni.
4.2 Future Prospects
Monitoring and surveillance of C. jejuni at various stages of meat production from farm
to folk can be done to track the potential stage of contamination. Structure and function
of other T6SS effectors proteins can be studied in future. To control multidrug resistant
C. jejuni screening of different drugs against the in silico identified drug targets could
be done to identify new drugs for treatment. Furthermore, testing other natural plant-
based drugs for control of C. jejuni in chicken could be done in future.
157
Chapter 5
References
158
Abadio, A. K., Kioshima, E. S., Teixeira, M. M., Martins, N. F., Maigret, B. & Felipe,
M. S. (2011). Comparative genomics allowed the identification of drug targets against
human fungal pathogens. BMC Genomics. 12, 75.
Abdel-Nour, M., Duncan, C., Prashar, A., Rao, C., Ginevra, C., Jarraud, S., Low, D. E.,
Ensminger, A. W., Terebiznik, M. R. & Guyard, C. (2014). The Legionella
pneumophila collagen-like protein mediates sedimentation, autoaggregation, and
pathogen-phagocyte interactions. Appl. Environ. Microbiol. 80, 1441-1454.
Adams, P. D., Afonine, P. V., Bunkóczi, G., Chen, V. B., Davis, I. W., Echols, N.,
Headd, J. J., Hung, L. W., Kapral, G. J., Grosse-Kunstleve, R. W., McCoy, A. J.,
Moriarty, N. W., Oeffner, R., Read, R. J., Richardson, D. C., Richardson, J. S.,
Terwilliger T.C. & Zwart, P. H. (2010). PHENIX: a comprehensive Python-based
system for macromolecular structure solution. Acta. Crystallogr. D. Biol. Crystallogr.
66, 213-221.
Ahn, Y. Y., Lee, D. S., Burd, H., Blank, W. & Kapatral, V. (2014). Metabolic network
analysis-based identification of antimicrobial drug targets in category A bioterrorism
agents. PLoS. One. 9, e85195.
Ailes, E., Demma, L., Hurd, S., Hatch, J., Jones, T. F., Vugia, D., Cronquist, A., Tobin-
D'Angelo, M., Larson, K., Laine, E., Edge, K., Zansky S. & Scallan, E. (2008).
Continued decline in the incidence of Campylobacter infections, FoodNet 1996-2006.
Foodborne Pathog. Dis. 5, 329-337.
Alfredson, D. A. & Korolik, V. (2007). Antibiotic resistance and resistance mechanisms
in Campylobacter jejuni and Campylobacter coli. FEMS Microbiol. Lett. 277, 123-132.
Ali, A. M., Qureshi, A. H., Rafi, S., Roshan, E., Khan, I., Malik, A. M. & Shahid, S. A.
(2003). Frequency of Campylobacter jejuni in diarrhoea/dysentery in children in
Rawalpindi and Islamabad. J. Pak. Med. Assoc. 53(11), 517-520.
Allos, B. M. (2001). Campylobacter jejuni Infections: update on emerging issues and
trends. Clin. Infect. Dis. 32, 1201-1206.
Alm, R. A., Guerry, P. & Trust, T. J. (1993). The Campylobacter sigma 54 flaB flagellin
promoter is subject to environmental regulation. J. Bacteriol. 175, 4448-4455.
Altschul, S. F., Gish, W., Miller, W., Myers, E. W. & Lipman, D. J. (1990). Basic local
alignment search tool. J. Mol. Biol. 215,403-410.
Alvarez-Martinez, C. E. & Christie, P. J. (2009). Biological diversity of prokaryotic
type IV secretion systems. Mol. Biol. Rev. 73, 775-808.
Amineni, U., Pradhan, D. & Marisetty, H. (2010). In silico identification of common
putative drug targets in Leptospira interrogans. J. Chem. Biol. 3, 165-173.
159
Anishetty, S., Pulimi, M. & Pennathur, G. (2005). Potential drug targets in
Mycobacterium tuberculosis through metabolic pathway analysis. Comput. Biol. Chem.
29, 368-378.
Arber, W. (2000). Genetic variation: molecular mechanisms and impact on microbial
evolution. FEMS Microbiol. Rev. 24, 1-7.
Arsi, K., Donoghue, A. M., Woo-Ming, A., Blore, P. J., & Donoghue D. J. (2015). The
efficacy of selected probiotic and prebiotic combinations in reducing Campylobacter
colonization in broiler chickens. J. Appl.Poult. Res. 24, 327-334.
Asakura, M., Samosornsuk, W., Hinenoya, A., Misawa, N., Nishimura, K., Matsuhisa,
A. & Yamasaki, S. (2008). Development of a cytolethal distending toxin (cdt) gene-
based species-specific multiplex PCR assay for the detection and identification of
Campylobacter jejuni, Campylobacter coli and Campylobacter fetus. FEMS Immunol.
Med. Microbiol. 52, 260-266.
Aschtgen, M. S., Thomas, M. S. & Cascales, E. (2010). Anchoring the type VI secretion
system to the peptidoglycan: TssL, TagL, TagP... what else? Virulence. 1, 535-540.
Bacon, D. J., Alm, R. A., Hu, L., Hickey, T. E., Ewing, C. P., Batchelor, R. A., Trust,
T. J. & Guerry, P. (2002). DNA sequence and mutational analyses of the pVir plasmid
of Campylobacter jejuni 81-176. Infect. Immun. 70, 6242-6250.
Bacon, D. J., Szymanski, C. M., Burr, D. H., Silver, R. P., Alm, R. A. & Guerry, P.
(2001). A phase-variable capsule is involved in virulence of Campylobacter jejuni 81-
176. Mol. Microbiol. 40, 769-777.
Baffone, W., Casaroli, A., Citterio, B., Pierfelici, L., Campana, R., Vittoria, E.,
Guaglianone, G. & Donelli, G. (2006). Campylobacter jejuni loss of culturability in
aqueous microcosms and ability to resuscitate in a mouse model. Int. J. Food.
Microbiol. 107, 83-91.
Balogu, T.V., Nwaugo V.O. & Onyeagba R.A. (2014). Persistence and Biofilm
Assessment of Campylobacter jejuni in Poultry Abattoir. Nigerian. Food. J. 32, 54-61.
Barer, M. R. & Harwood, C. R. (1999). Bacterial viability and culturability. Adv.
Microb. Physiol. 41, 93-137.
Barh, D. & Kumar, A. (2009). In silico identification of candidate drug and vaccine
targets from various pathways in Neisseria gonorrhoeae. In Silico Biol. 9, 225-231.
Baron, C. & Coombes, B. (2007). Targeting bacterial secretion systems: benefits of
disarmament in the microcosm. Infect. Disord. Drug. Targets. 7, 19-27.
Basler, M., Pilhofer, M., Henderson, G. P., Jensen, G. J. & Mekalanos, J. J. (2012).
Type VI secretion requires a dynamic contractile phage tail-like structure. Nature. 483,
182-186.
160
Batchelor, R. A., Pearson, B. M., Friis, L. M., Guerry, P. & Wells, J. M. (2004).
Nucleotide sequences and comparison of two large conjugative plasmids from different
Campylobacter species. Microbiology. 150, 3507-3517.
Bayliss, C. D., Bidmos, F. A., Anjum, A., Manchev, V. T., Richards, R. L., Grossier, J.
P., Wooldridge, K. G., Ketley, J. M., Barrow, P. A., Jones, M. A. & Tretyakov, M. V.
(2012). Phase variable genes of Campylobacter jejuni exhibit high mutation rates and
specific mutational patterns but mutability is not the major determinant of population
structure during host colonization. Nucleic. Acids. Res. 40, 5876-5889.
Begum, S., Sekar, M., Gunaseelan, L., Gawande, M., Suganya, G., Malar, P. A. &
Karthikeyan, A. (2015). Molecular identification of Campylobacter jejuni and coli from
chicken, calves and dogs to determine its potential threat on human being. Vet. World.
8, 1420-1423.
Benaissa, M., Babin, P., Quellard, N., Pezennec, L., Cenatiempo, Y. & Fauchère, J. L.
(1996). Changes in Helicobacter pylori ultrastructure and antigens during conversion
from the bacillary to the coccoid form. Infect. Immun. 64, 2331-2335.
Berman, H., Henrick, K., Nakamura, H. & Markley, J. L. (2007). The worldwide
Protein Data Bank (wwPDB): ensuring a single, uniform archive of PDB data. Nucleic
Acids Res. 35, D301-303.
Bhunchu, S., Rojsitthisak, P. & Rojsitthisak, P. (2015). Effects of preparation
parameters on the characteristics of chitosan–alginate nanoparticles containing
curcumin diethyl disuccinate. J. Drug Deliv. Sci. Technol. 28, 64-72.
Bièche, C., de Lamballerie, M., Federighi, M., Le Bail, A. & Tresse, O. (2010). Proteins
involved in Campylobacter jejuni 81-176 recovery after high-pressure treatment. Ann.
N. Y. Acad. Sci. 1189, 133-138.
Birk, T., Wik, M. T., Lametsch, R. & Knøchel, S. (2012). Acid stress response and
protein induction in Campylobacter jejuni isolates with different acid tolerance. BMC.
Microbiol. 12, 174.
Black, R. E., Levine, M. M., Clements, M. L., Hughes, T. P. & Blaser, M. J. (1988).
Experimental Campylobacter jejuni infection in humans. J. Infect. Dis. 157, 472-479.
Blaser, M. and Engberg, J. Clinical aspects of Campylobacter jejuni and Campylobacter
coli infections. In “Campylobacter”. I. Nachamkin, Szymanski, C., Blaser and M, 3rd
eds. ASM Press. Washington, DC., pp. 99-121(2008).
Bleumink-Pluym, N. M., van Alphen, L. B., Bouwman, L. I., Wösten, M. M. & van
Putten, J. P. (2013). Identification of a functional type VI secretion system in
Campylobacter jejuni conferring capsule polysaccharide sensitive cytotoxicity. PLoS.
Pathog. 9, e1003393.
Bolton, D. J. (2015). Campylobacter virulence and survival factors. Food Microbiol.
48, 99-108. doi:10.1016/j.fm.2014.11.017
161
Bönemann, G., Pietrosiuk, A., Diemand, A., Zentgraf, H. & Mogk, A. (2009).
Remodelling of VipA/VipB tubules by ClpV-mediated threading is crucial for type VI
protein secretion. EMBO J. 28, 315-325.
Bouwman, L. I., Niewold, P. & van Putten, J. P. (2013). Basolateral invasion and
trafficking of Campylobacter jejuni in polarized epithelial cells. PLoS One, 8, e54759.
Bratz, K., Golz, G., Janczyk, P., Nockler, K. & Alter, T. (2015). Analysis of in vitro
and in vivo effects of probiotics against Campylobacter spp. Berl. Munch. Tierarztl.
Wochenschr. 128, 155-162.
Brenes A., & Roura E. (2010). Essential oils in poultry nutrition: main effects and
modes of action. Anim. Feed. Sci. Technol., 158, 1-14.
Brink, A. J., Feldman, C., Grolman, D. C., Muckart, D., Pretorius, J., Richards, G. A.,
Senekal, M. & Sieling, W. (2004). Appropriate use of the carbapenems. S. Afr. Med. J.
94, 857-861.
Bronowski, C., James, C. E. & Winstanley, C. (2014). Role of environmental survival
in transmission of Campylobacter jejuni. FEMS. Microbiol. Lett. 356, 8-19.
Brown, H. L., Reuter, M., Salt, L. J., Cross, K. L., Betts, R. P. & van Vliet, A. H. (2014).
Chicken juice enhances surface attachment and biofilm formation of Campylobacter
jejuni. Appl. Environ. Microbiol. 80, 7053-7060.
Buelow, D. R., Christensen, J. E., Neal-McKinney, J. M. & Konkel, M. E. (2011).
Campylobacter jejuni survival within human epithelial cells is enhanced by the secreted
protein CiaI. Mol. Microbiol. 80, 1296-1312.
Burtnick, M. N., Brett, P. J., Harding, S. V., Ngugi, S. A., Ribot, W. J., Chantratita, N.,
Scorpio, A., Milne, T. S., Dean, R. E., Fritz, D. L, Peacock, S. J., Prior, J. L., Atkins,
T. P. & Deshazer, D. (2011). The cluster 1 type VI secretion system is a major virulence
determinant in Burkholderia pseudomallei. Infect. Immun. 79, 1512-1525.
Buswell, C. M., Herlihy, Y. M., Lawrence, L. M., McGuiggan, J. T., Marsh, P. D.,
Keevil, C. W. & Leach, S. A. (1998). Extended survival and persistence of
Campylobacter spp. in water and aquatic biofilms and their detection by
immunofluorescent-antibody and -rRNA staining. Appl. Environ. Microbiol. 64, 733-
741.
Butt, A. M., Tahir, S., Nasrullah, I., Idrees, M., Lu, J. & Tong, Y. (2012). Mycoplasma
genitalium: a comparative genomics study of metabolic pathways for the identification
of drug and vaccine targets. Infect. Genet. Evol. 12, 53-62.
Butzler, J. P. (2004). Campylobacter, from obscurity to celebrity. Clin. Microbiol.
Infect. 10, 868-876.
162
Caffrey, C. R., Rohwer, A., Oellien, F., Marhöfer, R. J., Braschi, S., Oliveira, G.,
McKerrow. J. H. & Selzer, P. M. (2009). A comparative chemogenomics strategy to
predict potential drug targets in the metazoan pathogen, Schistosoma mansoni. PLoS.
One. 4, e4413.
Cao, B., Cao, S., Dong, P., Gao, J. & Wang, J. (2013). High antibacterial activity of
ultrafine TiO2/graphene sheets nanocomposites under visible light irradiation. Mater.
Lett. 93, 349-352.
Cascales, E. & Cambillau, C. (2012). Structural biology of type VI secretion systems.
Philos. Trans. R. Soc. Lond. B. Biol. Sci. 367, 1102-1111.
Chaban, B., Ngeleka, M. & Hill, J. E. (2010). Detection and quantification of 14
Campylobacter species in pet dogs reveals an increase in species richness in feces of
diarrheic animals. BMC. Microbiol. 10, 73.
Champion, O. L., Gaunt, M. W., Gundogdu, O., Elmi, A., Witney, A. A., Hinds, J.,
Dorrell, N. & Wren, B. W. (2005). Comparative phylogenomics of the food-borne
pathogen Campylobacter jejuni reveals genetic markers predictive of infection source.
Proc. Natl. Acad. Sci. U.S.A. 102, 16043-16048.
Chaubey, P., Patel, R. R. & Mishra, B. (2014). Development and optimization of
curcumin-loaded mannosylated chitosan nanoparticles using response surface
methodology in the treatment of visceral leishmaniasis. Expert. Opin. Drug Deliv. 11,
1163-1181.
Chen, J., Sun, X. T., Zeng, Z. & Yu, Y. Y. (2011). Campylobacter enteritis in adult
patients with acute diarrhea from 2005 to 2009 in Beijing, China. Chin. Med. J. 124,
1508-1512.
Chen, L., Xiong, Z., Sun, L., Yang, J. & Jin, Q. (2012). VFDB 2012 update: toward the
genetic diversity and molecular evolution of bacterial virulence factors. Nucleic. Acids.
Res. 40, D641-645.
Cheng, G., Hao, H., Xie, S., Wang, X., Dai, M., Huang, L. & Yuan, Z. (2014).
Antibiotic alternatives: the substitution of antibiotics in animal husbandry? Front.
Microbiol. 5, 217
Chiang, S. L., Taylor, R. K., Koomey, M. & Mekalanos, J. J. (1995). Single amino acid
substitutions in the N-terminus of Vibrio cholerae TcpA affect colonization,
autoagglutination, and serum resistance. Mol. Microbiol. 17, 1133-1142.
Chlebicz, A. & Śliżewska, K. (2018). Campylobacteriosis, Salmonellosis, Yersiniosis,
and Listeriosis as Zoonotic Foodborne Diseases: A Review. Int. J. Environ. Res. Public
Health. 15, 863
Christensen, J. E., Pacheco, S. A. & Konkel, M. E. (2009). Identification of a
Campylobacter jejuni-secreted protein required for maximal invasion of host cells. Mol.
Microbiol. 73, 650-662.
163
Cianfanelli, F. R., Alcoforado Diniz, J., Guo, M., De Cesare, V., Trost, M. &
Coulthurst, S. J. (2016). VgrG and PAAR Proteins Define Distinct Versions of a
Functional Type VI Secretion System. PLoS Pathog. 12, e1005735.
Colles, F. M., Jones, K., Harding, R. M. & Maiden, M. C. (2003). Genetic diversity of
Campylobacter jejuni isolates from farm animals and the farm environment. Appl.
Environ. Microbiol. 69, 7409-7413.
Coppi, G., Iannuccelli, V., Leo, E., Bernabei, M. T. & Cameroni, R. (2002). Protein
immobilization in crosslinked alginate microparticles. J. Microencapsul. 19, 37-44.
Cornelis, G. R. (2006). The type III secretion injectisome. Nat. Rev. Microbiol. 4, 811-
825.
Costerton, J.W. (1995). Overview of microbial biofilms. J. Ind. Microbiol. 15, 137-140.
CR, Friedman, J, Neimann, HC, Wegener, RV, Tauxe, I, Nachamkin,and MJ, Blaser.
Epidemiology of Campylobacter jejuni infections in the United States and other
industrialized nations. In “Campylobacter”. I. Nachamkin, Szymanski, C., Blaser and
M, 2nd eds. ASM Press. Washington, DC., (2nd ed. pp. 121-138 (2000).
Craven, S. E., Stern, N. J., Line, E., Bailey, J. S., Cox, N. A. & Fedorka-Cray, P. (2000).
Determination of the incidence of Salmonella spp., Campylobacter jejuni, and
Clostridium perfringens in wild birds near broiler chicken houses by sampling intestinal
droppings. Avian Dis. 44, 715-720.
Crowther, G. J., Shanmugam, D., Carmona, S. J., Doyle, M. A., Hertz-Fowler, C.,
Berriman, M., Nwaka, S., Ralph, S. A., Roos, D. S., Voorhis, W.C.V. & F.
Agüero.(2010). Identification of attractive drug targets in neglected-disease pathogens
using an in silico approach. PLoS Negl. Trop. Dis. 4, e804.
Dalhoff, A. & Thomson, C. J. (2003). The art of fusion: from penams and cephems to
penems. Chemotherapy. 49, 105-120.
Das, S., Chakrabortty, A., Banerjee, R. & Chaudhuri, K. (2002). Involvement of in vivo
induced icmF gene of Vibrio cholerae in motility, adherence to epithelial cells, and
conjugation frequency. Biochem. Biophys. Res. Commun. 295, 922-928.
Davis, R. & Brown, P. D. (2016). Multiple antibiotic resistance index, fitness and
virulence potential in respiratory. J. Med. Microbiol. 65, 261-271.
de Pace, F., Boldrin de Paiva, J., Nakazato, G., Lancellotti, M., Sircili, M. P., Guedes
Stehling, E., Dias da Silveira, W. &. Sperandio, V. (2011). Characterization of IcmF of
the type VI secretion system in an avian pathogenic Escherichia coli (APEC) strain.
Microbiology. 157, 2954-2962.
de Zoete, Marcel R., van Putten, Jos P. M. & Wagenaar, Jaap A. (2007). Vaccination
of chickens against Campylobacter. Vaccine. 25, 5548-5557.
164
Decoin, V., Gallique, M., Barbey, C., Le Mauff, F., Poc, C. D., Feuilloley, M. G.,
Orange, n. & Merieau, A. (2015). A Pseudomonas fluorescens type 6 secretion system
is related to mucoidy, motility and bacterial competition. BMC Microbiol. 15, 72.
Dekeyser, P., Gossuin-Detrain, M., Butzler, J. P. & Sternon, J. (1972). Acute enteritis
due to related vibrio: first positive stool cultures. J. Infect. Dis. 125, 390-392.
Deng, J., Deng, L., Su, S., Zhang, M., Lin, X., Wei, L., Minai, A. A., Hassett, D. J. &
Lu, L. J. (2011). Investigating the predictability of essential genes across distantly
related organisms using an integrative approach. Nucleic. Acids. Res. 39, 795-807.
Dingle, K. E., Blaser, M. J., Tu, Z. C., Pruckler, J., Fitzgerald, C., van Bergen, M. A.,
Lawson, A. J., Owen, R. J. & Wagenaar, J. A. (2010). Genetic relationships among
reptilian and mammalian Campylobacter fetus strains determined by multilocus
sequence typing. J. Clin. Microbiol. 48, 977-980.
Domingues, A. R., Pires, S. M., Halasa, T. & Hald, T. (2012). Source attribution of
human campylobacteriosis using a meta-analysis of case-control studies of sporadic
infections. Epidemiol. Infect. 140, 970-981.
Donlan, R. M. & Costerton, J. W. (2002). Biofilms: survival mechanisms of clinically
relevant microorganisms. Clin. Microbiol. Rev. 15, 167-193.
Dorrell, N., Mangan, J. A., Laing, K. G., Hinds, J., Linton, D., Al-Ghusein, H., Barrell,
B. G., Parkhill, J. , Stoker, N. G., Karlyshev, A. V., Butcher, P. D. & Wren, B. W.
(2001). Whole genome comparison of Campylobacter jejuni human isolates using a
low-cost microarray reveals extensive genetic diversity. Genome. Res. 11, 1706-1715.
Douzi, B., Spinelli, S., Blangy, S., Roussel, A., Durand, E., Brunet, Y. R., Cascales, E.
& Cambillau, C. (2014). Crystal structure and self-interaction of the type VI secretion
tail-tube protein from enteroaggregative Escherichia coli. PLoS One. 9, e86918.
Durand, E., Cambillau, C., Cascales, E. & Journet, L. (2014). VgrG, Tae, Tle, and
beyond: the versatile arsenal of Type VI secretion effectors. Trends. Microbiol. 22, 498-
507.
Durand, E., Nguyen, V. S., Zoued, A., Logger, L., Péhau-Arnaudet, G., Aschtgen, M.
S., Spinelli, S., Desmyter, A., Bardiaux, B., Dujeancourt, A., Roussel, A., Cambillau,
C., Cascales, E. & Fronzes, R. (2015). Biogenesis and structure of a type VI secretion
membrane core complex. Nature. 523, 555-560.
EFSA. (2011). Scientific opinion on Campylobacter in broiler meat production:
control options and performance objectives and/or targets at different stages of the food
chain. EFSA. J. 9, 2015.
Eisenbrandt, R., Kalkum, M., Lai, E. M., Lurz, R., Kado, C. I., & Lanka, E. (1999).
Conjugative pili of IncP plasmids, and the Ti plasmid T pilus are composed of cyclic
subunits. J. Biol. Chem. 274, 22548-22555.
165
Ellington, M. J., Kistler, J., Livermore, D. M. & Woodford, N. (2007). Multiplex PCR
for rapid detection of genes encoding acquired metallo-beta-lactamases. J. Antimicrob.
Chemother. 59, 321-322.
El-Shibiny, A., Scott, A., Timms, A., Metawea, Y., Connerton, P. & Connerton, I.
(2009). Application of a group II Campylobacter bacteriophage to reduce strains of
Campylobacter jejuni and Campylobacter coli colonizing broiler chickens. J. Food.
Prot. 72, 733-740.
Englen, M. D. & Kelley, L. C. (2000). A rapid DNA isolation procedure for the
identification of Campylobacter jejuni by the polymerase chain reaction. Lett. Appl.
Microbiol. 31, 421-426.
Epps, S. V., Harvey, R. B., Hume, M. E., Phillips, T. D., Anderson, R. C. & Nisbet, D.
J. (2013). Foodborne Campylobacter: infections, metabolism, pathogenesis and
reservoirs. Int. J. Environ. Res. Public. Health. 10, 6292-6304.
Eucker, T. P. & Konkel, M. E. (2012). The cooperative action of bacterial fibronectin-
binding proteins and secreted proteins promote maximal Campylobacter jejuni invasion
of host cells by stimulating membrane ruffling. Cell Microbiol. 14, 226-238.
Evans, M. R., Northey, G., Sarvotham, T. S., Hopkins, A. L., Rigby, C. J. & Thomas,
D. R. (2009). Risk factors for ciprofloxacin-resistant Campylobacter infection in Wales.
J. Antimicrob. Chemother. 64, 424-427.
Falcone, P. M., Mastromatteo, M., Del Nobile, M. A., Corbo, M. R. & Sinigaglia, M.
(2007). Evaluating in vitro antimicrobial activity of thymol toward hygiene-indicating
and pathogenic bacteria. J. Food. Prot. 70, 425-431.
Feizabadi, M. M., Dolatabadi, S. & Zali, M. R. (2007). Isolation and drug-resistant
patterns of Campylobacter strains cultured from diarrheic children in Tehran. Jpn. J.
Infect. Dis. 60, 217-219.
Feng, Q. L., Wu, J., Chen, G. Q., Cui, F. Z., Kim, T. N. & Kim, J. O. (2000). A
mechanistic study of the antibacterial effect of silver ions on Escherichia coli and
Staphylococcus aureus. J. Biomed. Mater. Res. 52, 662-668.
Ferris, H. U. & Minamino, T. (2006). Flipping the switch: bringing order to flagellar
assembly. Trends Microbiol. 14, 519-526.
Flanagan, R. C., Neal-McKinney, J. M., Dhillon, A. S., Miller, W. G. & Konkel, M. E.
(2009). Examination of Campylobacter jejuni putative adhesins leads to the
identification of a new protein, designated FlpA, required for chicken colonization.
Infect. Immun. 77, 2399-2407.
Foley, S. L., Lynne, A. M. & Nayak, R. (2009). Molecular typing methodologies for
microbial source tracking and epidemiological investigations of Gram-negative
bacterial foodborne pathogens. Infect. Genet. Evol. 9, 430-440.
166
Fox, J. G. (1982). Campylobacteriosis--a "new" disease in laboratory animals. Lab.
Anim. Sci. 32, 625-637.
Franco, D.A. (1988). Campylobacter Species: Considerations for Controlling a
Foodborne Pathogen. J. Food. Prot. 51, 145-153.
Fujimura, K. E., Slusher, N. A., Cabana, M. D. & Lynch, S. V. (2010). Role of the gut
microbiota in defining human health. Expert. Rev. Anti. Infect. Ther. 8, 435-454.
Galán, J. E. & Wolf-Watz, H. (2006). Protein delivery into eukaryotic cells by type III
secretion machines. Nature. 444, 567-573.
Gallique, M., Bouteiller, M., & Merieau, A. (2017). The Type VI Secretion System: A
Dynamic System for Bacterial Communication? Front. Microbiol. 8, 1454.
Gallique, M., Decoin, V., Barbey, C., Rosay, T., Feuilloley, M. G., Orange, N. &
Merieau, A. (2017). Contribution of the Pseudomonas fluorescens MFE01 Type VI
Secretion System to Biofilm Formation. PLoS One. 12, e0170770.
Gaonkar, R. H., Ganguly, S., Dewanjee, S., Sinha, S., Gupta, A., Chattopadhyay, D. &
Chatterjee Debnath, M. (2017). Garcinol loaded vitamin E TPGS emulsified PLGA
nanoparticles: preparation, physicochemical characterization, in vitro and in vivo
studies. Sci. Rep. 7, 530.
Garénaux, A., Jugiau, F., Rama, F., de Jonge, R., Denis, M., Federighi, M. & Ritz, M.
(2008). Survival of Campylobacter jejuni strains from different origins under oxidative
stress conditions: effect of temperature. Curr. Microbiol. 56, 293-297
GBD Diarrhoeal Diseases Collaborators (2018). Estimates of global, regional, and
national morbidity, mortality, and aetiologies of diarrhoeal diseases: a systematic
analysis for the Global Burden of Disease Study 2015. Lancet. Infect. Dis. 17:909–48.
Ghareeb, K., Awas, W., Mohnl, M., Schatzmaryr, G. & Bohm M, J. (2013). Control
strategies for Campylobacter infection in poultry production. Worlds. Poult. Sci. J. 69,
57-76.
Gibbens, J. C., Pascoe, S. J., Evans, S. J., Davies, R. H. & Sayers, A. R. (2001). A trial
of biosecurity as a means to control Campylobacter infection of broiler chickens. Prev.
Vet. Med. 48, 85-99.
Gilbreath, J. J., Cody, W. L., Merrell, D. S., & Hendrixson, D. R. (2011). Change Is
Good: Variations in Common Biological Mechanisms in the Epsilonproteobacterial
Genera Campylobacter and Helicobacter. Microbiol. Mol. Biol. Rev.. 75, 84-132.
Gillespie, I. A., O'Brien, S. J., Frost, J. A., Adak, G. K., Horby, P., Swan, A. V., Painter,
M. J., Neal K. R. & Collaborators C. S. S. S. (2002). A case-case comparison of
Campylobacter coli and Campylobacter jejuni infection: a tool for generating
hypotheses. Emerg. Infect. Dis. 8, 937-942.
167
Golden, N. J. & Acheson, D. W. (2002). Identification of motility and autoagglutination
Campylobacter jejuni mutants by random transposon mutagenesis. Infect. Immun. 70,
1761-1771.
Goon, S., Kelly, J. F., Logan, S. M., Ewing, C. P. & Guerry, P. (2003). Pseudaminic
acid, the major modification on Campylobacter flagellin, is synthesized via the Cj1293
gene. Mol. Microbiol. 50, 659-671.
Gophna, U., Ron, E. Z. & Graur, D. (2003). Bacterial type III secretion systems are
ancient and evolved by multiple horizontal-transfer events. Gene. 312, 151-163.
Gracia, M. I., Millan, C., Sanchez, J., Guyard-Nicodeme, M., Mayot, J., Carre, Y.,
Csorbai, A., Chemaly M. & Medel, P. (2016). Efficacy of feed additives against
Campylobacter in live broilers during the entire rearing period: Part B. Poult. Sci. 95,
886-892.
Green, E. R. & Mecsas, J. (2016). Bacterial Secretion Systems: An Overview.
Microbiol. Spectr. 4 , VMBF-0012-2015.
Griffiths, P. L. (1993). Morphological changes of Campylobacter jejuni growing in
liquid culture. Lett. Appl. Microbiol. 17, 152-155.
Gubbels, S. M., Kuhn, K. G., Larsson, J. T., Adelhardt, M., Engberg, J., Ingildsen, P.,
Hollesen, L. W., Muchitsch, S., Mølbak, K. & Ethelberg, S. (2012). A waterborne
outbreak with a single clone of Campylobacter jejuni in the Danish town of Køge in
May 2010. Scand. J. Infect. Dis. 44, 586-594.
Guerry, P., Ewing, C. P., Hickey, T. E., Prendergast, M. M. & Moran, A. P. (2000).
Sialylation of lipooligosaccharide cores affects immunogenicity and serum resistance
of Campylobacter jejuni. Infect. Immun. 68, 6656-6662.
Guerry, P., Ewing, C. P., Schirm, M., Lorenzo, M., Kelly, J., Pattarini, D., Majam, G.,
Thibault, P. & Logan, S. (2006). Changes in flagellin glycosylation affect
Campylobacter autoagglutination and virulence. Mol. Microbiol. 60, 299-311.
Guerry, P., Logan, S. M., Thornton, S. & Trust, T. J. (1990). Genomic organization and
expression of Campylobacter flagellin genes. J. Bacteriol. 172, 1853-1860.
Gunther, N. W. & Chen, C. Y. (2009). The biofilm forming potential of bacterial
species in the genus Campylobacter. Food. Microbiol. 26, 44-51.
Gustafson, A. M., Snitkin, E. S., Parker, S. C., DeLisi, C. & Kasif, S. (2006). Towards
the identification of essential genes using targeted genome sequencing and comparative
analysis. BMC Genomics. 7, 265.
Hachani, A., Lossi, N. S., Hamilton, A., Jones, C., Bleves, S., Albesa-Jové, D. &
Filloux, A. (2011). Type VI secretion system in Pseudomonas aeruginosa: secretion
and multimerization of VgrG proteins. J. Biol. Chem. 286, 12317-12327.
168
Haddock, G., Mullin, M., MacCallum, A., Sherry, A., Tetley, L., Watson, E., Dagleish,
M., Smith D. G. & Everest, P. (2010). Campylobacter jejuni 81-176 forms distinct
microcolonies on in vitro-infected human small intestinal tissue prior to biofilm
formation. Microbiology. 156, 3079-3084.
Hald, B., Sommer, H. M. & Skovgård, H. (2007). Use of fly screens to reduce
Campylobacter spp. introduction in broiler houses. Emerg. Infect. Dis. 13, 1951-1953.
Hanning, I., Jarquin, R. & Slavik, M. (2008). Campylobacter jejuni as a secondary
colonizer of poultry biofilms. J. Appl. Microbiol. 105, 1199-1208.
Hansson, I., Vågsholm, I., Svensson, L. & Olsson Engvall, E. (2007). Correlations
between Campylobacter spp. prevalence in the environment and broiler flocks. J. Appl.
Microbiol. 103, 640-649.
Harikishore, M., Sandhyarani, M., Venkateswarlu, K., Nellaippan, T. A. &
Rameshbabu, N. (2014). Effect of Ag Doping on Antibacterial and Photocatalytic
Activity of Nanocrystalline TiO2. Procedia Mater. Sci. 6, 557-566.
Harrison, J. W., Dung, T. T., Siddiqui, F., Korbrisate, S., Bukhari, H., Tra, M. P.,
Hoang, N. V., Carrique-Mas, J., Bryant, J., Campbell, J. I., Studholme, D. J., Wren, B.
W., Baker, S., Titball, R. W. & Champion, O. L (2014). Identification of possible
virulence marker from Campylobacter jejuni isolates. Emerg. Infect. Dis. 20, 1026-
1029.
Havelaar, A. H., Ivarsson, S., Löfdahl, M. & Nauta, M. J. (2013). Estimating the true
incidence of campylobacteriosis and salmonellosis in the European Union, 2009.
Epidemiol. Infect. 141, 293-302.
Hazeleger, W. C., Wouters, J. A., Rombouts, F. M. & Abee, T. (1998). Physiological
activity of Campylobacter jejuni far below the minimal growth temperature. Appl.
Environ. Microbiol. 64, 3917-3922.
He, Y. & Chen, C. Y. (2010). Quantitative analysis of viable, stressed and dead cells of
Campylobacter jejuni strain 81-176. Food Microbiol. 27, 439-446.
Hendrixson, D. R. (2006). A phase-variable mechanism controlling the Campylobacter
jejuni FlgR response regulator influences commensalism. Mol. Microbiol. 61, 1646-
1659.
Hendrixson, D. R. & DiRita, V. J. (2004). Identification of Campylobacter jejuni genes
involved in commensal colonization of the chick gastrointestinal tract. Mol. Microbiol.
52, 471-484.
Hickey, T. E., McVeigh, A. L., Scott, D. A., Michielutti, R. E., Bixby, A., Carroll, S.
A., Bourgeois, A. L. & Guerry, P. (2000). Campylobacter jejuni cytolethal distending
toxin mediates release of interleukin-8 from intestinal epithelial cells. Infect. Immun.
68(12), 6535-6541.
169
Ho, B. T., Dong, T. G. & Mekalanos, J. J. (2014). A view to a kill: the bacterial type
VI secretion system. Cell. Host. Microbe. 15, 9-21.
Ho, S. N., Hunt, H. D., Horton, R. M., Pullen, J. K. & Pease, L. R. (1989). Site-directed
mutagenesis by overlap extension using the polymerase chain reaction. Gene, 77, 51-
59.
Hoang, K. V., Wang, Y. & Lin, J. (2012). Identification of genetic loci that contribute
to Campylobacter resistance to fowlicidin-1, a chicken host defense peptide. Front.
Cell. Infect. Microbiol. 2.
Holmberg, M., Rosendal, T., Engvall, E. O., Ohlson, A. & Lindberg, A. (2015).
Prevalence of thermophilic Campylobacter species in Swedish dogs and
characterization of C. jejuni isolates. Acta. Vet. Scand. 57.
Holmes, P. & Mauer, J. (2016). Antimicrobial Resistance And New Antibiotics. Health
Aff. (Millwood). 35, 1935.
Hood, R. D., Singh, P., Hsu, F., Güvener, T., Carl, M. A., Trinidad, R. R., Silverman,
J. M., Ohlson, B. B., Hicks, K. G., Plemel, R. L., Li, M., Schwarz, S., Wang, W. Y.,
Merz, A. J., Goodlett, D. R. & Mougous, J. D. (2010). A type VI secretion system of
Pseudomonas aeruginosa targets a toxin to bacteria. Cell Host Microbe, 7, 25-37.
Horrocks, S. M., Anderson, R. C., Nisbet, D. J. & Ricke, S. C. (2009). Incidence and
ecology of Campylobacter jejuni and coli in animals. Anaerobe. 15, 18-25.
Hosseini, S. F., Zandi, M., Rezaei, M., & Farahmandghavi, F. (2013). Two-step method
for encapsulation of oregano essential oil in chitosan nanoparticles: preparation,
characterization and in vitro release study. Carbohydr. Polym. 95, 50-56.
Hsieh, W. C., Chang, C. P. & Gao, Y. L. (2006). Controlled release properties of
Chitosan encapsulated volatile Citronella Oil microcapsules by thermal treatments.
Colloids. Surf. B. Biointerfaces. 53, 209-214.
Huang, J. L., Xu, H. Y., Bao, G. Y., Zhou, X. H., Ji, D. J., Zhang, G., Liu, P. H., Jiang,
F., Pan, Z. M., Liu X. F. & Jiao, X. A. (2009). Epidemiological surveillance of
Campylobacter jejuni in chicken, dairy cattle and diarrhoea patients. Epidemiol. Infect.
137, 1111-1120.
Hudson, J. A., Nicol, C., Wright, J., Whyte, R. & Hasell, S. K. (1999). Seasonal
variation of Campylobacter types from human cases, veterinary cases, raw chicken,
milk and water. J. Appl. Microbiol. 87, 115-124.
Hussain, I., Shahid Mahmood, M., Akhtar, M. & Khan, A. (2007). Prevalence of
Campylobacter species in meat, milk and other food commodities in Pakistan. Food.
Microbiol. 24, 219-222.
170
Ibrahim, N. G., Zafar, A. & Hasan, R. (2004). Evaluation of frequency of isolation and
trends in antibiotic resistance among Campylobacter isolates over 11 year period. J.
Pak. Med. Assoc. 54, 291-294.
Ikeda, N. & Karlyshev, A. V. (2012). Putative mechanisms and biological role of
coccoid form formation in Campylobacter jejuni. Eur. J. Microbiol. Immunol. 2, 41-
49.
Jackson, D. N., Davis, B., Tirado, S. M., Duggal, M., van Frankenhuyzen, J. K.,
Deaville, D. & Trevors, J. T. (2009). Survival mechanisms and culturability of
Campylobacter jejuni under stress conditions. Antonie. Van. Leeuwenhoek, 96, 377-
394.
Jain, A. K., Swarnakar, N. K., Godugu, C., Singh, R. P. & Jain, S. (2011). The effect
of the oral administration of polymeric nanoparticles on the efficacy and toxicity of
tamoxifen. Biomaterials. 32, 503-515.
Jamil, B., Abbasi, R., Abbasi, S., Imran, M., Khan, S. U., Ihsan, A., Javed, S. &
Bokhari, H. (2016). Encapsulation of Cardamom Essential Oil in Chitosan Nano-
composites. Front. Microbiol. 7, 1580.
Jani, A. J. & Cotter, P. A. (2010). Type VI secretion: not just for pathogenesis anymore.
Cell. Host. Microbe. 8, 2-6.
Janssen, R., Krogfelt, K. A., Cawthraw, S. A., van Pelt, W., Wagenaar, J. A. & Owen,
R. J. (2008). Host-pathogen interactions in Campylobacter infections: the host
perspective. Clin. Microbiol. Rev. 21, 505-518.
Jin, S., Joe, A., Lynett, J., Hani, E. K., Sherman, P. & Chan, V. L. (2001). JlpA, a novel
surface-exposed lipoprotein specific to Campylobacter jejuni, mediates adherence to
host epithelial cells. Mol. Microbiol. 39, 1225-1236.
Jin, S., Song, Y. C., Emili, A., Sherman, P. M. & Chan, V. L. (2003). JlpA of
Campylobacter jejuni interacts with surface-exposed heat shock protein 90alpha and
triggers signalling pathways leading to the activation of NF-kappaB and p38 MAP
kinase in epithelial cells. Cell. Microbiol. 5, 165-174.
Jobichen, C., Chakraborty, S., Li, M., Zheng, J., Joseph, L., Mok, Y. K., Leung, K. Y.
& Sivaraman, J. (2010). Structural basis for the secretion of EvpC: a key type VI
secretion system protein from Edwardsiella tarda. PLoS One, 5, e12910.
Johnson, T. J., Shank, J. M. & Johnson, J. G. (2017). Current and Potential Treatments
for Reducing Campylobacter Colonization in Animal Hosts and Disease in Humans.
Front. Microbiol. 8, 487.
Jones, N., Ray, B., Ranjit, K. T. & Manna, A. C. (2008). Antibacterial activity of ZnO
nanoparticle suspensions on a broad spectrum of microorganisms. FEMS. Microbiol.
Lett. 279, 71-76.
171
Joshua, G. W., Guthrie-Irons, C., Karlyshev, A. V. & Wren, B. W. (2006). Biofilm
formation in Campylobacter jejuni. Microbiology. 152, 387-396.
Kaakoush, N. O., Castaño-Rodríguez, N., Mitchell, H. M. & Man, S. M. (2015). Global
Epidemiology of Campylobacter Infection. Clin. Microbiol. Rev. 28, 687-720.
Kalmokoff, M., Lanthier, P., Tremblay, T. L., Foss, M., Lau, P. C., Sanders, G., Austin,
J., Kelly J. & Szymanski, C. M. (2006). Proteomic analysis of Campylobacter jejuni
11168 biofilms reveals a role for the motility complex in biofilm formation. J.
Bacteriol. 188, 4312-4320.
Kapperud, G., Espeland, G., Wahl, E., Walde, A., Herikstad, H., Gustavsen, S., Tveit,
I., Natås, O. Bevanger L. & Digranes, A. (2003). Factors associated with increased and
decreased risk of Campylobacter infection: a prospective case-control study in Norway.
Am. J. Epidemiol. 158, 234-242.
Karlyshev, A. V., Everest, P., Linton, D., Cawthraw, S., Newell, D. G. & Wren, B. W.
(2004). The Campylobacter jejuni general glycosylation system is important for
attachment to human epithelial cells and in the colonization of chicks. Microbiology.
150, 1957-1964.
Kassenborg, H. D., Smith, K. E., Vugia, D. J., Rabatsky-Ehr, T., Bates, M. R., Carter,
M. A., Dumas, N. B., Cassidy, M. P., Marano, N., Tauxe, R. V., Angulo, F. J. & Group,
F.W. Emerging Infections Program FoodNet Working. (2004). Fluoroquinolone-
resistant Campylobacter infections: eating poultry outside of the home and foreign
travel are risk factors. Clin. Infect. Dis. 38, S279-284.
Katsma, W. E., De Koeijer, A. A., Jacobs-Reitsma, W. F., Mangen, M. J. & Wagenaar,
J. A. (2007). Assessing interventions to reduce the risk of Campylobacter prevalence in
broilers. Risk. Anal. 27, 863-876.
Katuwavila, N.P., Perera, A.D.L.C., Samarakoon, S.R., Soysa, P., Karunaratne, V.,
Amaratunga, G.A.J., & Karunaratne, D.N. (2016). Chitosan-Alginate Nanoparticle
System Efficiently Delivers Doxorubicin to MCF-7 Cells. J. Nanomater. 2016, 1-12.
Katz, M. L., Mueller, L. V., Polyakov, M. & Weinstock, S. F. (2006). Where have all
the antibiotic patents gone? Nat. Biotechnol. 24, 1529-1531.
Kelly, D. J. (2001). The physiology and metabolism of Campylobacter jejuni and
Helicobacter pylori. Symp. Ser. Soc. Appl. Microbiol. 30, 16S-24S.
Kerfeld, C. A. & Scott, K. M. (2011). Using BLAST to teach "E-value-tionary"
concepts. PLoS Biol. 9, e1001014.
Ketley, J. M. (1997). Pathogenesis of enteric infection by Campylobacter.
Microbiology. 143, 5-21.
172
Khalil, K., Lindblom, G. B., Mazhar, K., Sjögren, E. & Kaijser, B. (1993). Frequency
and enterotoxigenicity of Campylobacter jejuni and C. coli in domestic animals in
Pakistan as compared to Sweden. J. Trop. Med. Hyg. 96, 35-40.
Kiehlbauch, J. A., Albach, R. A., Baum, L. L. & Chang, K. P. (1985). Phagocytosis of
Campylobacter jejuni and its intracellular survival in mononuclear phagocytes. Infect.
Immun. 48, 446-451.
Kim, D, Nikles, D.E., Johnson, D.T. & Brazel, CS. (2008). Heat generation of
aqueously dispersed CoFe2O4 nanoparticles as heating agents for magnetically
activated drug delivery and hyperthermia. J. Magn. Magn. Mater. 320, 2390-2396.
Kim, J., Lee, J. Y., Lee, H., Choi, J. Y., Kim, D. H., Wi, Y. M., Peck K. R. & Ko, K. S.
(2017). Microbiological features and clinical impact of the type VI secretion system
(T6SS) in Acinetobacter baumannii isolates causing bacteremia. Virulence. 8, 1378-
1389.
Kittl, S., Kuhnert, P., Hächler, H. & Korczak, B. M. (2011). Comparison of genotypes
and antibiotic resistance of Campylobacter jejuni isolated from humans and slaughtered
chickens in Switzerland. J. Appl. Microbiol. 110(2), 513-520.
Klancnik, A., Botteldoorn, N., Herman, L. & Mozina, S. S. (2006). Survival and stress
induced expression of groEL and rpoD of Campylobacter jejuni from different growth
phases. Int J. Food. Microbiol. 112, 200-207.
Klančnik, A., Možina, S. S. & Zhang, Q. (2012). Anti-Campylobacter activities and
resistance mechanisms of natural phenolic compounds in Campylobacter. PLoS One.
7, e51800.
Konkel, M. E., Kim, B. J., Rivera-Amill, V. & Garvis, S. G. (1999). Bacterial secreted
proteins are required for the internaliztion of Campylobacter jejuni into cultured
mammalian cells. Mol. Microbiol. 32, 691-701.
Konkel, M. E., Klena, J. D., Rivera-Amill, V., Monteville, M. R., Biswas, D., Raphael,
B. & Mickelson, J. (2004). Secretion of virulence proteins from Campylobacter jejuni
is dependent on a functional flagellar export apparatus. J. Bacteriol. 186, 3296-3303.
Konkel, M. E., Larson, C. L. & Flanagan, R. C. (2010). Campylobacter jejuni FlpA
binds fibronectin and is required for maximal host cell adherence. J. Bacteriol. 192, 68-
76.
Korhonen, L. K. & Martikainen, P. J. (1991). Comparison of the survival of
Campylobacter jejuni and Campylobacter coli in culturable form in surface water. Can.
J. Microbiol. 37, 530-533.
Körpe D. A., Malekghasemi S., Aydın U. & Duman M. (2018). Fabrication of
monodispersive nanoscale alginate–chitosan core–shell particulate systems for
controlled release studies. J. Nanopart. Res.16, 2754
173
Krogh, A., Larsson, B., von Heijne, G. & Sonnhammer, E. L. (2001). Predicting
transmembrane protein topology with a hidden Markov model: application to complete
genomes. J. Mol. Biol. 305, 567-580.
Kubota, K., Kasuga, F., Iwasaki, E., Inagaki, S., Sakurai, Y., Komatsu, M., Toyofuku,
H., Angulo, F. J., Scallan, E. & Morikawa, K. (2011). Estimating the burden of acute
gastroenteritis and foodborne illness caused by Campylobacter, Salmonella, and Vibrio
parahaemolyticus by using population-based telephone survey data, Miyagi Prefecture,
Japan, 2005 to 2006. J. Food Prot. 74, 1592-1598.
Kwan, P. S., Barrigas, M., Bolton, F. J., French, N. P., Gowland, P., Kemp, R.,
Leatherbarrow, H., Upton M. & Fox, A. J. (2008). Molecular epidemiology of
Campylobacter jejuni populations in dairy cattle, wildlife, and the environment in a
farmland area. Appl. Environ. Microbiol. 74, 5130-5138.
Lai, C. K., Chen, Y. A., Lin, C. J., Lin, H. J., Kao, M. C., Huang, M. Z., Lin, Y. H.,
Chiang-Ni, C., Chen, C. J., Lo, U. G., Lin, L. C., Lin, H., Hsieh J.T. & Lai, C. H. (2016).
Molecular Mechanisms and Potential Clinical Applications of Campylobacter jejuni
Cytolethal Distending Toxin. Front. Cell. Infect. Microbiol. 6, 9.
Leonard, E. E., Takata, T., Blaser, M. J., Falkow, S., Tompkins, L. S., & Gaynor, E. C.
(2003). Use of an open-reading frame-specific Campylobacter jejuni DNA microarray
as a new genotyping tool for studying epidemiologically related isolates. J. Infect. Dis.
187, 691-694.
Lertpiriyapong, K., Gamazon, E. R., Feng, Y., Park, D. S., Pang, J., Botka, G., Graffam,
M. E., Ge, Z. & Fox, J. G. (2012). Campylobacter jejuni type VI secretion system: roles
in adaptation to deoxycholic acid, host cell adherence, invasion, and in vivo
colonization. PLoS One, 7, e42842.
Li, P., Dai, Y. N., Zhang, J. P., Wang, A. Q. & Wei, Q. (2008). Chitosan-Alginate
Nanoparticles as a Novel Drug Delivery System for Nifedipine. Int. J. Biomed. Sci. 4,
221-228.
Lim, Y. T., Jobichen, C., Wong, J., Limmathurotsakul, D., Li, S., Chen, Y., Raida, M.,
Srinivasan, N., MacAry, P. A., Sivaraman, J. & Gan, Y. H. (2015). Extended loop
region of Hcp1 is critical for the assembly and function of type VI secretion system in
Burkholderia pseudomallei. Sci. Rep. 5, 8235.
Lin, J. (2009). Novel approaches for Campylobacter control in poultry. Foodborne.
Pathog. Dis. 6, 755-765.
Lin, Q. P., Gao, Z. Q., Geng, Z., Zhang, H. & Dong, Y. H. (2017). Crystal structure of
the putative cytoplasmic protein STM0279 (Hcp2) from Salmonella typhimurium. Acta
Crystallogr. F. Struct. Biol. Commun. 73, 463-468.
Line, J. E., Svetoch, E. A., Eruslanov, B. V., Perelygin, V. V., Mitsevich, E. V.,
Mitsevich, I. P., Levchuk, V. P., Svetoch, O. E., Seal, B. S., Siragusa, G. R. & Stern,
N. J. (2008). Isolation and purification of enterocin E-760 with broad antimicrobial
174
activity against gram-positive and gram-negative bacteria. Antimicrob. Agents.
Chemother. 52, 1094-1100.
Liu, Y., He, L., Mustapha, A., Li, H., Hu, Z. Q. & Lin, M. (2009). Antibacterial
activities of zinc oxide nanoparticles against Escherichia coli O157:H7. J. Appl.
Microbiol. 107, 1193-1201.
Louwen, R., Heikema, A., van Belkum, A., Ott, A., Gilbert, M., Ang, W., Endtz, H. P.,
Bergman, M. P. & Nieuwenhuis, E. E. (2008). The sialylated lipooligosaccharide outer
core in Campylobacter jejuni is an important determinant for epithelial cell invasion.
Infect. Immun. 76, 4431-4438.
Lu, X., Rasco, B. A., Jabal, J. M., Aston, D. E., Lin, M. & Konkel, M. E. (2011).
Investigating antibacterial effects of garlic (Allium sativum) concentrate and garlic-
derived organosulfur compounds on Campylobacter jejuni by using Fourier transform
infrared spectroscopy, Raman spectroscopy, and electron microscopy. Appl. Environ.
Microbiol. 77, 5257-5269.
Lu, X., Weakley, A. T., Aston, D. E., Rasco, B. A., Wang, S. & Konkel, M. E. (2012).
Examination of nanoparticle inactivation of Campylobacter jejuni biofilms using
infrared and Raman spectroscopies. J. Appl. Microbiol. 113, 952-963.
Luangtongkum, T., Jeon, B., Han, J., Plummer, P., Logue, C. M. & Zhang, Q. (2009).
Antibiotic resistance in Campylobacter: emergence, transmission and persistence.
Future. Microbiol. 4, 189-200.
Veron, M. & Chatelain, R. (1973). Taxonomic study of the genus Campylobacter
(Sebald and Veron) and designation of the neotype strain for the type species,
Campylobacter fetus (Smith and Taylor) Sebald and Veron. Int. J. Syst. Bacteriol. 23,
122-134
Ma, A. T. & Mekalanos, J. J. (2010). In vivo actin cross-linking induced by Vibrio
cholerae type VI secretion system is associated with intestinal inflammation. Proc.
Natl. Acad. Sci. U.S.A. 107, 4365-4370.
Maness, P. C., Smolinski, S., Blake, D. M., Huang, Z., Wolfrum, E. J. & Jacoby, W. A.
(1999). Bactericidal activity of photocatalytic TiO(2) reaction: toward an understanding
of its killing mechanism. Appl. Environ. Microbiol. 65, 4094-4098.
Manzoor, U., Siddique, S., Ahmed, R., Noreen, Z., Bokhari, H. & Ahmad, I. (2016).
Antibacterial, Structural and Optical Characterization of Mechano-Chemically
Prepared ZnO Nanoparticles. PLoS One. 11, e0154704.
Mattheus, W., Botteldoorn, N., Heylen, K., Pochet, B. & Dierick, K. (2012). Trend
analysis of antimicrobial resistance in Campylobacter jejuni and Campylobacter coli
isolated from Belgian pork and poultry meat products using surveillance data of 2004-
2009. Foodborne. Pathog. Dis. 9, 465-472.
175
McFadyean, J. & Stockman, S. (1913). Report of the Departmental Committee
Appointed by the Board of Agriculture and Fisheries to inquire into epizootic abortion.
Part III. Abortion in sheep. London, HMSO.
Menozzi, F. D., Boucher, P. E., Riveau, G., Gantiez, C. & Locht, C. (1994). Surface-
associated filamentous hemagglutinin induces autoagglutination of Bordetella
pertussis. Infect. Immun. 62, 4261-4269.
Millet, S. & Maertens, L. (2011). The European ban on antibiotic growth promoters in
animal feed: from challenges to opportunities. Vet. J.187, 143-144).
Mohan, V. (2015). Faeco-prevalence of Campylobacter jejuni in urban wild birds and
pets in New Zealand. BMC Res. Notes. 8, 1.
Monteville, M. R., Yoon, J. E. & Konkel, M. E. (2003). Maximal adherence and
invasion of INT 407 cells by Campylobacter jejuni requires the CadF outer-membrane
protein and microfilament reorganization. Microbiology. 149, 153-165.
Moonah, S., Sanders, N. G., Persichetti, J. K., & Sullivan, D. J. (2014). Erythrocyte
lysis and Xenopus laevis oocyte rupture by recombinant Plasmodium falciparum
hemolysin III. Eukaryot. Cell. 13, 1337-1345.
Moore, J. E., Barton, M. D., Blair, I. S., Corcoran, D., Dooley, J. S., Fanning, S., Kempf,
I., Lastovica, A. J., Lowery, C. J., Matsuda, M., McDowell, D. A., McMahon, A.,
Millar, B. C., Rao, J. R., Rooney, P. J., Seal, B. S., Snelling, W. J. & Tolba, O. (2006).
The epidemiology of antibiotic resistance in Campylobacter. Microbes. Infect. 8, 1955-
1966.
Moore, J. E., Corcoran, D., Dooley, J. S., Fanning, S., Lucey, B., Matsuda, M.,
McDowell, D. A., Mégraud, F., Millar, B. C., O'Mahony, R., O'Riordan, L., O'Rourke,
M., Rao, J. R., Rooney, P. J., Sails A., & Whyte, P. (2005). Campylobacter. Vet. Res.
36, 351-382.
Moran, A. P. & Upton, M. E. (1987). Factors affecting production of coccoid forms by
Campylobacter jejuni on solid media during incubation. J. Appl. Bacteriol. 62, 527-
537.
Moriya, Y., Itoh, M., Okuda, S., Yoshizawa, A. C. & Kanehisa, M. (2007). KAAS: an
automatic genome annotation and pathway reconstruction server. Nucleic Acids. Res.
35, W182-185. doi:10.1093/nar/gkm321
Mosmann, T. (1983). Rapid colorimetric assay for cellular growth and survival:
application to proliferation and cytotoxicity assays. J. Immunol. Methods. 65, 55-63.
Mougous, J. D., Cuff, M. E., Raunser, S., Shen, A., Zhou, M., Gifford, C. A., Goodman,
A. L., Joachimiak, G., Ordoñez, C. L., Lory, S., Walz, T., Joachimiak A. & Mekalanos,
J. J. (2006). A virulence locus of Pseudomonas aeruginosa encodes a protein secretion
apparatus. Science. 312, 1526-1530.
176
Mughini Gras, L., Smid, J. H., Wagenaar, J. A., Koene, M. G., Havelaar, A. H.,
Friesema, I. H., French, N. P., Flemming, C.J. Galson, D., Graziani, C., Busani, L. &
VAN Pelt, W. (2013). Increased risk for Campylobacter jejuni and C. coli infection of
pet origin in dog owners and evidence for genetic association between strains causing
infection in humans and their pets. Epidemiol. Infect. 141, 2526-2535.
Mukherjee, P., Ramamurthy, T., Bhattacharya, M. K., Rajendran, K. &
Mukhopadhyay, A. K. (2013). Campylobacter jejuni in hospitalized patients with
diarrhea, Kolkata, India. Emerg. Infect. Dis. 19, 1155-1156.
Mukherjee, P., Ramamurthy, T., Mitra, U. & Mukhopadhyay, A. K. (2014). Emergence
of high-level azithromycin resistance in Campylobacter jejuni isolates from pediatric
diarrhea patients in Kolkata, India. Antimicrob. Agents. Chemother. 58, 4248.
Mulder, N. & Apweiler, R. (2007). InterPro and InterProScan: tools for protein
sequence classification and comparison. Methods. Mol. Biol. 396, 59-70.
Murphy, C., Carroll, C. & Jordan, K. N. (2003a). Identification of a novel stress
resistance mechanism in Campylobacter jejuni. J. Appl. Microbiol. 95, 704-708.
Murphy, C., Carroll, C. & Jordan, K. N. (2003b). Induction of an adaptive tolerance
response in the foodborne pathogen, Campylobacter jejuni. FEMS. Microbiol. Lett.
223, 89-93.
Murphy, C., Carroll, C. & Jordan, K. N. (2006). Environmental survival mechanisms
of the foodborne pathogen Campylobacter jejuni. J. Appl. Microbiol.100, 623-632.
Nachamkin, I., Yang, X. H. & Stern, N. J. (1993). Role of Campylobacter jejuni flagella
as colonization factors for three-day-old chicks: analysis with flagellar mutants. Appl.
Environ. Microbiol. 59, 1269-1273.
Natrajan, D., Srinivasan, S., Sundar, K. & Ravindran, A. (2015). Formulation of
essential oil-loaded chitosan-alginate nanocapsules. J. Food Drug. Anal. 23, 560-568.
Navarro, M., Stanley, R., Cusack, A. & Sultanbawa, A. (2015). Combinations of plant-
derived compounds against Campylobacter in vitro. J. Appl. Poult. Res., 24, 352–363.
Newell, D. G., Elvers, K. T., Dopfer, D., Hansson, I., Jones, P., James, S., Gittins, J.,
Stern, N. J., Davies, R., Connerton, I., Pearson, D., Salvat, G. & Allen, V. M. (2011).
Biosecurity-based interventions and strategies to reduce Campylobacter spp. on poultry
farms. Appl. Environ. Microbiol. 77, 8605-8614.
NG, L. K., Sherburne, R., Taylor, D. E. & Stiles, M. E. (1985). Morphological forms
and viability of Campylobacter species studied by electron microscopy. J. Bacteriol.
164, 338-343.
177
Nguyen, T. N., Hotzel, H., Njeru, J., Mwituria, J., El-Adawy, H., Tomaso, H.,
Neubauer, H. & Hafez, H. M. (2016). Antimicrobial resistance of Campylobacter
isolates from small scale and backyard chicken in Kenya. Gut Pathog. 8, 39.
Nguyen, V. T., Fegan, N., Turner, M. S. & Dykes, G. A. (2012). Role of attachment to
surfaces on the prevalence and survival of Campylobacter through food systems. J.
Food. Prot. 75, 195-206. doi:10.4315/0362-028X.JFP-11-012
Nicolle, L. (2006). Community-acquired MRSA: a practitioner's guide. CMAJ. 175,
145.
Nisar, M., Ahmad, M. U. D., Mushtaq, M. H., Shehzad, W., Hussain, A., Nasar, M.,
Nagaraja, K. V., & Goyal, S. M. (2018). Occurrence of Campylobacter in retail meat
in Lahore, Pakistan. Acta Trop. 185,42-45.
Noreen, Z., Abrar, M., Siddiqui, F., Faryal, R., Hamid, H. & Bokhari, H. (2016).
Antibiotic Susceptibility and Molecular Characterization of Campylobacter jejuni
Strain Isolated from a Guillain Barré Syndrome Child. Indian J. Pediatr. 83, 728.
Noreen, Z., Ahmad, I., Siddiqui, F., Ziya, A.B., Abbas, T. & Bokhari H.(2017). Size
dependent structural, anti-bacterial and anti-biofilm properties of Er doped Li-Ni
ferrites synthesized by the sol-gel auto-combustion route Ceram. Int. 43, 10784-10790.
Noreen, Z., Jobichen, C., Abbasi, R., Seetharaman, J., Sivaraman, J., & Bokhari H.
(2018). Structural basis for the pathogenesis of Campylobacter jejuni Hcp1, a structural
and effector protein of the Type VI Secretion System. FEBS. J. 2018 doi:
10.1111/febs.14650. [Epub ahead of print]
Nuijten, P. J., Márquez-Magaña, L. & van der Zeijst, B. A. (1995). Analysis of flagellin
gene expression in flagellar phase variants of Campylobacter jejuni 81116. Antonie.
Van. Leeuwenhoek. 67, 377-383.
Nuijten, P. J., van Asten, F. J., Gaastra, W. & van der Zeijst, B. A. (1990). Structural
and functional analysis of two Campylobacter jejuni flagellin genes. J. Biol. Chem. 265,
17798-17804.
Oechslin, F. (2018). Resistance Development to Bacteriophages Occurring during
Bacteriophage Therapy. Viruses. 10, 351.
Oh, E., Andrews, K. J. & Jeon, B. (2018). Enhanced Biofilm Formation by Ferrous and
Ferric Iron Through Oxidative Stress in. Front. Microbiol. 9, 1204.
Oh, E., Kim, J. C. & Jeon, B. (2016). Stimulation of biofilm formation by oxidative
stress in Campylobacter jejuni under aerobic conditions. Virulence. 7, 846-851.
Oliver, J. D. (2005). The viable but nonculturable state in bacteria. J. Microbiol. 43, 93-
100.
178
Osipiuk, J., Xu, X., Cui, H., Savchenko, A., Edwards, A. & Joachimiak, A. (2011).
Crystal structure of secretory protein Hcp3 from Pseudomonas aeruginosa. J. Struct.
Funct. Genomics. 12, 21-26.
O'Toole, G. A. & Kolter, R. (1998). Flagellar and twitching motility are necessary for
Pseudomonas aeruginosa biofilm development. Mol. Microbiol. 30, 295-304.
Otwinowski, Z. & Minor, W. (1997). Processing of X-ray diffraction data collected in
oscillation mode. Methods Enzymol. 276, 307-326.
Palmer, T. & Berks, B. C. (2012). The twin-arginine translocation (Tat) protein export
pathway. Nat. Rev. Microbiol. 10, 483-496.
Park, S. F. (2002). The physiology of Campylobacter species and its relevance to their
role as foodborne pathogens. Int. J. Food Microbiol. 74, 177-188.
Parkhill, J., Wren, B. W., Mungall, K., Ketley, J. M., Churcher, C., Basham, D.,
Chillingworth, T. Davies, R. M. Feltwell, T. Holroyd, S. Jagels, K. Karlyshev, A. V.
Moule, S. Pallen, M. J. Penn, C. W. Quail, M. A.. Rajandream, M. A Rutherford, K.
M. van Vliet, A. H. Whitehead, S. & Barrell, B. G. (2000). The genome sequence of
the food-borne pathogen Campylobacter jejuni reveals hypervariable sequences.
Nature. 403, 665-668.
Paterson, D. L., Ko, W. C., Von Gottberg, A., Mohapatra, S., Casellas, J. M., Goossens,
H., Mulazimoglu, L. Trenholme, G. Klugman, K. P. Bonomo, R. A. Rice, L. B.
Wagener, M. M. McCormack J. G. & Yu, V. L. (2004). Antibiotic therapy for
Klebsiella pneumoniae bacteremia: implications of production of extended-spectrum
beta-lactamases. Clin. Infect. Dis. 39, 31-37.
Pearson, B. M., Pin, C., Wright, J., I'Anson, K., Humphrey, T. & Wells, J. M. (2003).
Comparative genome analysis of Campylobacter jejuni using whole genome DNA
microarrays. FEBS. Lett. 554, 224-230.
Persson, S. & Olsen, K. E. (2005). Multiplex PCR for identification of Campylobacter
coli and Campylobacter jejuni from pure cultures and directly on stool samples. J. Med.
Microbiol. 54, 1043-1047.
Petersen, L., Nielsen, E. M., Engberg, J., On, S. L. & Dietz, H. H. (2001). Comparison
of genotypes and serotypes of Campylobacter jejuni isolated from Danish wild
mammals and birds and from broiler flocks and humans. Appl. Environ. Microbiol. 67,
3115-3121.
Pieper, U., Eswar, N., Davis, F. P., Braberg, H., Madhusudhan, M. S., Rossi, A., Marti-
Renom, M., Karchin, R., Webb, B. M., Eramian, D., Shen, M. Y., Kelly, L., Melo, F.
& Sali, A. (2006). MODBASE: a database of annotated comparative protein structure
models and associated resources. Nucleic. Acids. Res. 34, D291-295.
179
Pintar, K. D. M., Thomas, K. M., Christidis, T., Otten, A., Nesbitt, A., Marshall, B.,
Pollari, F. Hurst, M. & Ravel, A. (2017). A Comparative Exposure Assessment of
Campylobacter in Ontario, Canada. Risk Anal. 37, 677-715.
Piras, A. M., Maisetta, G., Sandreschi, S., Gazzarri, M., Bartoli, C., Grassi, L., Esin, S.,
Chiellini, F., & Batoni, G. (2015). Chitosan nanoparticles loaded with the antimicrobial
peptide temporin B exert a long-term antibacterial activity in vitro against clinical
isolates of Staphylococcus epidermidis. Front. Microbiol. 6, 372.
Platts-Mills, J. A., Babji, S., Bodhidatta, L., Gratz, J., Haque, R., Havt, A.,
Investigators, MAL-ED Network. (2015). Pathogen-specific burdens of community
diarrhoea in developing countries: a multisite birth cohort study (MAL-ED). Lancet.
Glob. Health. 3, e564-575.
Poly, F. & Guerry, P. (2008). Pathogenesis of Campylobacter. Curr. Opin.
Gastroenterol. 24, 27-31.
Poly, F., Ewing, C., Goon, S., Hickey, T. E., Rockabrand, D., Majam, G., Lee, L., Phan,
J., Savarino N. J., & Guerry, P. (2007). Heterogeneity of a Campylobacter jejuni protein
that is secreted through the flagellar filament. Infect. Immun. 75, 3859-3867.
Pozidis, C., Chalkiadaki, A., Gomez-Serrano, A., Stahlberg, H., Brown, I., Tampakaki,
A. P., Lustig, A., Sianidis, G., Politou, A. S., Engel, A., Panopoulos, N. J., Mansfield,
J., Pugsley, A. P., Karamanou S. & Economou, A. (2003). Type III protein translocase:
HrcN is a peripheral ATPase that is activated by oligomerization. J. Biol. Chem. 278,
25816-25824.
Pukatzki, S., Ma, A. T., Revel, A. T., Sturtevant, D. & Mekalanos, J. J. (2007). Type
VI secretion system translocates a phage tail spike-like protein into target cells where
it cross-links actin. Proc. Natl. Acad. Sci. U.S.A. 104, 15508-15513.
Pukatzki, S., McAuley, S. B. & Miyata, S. T. (2009). The type VI secretion system:
translocation of effectors and effector-domains. Curr. Opin. Microbiol. 12, 11-17.
Rajendran, P., Babji, S., George, A. T., Rajan, D. P., Kang, G., & Ajjampur, S. S.
(2012). Detection and species identification of Campylobacter in stool samples of
children and animals from Vellore, south India. Indian J. Med. Microbiol. 30, 85-88.
doi:10.4103/0255-0857.93049
Raman, K., Yeturu, K. & Chandra, N. (2008). targetTB: a target identification pipeline
for Mycobacterium tuberculosis through an interactome, reactome and genome-scale
structural analysis. BMC Syst. Biol. 2, 109.
Ramos, J. L., Gallegos, M. T., Marqués, S., Ramos-González, M. I., Espinosa-Urgel,
M. & Segura, A. (2001). Responses of Gram-negative bacteria to certain environmental
stressors. Curr. Opin. Microbiol., 4, 166-171.
Rampino, A., Borgogna, M., Blasi, P., Bellich, B. & Cesàro, A. (2013). Chitosan
nanoparticles: preparation, size evolution and stability. Int. J. Pharm. 455, 219-228.
180
Reddy, K. M., Feris, K., Bell, J., Wingett, D. G., Hanley, C. & Punnoose, A. (2007).
Selective toxicity of zinc oxide nanoparticles to prokaryotic and eukaryotic systems.
Appl. Phys. Lett. 90, 2139021-2139023.
Reezal, A., McNeil, B. & Anderson, J. G. (1998). Effect of low-osmolality nutrient
media on growth and culturability of Campylobacter species. Appl. Environ. Microbiol.
64, 4643-4649.
Rêgo, A. T., Chandran, V. & Waksman, G. (2010). Two-step and one-step secretion
mechanisms in Gram-negative bacteria: contrasting the type IV secretion system and
the chaperone-usher pathway of pilus biogenesis. Biochem. J. 425, 475-488.
Reuter, M., Mallett, A., Pearson, B. M. & van Vliet, A. H. (2010). Biofilm formation
by Campylobacter jejuni is increased under aerobic conditions. Appl. Environ.
Microbiol. 76, 2122-2128.
Riaz, S., Faisal, M. & Hasnain, S. (2011). Antibiotic susceptibility pattern and multiple
antibiotic resistances (MAR) calculation of extended spectrum β- lactamase (ESBL)
producing Escherichia coli and Klebsiella species in Pakistan. Afri. J. Biotechnol. 10,
6325-6331.
Riddle, M.S. & Guerry, P. (2016). Status of vaccine research and development for
Campylobacter jejuni. Vaccine. 34, 2903-2906.
Ridley, A. M., Morris, V. K., Cawthraw, S. A., Ellis-Iversen, J., Harris, J. A., Kennedy,
E. M., Newell D. G. & Allen, V. M. (2011). Longitudinal molecular epidemiological
study of thermophilic campylobacters on one conventional broiler chicken farm. Appl
Environ Microbiol, 77(1), 98-107. doi:10.1128/AEM.01388-10
Ridley, A. M., Toszeghy, M. J., Cawthraw, S. A., Wassenaar, T. M. & Newell, D. G.
(2008). Genetic instability is associated with changes in the colonization potential of
Campylobacter jejuni in the avian intestine. J. Appl. Microbiol. 105, 95-104.
doi:10.1111/j.1365-2672.2008.03759.x
Rocha, E.P. & Danchin, A. (2003). Essentiality, not expressiveness, drives gene-strand
bias in bacteria. Nat. Genet. 34, 377-378.
Rollins, D. M., & Colwell, R. R. (1986). Viable but nonculturable stage of
Campylobacter jejuni and its role in survival in the natural aquatic environment. Appl.
Environ. Microbiol. 52, 531-538.
Roop, R. M., Smibert, R. M., Johnson, J. L. & Krieg, N. R. (1984). Differential
characteristics of catalase-positive campylobacters correlated with DNA homology
groups. Can. J. Microbiol. 30, 938-951.
Rosenberg, M. (2006). Microbial adhesion to hydrocarbons: twenty-five years of doing
MATH. FEMS. Microbiol. Lett. 262, 129-134.
181
Rosenquist, H., Nielsen, N. L., Sommer, H. M., Nørrung, B. & Christensen, B. B.
(2003). Quantitative risk assessment of human campylobacteriosis associated with
thermophilic Campylobacter species in chickens. Int. J. Food Microbiol. 83, 87-103.
Ruiz, F. M., Santillana, E., Spínola-Amilibia, M., Torreira, E., Culebras, E. & Romero,
A. (2015). Crystal Structure of Hcp from Acinetobacter baumannii: A Component of
the Type VI Secretion System. PLoS One. 10, e0129691.
Russell, A. B., Peterson, S. B. & Mougous, J. D. (2014). Type VI secretion system
effectors: poisons with a purpose. Nat. Rev. Microbiol. 12, 137-148.
Saint-Cyr, M. J., Guyard-Nicodème, M., Messaoudi, S., Chemaly, M., Cappelier, J. M.,
Dousset, X. & Haddad, N. (2016). Recent Advances in Screening of Anti-
Campylobacter Activity in Probiotics for Use in Poultry. Front. Microbiol. 7, 553.
Sampathkumar, B., Khachatourians, G. G. & Korber, D. R. (2003). High pH during
trisodium phosphate treatment causes membrane damage and destruction of Salmonella
enterica serovar enteritidis. Appl. Environ. Microbiol. 69, 122-129.
Sanders, S. Q., Frank, J. F. & Arnold, J. W. (2008). Temperature and nutrient effects
on Campylobacter jejuni attachment on multispecies biofilms on stainless steel. J.
Food. Prot. 71, 271-278.
Saran, S., Bisht, M.S., Singh, K. & Teotia, U.V.S. (2012). Comparing adhesion
attributes of two isolates of Lactobacillus acidophilus for assessment of prebiotics,
honey and inulin. Int. J Sci. Res. 2, 1-7.
Sarker, S. D., Nahar, L. & Kumarasamy, Y. (2007). Microtitre plate-based antibacterial
assay incorporating resazurin as an indicator of cell growth, and its application in the
in vitro antibacterial screening of phytochemicals. Methods. 42, 321-324.
Sauer, K., Cullen, M. C., Rickard, A. H., Zeef, L. A., Davies, D. G. & Gilbert, P. (2004).
Characterization of nutrient-induced dispersion in Pseudomonas aeruginosa PAO1
biofilm. J. Bacteriol. 186, 7312-7326.
Saxena, Manvendra, John, Binu, Mu, Monica, Van, Thi Thu Hao, Taki, Aya, Coloe,
Peter J. & Smooker, Peter M. (2013). Strategies to Reduce Campylobacter Colonisation
in Chickens. Procedia. Vaccinol, 7, 40-43.
Schwarz, S., Hood, R. D. & Mougous, J. D. (2010). What is type VI secretion doing in
all those bugs? Trends. Microbiol. 18, 531-537.
Seal, B. S., Lillehoj, H. S., Donovan, D. M. & Gay, C. G. (2013). Alternatives to
antibiotics: a symposium on the challenges and solutions for animal production. Anim.
Health. Res. Rev. 14, 78-87.
182
Sears, A., Baker, M. G., Wilson, N., Marshall, J., Muellner, P., Campbell, D. M., Lake
R. J. & French, N. P. (2011). Marked campylobacteriosis decline after interventions
aimed at poultry, New Zealand. Emerg. Infect. Dis. 17, 1007-1015.
Sha, J., Rosenzweig, J. A., Kozlova, E. V., Wang, S., Erova, T. E., Kirtley, M. L., van
Lier C. J. & Chopra, A. K. (2013). Evaluation of the roles played by Hcp and VgrG
type 6 secretion system effectors in Aeromonas hydrophila SSU pathogenesis.
Microbiology. 159, 1120-1135.
Shah, B., Davidson, P. M. & Zhong, Q. (2012). Nanocapsular dispersion of thymol for
enhanced dispersibility and increased antimicrobial effectiveness against Escherichia
coli O157:H7 and Listeria monocytogenes in model food systems. Appl. Environ.
Microbiol, 78, 8448-8453.
Shah, N. A., Khan, M. R. & Nadhman, A. (2014). Antileishmanial, Toxicity, and
Phytochemical Evaluation of Medicinal Plants Collected from Pakistan. Biomed. Res.
Int. 2014, 384204
Shanmugham, B. & Pan, A. (2013). Identification and characterization of potential
therapeutic candidates in emerging human pathogen Mycobacterium abscessus: a novel
hierarchical in silico approach. PLoS One. 8, e59126.
Sharma, H., Unicomb, L., Forbes, W., Djordjevic, S., Valcanis, M., Dalton, C. &
Ferguson, J. (2003). Antibiotic resistance in Campylobacter jejuni isolated from
humans in the Hunter Region, New South Wales. Commun. Dis. Intell. Q. Rep. 27, S80-
88.
Shneider, M. M., Buth, S. A., Ho, B. T., Basler, M., Mekalanos, J. J. & Leiman, P. G.
(2013). PAAR-repeat proteins sharpen and diversify the type VI secretion system spike.
Nature. 500, 350-353.
Si, M., Wang, Y., Zhang, B., Zhao, C., Kang, Y., Bai, H., Wei, D., Zhu, L., Zhang, L.,
Dong, T. G. & Shen, X. (2017). The Type VI Secretion System Engages a Redox-
Regulated Dual-Functional Heme Transporter for Zinc Acquisition. Cell Rep. 20, 949-
959.
Siddiqui, F. M., Akram, M., Noureen, N., Noreen, Z. & Bokhari, H. (2015). Antibiotic
susceptibility profiling and virulence potential of Campylobacter jejuni isolates from
different sources in Pakistan. Asian. Pac. J. Trop. Med. 8, 197-202.
Siddiqui, F. M., Ibrahim, M., Noureen, N., Noreen, Z., Titball, R. W., Champion, O.
L., Wren, B. W., Studholme D. & Bokhari, H. (2015). Draft Genome Sequence of the
Enteropathogenic Bacterium Campylobacter jejuni Strain cj255. Genome Announc. 3.
e01223-15.
Siddiqui, F., Champion, O., Akram, M., Studholme, D., Eqani, S. A., Wren, B. W.,
Titball, R. & Bokhari, H. (2015). Molecular detection identified a type six secretion
system in Campylobacter jejuni from various sources but not from human cases. J.
Appl. Microbiol. 118, 1191-1198.
183
Silva, J., Leite, D., Fernandes, M., Mena, C., Gibbs, P. A. & Teixeira, P. (2011).
Campylobacter spp. as a Foodborne Pathogen: A Review. Front. Microbiol. 2, 200.
Silverman, J. M., Brunet, Y. R., Cascales, E., & Mougous, J. D. (2012). Structure and
regulation of the type VI secretion system. Annu. Rev. Microbiol. 66, 453-472.
Singh, A., Mallick, K., Banerjee, M., Kumar, R. (2016). Loss of outer membrane
integrity in Gram-negative bacteria by silver nanoparticles loaded with Camellia
sinensis leaf phytochemicals: plausible mechanism of bacterial cell disintegration. Bull.
of Mater. Sci. 39, 1871-1878.
Skehan, P., Storeng, R., Scudiero, D., Monks, A., McMahon, J., Vistica, D., Warren, J.
T., Bokesch, H., Kenney, S. & Boyd, M. R. (1990). New colorimetric cytotoxicity assay
for anticancer-drug screening. J. Natl. Cancer. Inst. 82, 1107-1112.
Skirrow, M. B. (1977). Campylobacter enteritis: a "new" disease. Br. Med. J. 2, 9-11.
Skovgaard, N. (2007). New trends in emerging pathogens. Int. J. Food. Microbiol. 120,
217-224.
Smith, J. L. & Fratamico, P. M. (2010). Fluoroquinolone resistance in campylobacter.
J. Food. Prot. 73, 1141-1152.
Smith, T. (1919). The Etiological Relation of Spirilla (Vibrio fetus) to Bovine Abortion.
J. Exp. Med. 30, 313-323.
Song, Y. C., Jin, S., Louie, H., Ng, D., Lau, R., Zhang, Y., Weerasekera, R., Al Rashid,
S., Ward, L. A., Der, S. D. & Chan, V. L. (2004). FlaC, a protein of Campylobacter
jejuni TGH9011 (ATCC43431) secreted through the flagellar apparatus, binds
epithelial cells and influences cell invasion. Mol. Microbiol. 53, 541-553.
Soofi, S. B., Habib, M. A., von Seidlein, L., Khan, M. J., Muhammad, S., Bhutto, N.,
Khan, M. I., Rasool, S., Zafar, A., Clemens, J. D., Nizami, Q. & Bhutta, Z. A. (2011).
A comparison of disease caused by Shigella and Campylobacter species: 24 months
community based surveillance in 4 slums of Karachi, Pakistan. J. Infect. Public. Health.
4, 12-21.
Sotelo-Boyás, M.E., Correa-Pacheco, Z.N., Bautista-Baños, S. & Corona-Rangel, M.L.
(2017). Physicochemical characterization of chitosan nanoparticles and nanocapsules
incorporated with lime essential oil and their antibacterial activity against food-borne
pathogens. LWT. Food. Sci. Technol.77, 15-20.
Stabler, R. A., Larsson, J. T., Al-Jaberi, S., Nielsen, E. M., Kay, E., Tam, C. C., Higgins,
C. D., Rodrigues, L. C., Richardson, J. F., O'Brien, S. J.& Wren, B. W. (2013).
Characterization of water and wildlife strains as a subgroup of Campylobacter jejuni
using DNA microarrays. Environ. Microbiol. 15, 2371-2383.
184
Stern, N. J., Svetoch, E. A., Eruslanov, B. V., Kovalev, Y. N., Volodina, L. I.,
Perelygin, V. V., Mitsevich, E. V., Mitsevich, I. P. & Levchuk, V. P. (2005).
Paenibacillus polymyxa purified bacteriocin to control Campylobacter jejuni in
chickens. J. Food. Prot. 68, 1450-1453.
Stern, N. J., Svetoch, E. A., Eruslanov, B. V., Perelygin, V. V., Mitsevich, E. V.,
Mitsevich, I. P., Pokhilenko, V. D., Levchuk, V. P., Svetoch, O. E. & Seal, B. S. (2006).
Isolation of a Lactobacillus salivarius strain and purification of its bacteriocin, which is
inhibitory to Campylobacter jejuni in the chicken gastrointestinal system. Antimicrob.
Agents. Chemother. 50(9), 3111-3116.
Suarez, G., Sierra, J. C., Kirtley, M. L. & Chopra, A. K. (2010). Role of Hcp, a type 6
secretion system effector, of Aeromonas hydrophila in modulating activation of host
immune cells. Microbiology. 156, 3678-3688.
Svetoch, E. A., Eruslanov, B. V., Perelygin, V. V., Mitsevich, E. V., Mitsevich, I. P.,
Borzenkov, V. N., Levchuk, V. P., Svetoch, O. E., Kovalev, Y. N., Stepanshin, Y. G.,
Siragusa, G. R., Seal, B. S. & Stern, N. J. (2008). Diverse antimicrobial killing by
Enterococcus faecium E 50-52 bacteriocin. J. Agric. Food. Chem. 56, 1942-1948.
Szymanski, C. M., Burr, D. H. & Guerry, P. (2002). Campylobacter protein
glycosylation affects host cell interactions. Infect. Immun. 70, 2242-2244.
Szymanski, C. M., Logan, S. M., Linton, D. & Wren, B. W. (2003). Campylobacter--a
tale of two protein glycosylation systems. Trends. Microbiol. 11, 233-238.
Tangwatcharin, P., Chanthachum, S., Khopaibool, P. & Griffiths, M. W. (2006).
Morphological and physiological responses of Campylobacter jejuni to stress. J. Food.
Prot. 69, 2747-2753.
Taylor, E. V., Herman, K. M., Ailes, E. C., Fitzgerald, C., Yoder, J. S., Mahon, B. E.
& Tauxe, R. V. (2013). Common source outbreaks of Campylobacter infection in the
USA, 1997-2008. Epidemiol. Infect. 141, 987-996.
Thies, K. L. & F. R. Champlin. (1989). Compositional factors influencing cell surface
hydrophobicity of Pasteurella multocida variants. Curr. Microbiol. 8, 385–390.
Thomas, C., Gibson, H., Hill, D. J. & Mabey, M. (1998). Campylobacter epidemiology:
an aquatic perspective. J. Appl. Microbiol. 85, 168S-177S.
Tian, Y., Zhao, Y., Wu, X., Liu, F., Hu, B. & Walcott, R. R. (2015). The type VI protein
secretion system contributes to biofilm formation and seed-to-seedling transmission of
Acidovorax citrulli on melon. Mol. Plant. Pathol. 16, 38-47.
Turonova, H., Briandet, R., Rodrigues, R., Hernould, M., Hayek, N., Stintzi, A.,
Pazlarova, J. &. Tresse, O. (2015). Biofilm spatial organization by the emerging
pathogen Campylobacter jejuni: comparison between NCTC 11168 and 81-176 strains
under microaerobic and oxygen-enriched conditions. Front. Microbiol. 6, 709.
185
Valderrama, A., & Rojas De, G. (2017). Traceability of Active Compounds of Essential
Oils in Antimicrobial Food Packaging Using a Chemometric Method by ATR-
FTIR. Am. J. Analyt. Chem. 8, 726-741.
Vandenberg, G. W. & De La Noue, J. (2001). Evaluation of protein release from
chitosan-alginate microcapsules produced using external or internal gelation. J.
Microencapsul. 18, 433-441.
Vardakas, K. Z., Tansarli, G. S., Rafailidis, P. I. & Falagas, M. E. (2012). Carbapenems
versus alternative antibiotics for the treatment of bacteraemia due to Enterobacteriaceae
producing extended-spectrum β-lactamases: a systematic review and meta-analysis. J.
Antimicrob. Chemother. 67, 2793-2803.
Vegge, C. S., Brøndsted, L., Ligowska-Marzęta, M. & Ingmer, H. (2012). Natural
transformation of Campylobacter jejuni occurs beyond limits of growth. PLoS One. 7,
e45467.
Velho-Pereira, S., Noronha, A., Mathias, A., Zakane, R., Naik, V., Naik, P., Salker, A.
V. & Naik, S. R. (2015). Antibacterial action of doped CoFe2O4 nanocrystals on
multidrug resistant bacterial strains. Mater. Sci. Eng. C. Mater. Biol. Appl. 52, 282-287.
Verbeke, W., Frewer, L. J., Scholderer, J., & De Brabander, H. F. (2007). Why
consumers behave as they do with respect to food safety and risk information. Anal.
Chim. Acta. 586, 2-7.
Vettiger, A. & Basler, M. (2016). Type VI Secretion System Substrates Are Transferred
and Reused among Sister Cells. Cell, 167, 99-110.
Vinzent, R. (1950). Human infection due to Vibrio foetus. Nourrisson. 38, 96-98.
Wagenaar, J. A., Mevius, D. J. & Havelaar, A. H. (2006). Campylobacter in primary
animal production and control strategies to reduce the burden of human
campylobacteriosis. Rev. Sci. Tech. 25, 581-594.
Wang, Q, Shi, Y., Yang, G. & Zhao, L. (2017). Sodium Alginate Coated Chitosan
Nanoparticles Enhance Antitumor Efficiency via Smartly Regulating Drug Release at
Different pH. J. Biomater. Tissue Eng. 7, 127-133.
Wang, W. J., Wang, Q., Zhang, Y., Lu, R., Zhang, Y. L., Yang, K. W., Lei. J. E., & He,
Y. (2017). Characterization of β-lactamase activity using isothermal titration
calorimetry. Biochim. Biophys. Acta. Gen. Subj. 1861, 2031-2038.
Wardak, S., Szych, J. & Duda, U. (2007). Antimicrobial susceptibilities of
Campylobacter sp strains isolated from humans in 2005 to 2006 in Bielsko-Biala
Region, Poland. Med. Dosw. Mikrobiol. 59, 43-49.
Wardlaw, T., Salama, P., Brocklehurst, C., Chopra, M. & Mason, E. (2010). Diarrhoea:
whychildren are still dying and what can be done. Lancet, 375(9718), 870-872.
186
Wassenaar, T. M. & Blaser, M. J. (1999). Pathophysiology of Campylobacter jejuni
infections of humans. Microbes. Infect. 1, 1023-1033.
Whiley, H., van den Akker, B., Giglio, S. & Bentham, R. (2013). The role of
environmental reservoirs in human campylobacteriosis. Int. J. Environ. Res. Public.
Health. 10, 5886-5907.
Whitehouse, C. A., Balbo, P. B., Pesci, E. C., Cottle, D. L., Mirabito, P. M. & Pickett,
C. L. (1998). Campylobacter jejuni cytolethal distending toxin causes a G2-phase cell
cycle block. Infect. Immun. 66, 1934-1940.
Wieczorek, K. & Osek, J. (2013). Antimicrobial resistance mechanisms among
Campylobacter. Biomed. Res. Int. 2013, 340605.
Wilson, D. J., Gabriel, E., Leatherbarrow, A. J., Cheesbrough, J., Gee, S., Bolton, E.,
Fox, A., Hart, C. A. & Diggle, P. J. (2008). Tracing the source of campylobacteriosis.
PLoS. Genet. 4, e1000203.
Wilson, D. J., Gabriel, E., Leatherbarrow, A. J., Cheesbrough, J., Gee, S., Bolton, E.,
Fox, A., Hart, C. A., Diggle, P. J. & Fearnhead, P. (2009). Rapid evolution and the
importance of recombination to the gastroenteric pathogen Campylobacter jejuni. Mol.
Biol. Evol. 26, 385-397. doi:10.1093/molbev/msn264
Wishart, D. S., Knox, C., Guo, A. C., Shrivastava, S., Hassanali, M., Stothard, P.,
Chang Z. & Woolsey, J. (2006). DrugBank: a comprehensive resource for in silico drug
discovery and exploration. Nucleic Acids. Res. 34, D668-672.
Wösten, M. M., Wagenaar, J. A. & van Putten, J. P. (2004). The FlgS/FlgR two-
component signal transduction system regulates the fla regulon in Campylobacter
jejuni. J. Biol. Chem. 279, 16214-16222.
World Health Orgnization, Food and Agriculture Organization of the United Nations,
World Organisation for Animal Health (2012). The global view of campylobacteriosis:
report of an expert consultation, Utrecht, Netherlands, 9–11 July 2012. Geneva,
Switzerland
World Health Orgnization (2017a). Diarrhoeal disease fact sheet, 2017. Available
online: http://www.who.int/news-room/fact-sheets/detail/diarrhoeal-disease [Accessed
on Jun 26, 2018]
World Health Organization. (2017b). Global priority list ofantibiotic-resistant bacteria
to guide research, discovery, and development of new antibiotics. WHO Press. pp. 1-7.
Xie, Y., He, Y., Irwin, P. L., Jin, T. & Shi, X. (2011). Antibacterial activity and
mechanism of action of zinc oxide nanoparticles against Campylobacter jejuni. Appl.
Environ. Microbiol. 77, 2325-2331.
187
Yong, D., Lee, K., Yum, J. H., Shin, H. B., Rossolini, G. M. & Chong, Y. (2002).
Imipenem-EDTA disk method for differentiation of metallo-beta-lactamase-producing
clinical isolates of Pseudomonas spp. and Acinetobacter spp. J. Clin. Microbiol. 40,
3798-3801.
Yong, D., Toleman, M. A., Giske, C. G., Cho, H. S., Sundman, K., Lee, K. & Walsh,
T. R. (2009). Characterization of a new metallo-beta-lactamase gene, bla(NDM-1), and
a novel erythromycin esterase gene carried on a unique genetic structure in Klebsiella
pneumoniae sequence type 14 from India. Antimicrob. Agents. Chemother. 53, 5046-
5054.
Yoon, S. S., Hennigan, R. F., Hilliard, G. M., Ochsner, U. A., Parvatiyar, K., Kamani,
M. C., Allen, H. L., DeKievit, T. R., Gardner, P. R., Schwab, U., Rowe, J. J., Iglewski,
B. H., McDermott, T. R., Mason, R. P., Wozniak, D. J., Hancock, R. E., Parsek, M. R.,
Noah, T. L., Boucher R. C. & Hassett, D. J. (2002). Pseudomonas aeruginosa anaerobic
respiration in biofilms: relationships to cystic fibrosis pathogenesis. Dev. Cell. 3, 593-
603.
Young, G. M., Schmiel, D. H. & Miller, V. L. (1999). A new pathway for the secretion
of virulence factors by bacteria: the flagellar export apparatus functions as a protein-
secretion system. Proc. Natl. Acad. Sci. U.S.A. 96, 6456-6461.
Young, K. T., Davis, L. M. & Dirita, V. J. (2007). Campylobacter jejuni: molecular
biology and pathogenesis. Nat. Rev. Microbiol. 5, 665-679.
Zhang, B., Kirov, S. & Snoddy, J. (2005). WebGestalt: an integrated system for
exploring gene sets in various biological contexts. Nucleic Acids. Res., 33, W741-748.
Zhang, R. & Lin, Y. (2009). DEG 5.0, a database of essential genes in both prokaryotes
and eukaryotes. Nucleic Acids. Res. 37, D455-458.
Zheng, J. & Leung, K. Y. (2007). Dissection of a type VI secretion system in
Edwardsiella tarda. Mol. Microbiol. 66, 1192-1206.
Zhou, Y., Tao, J., Yu, H., Ni, J., Zeng, L., Teng, Q., K. S., Zhao, G. P., Guo X. & Yao,
Y. (2012). Hcp family proteins secreted via the type VI secretion system coordinately
regulate Escherichia coli K1 interaction with human brain microvascular endothelial
cells. Infect. Immun. 80, 1243-1251.
188
Annexure
189
Metadata of C. jejuni positive samples
Sample
ID
Date City Gender Age Fever
(C)
Diarrhoea/watery
diarrhoea/bloody
diarrhoea
Income
group
Dehydration Group
Predicted
MAR
index
BH1 Jan-15 Rawalpindi Male 9 Months 37.5 Watery diarrhoea LIC Severe C7/C8 0.64
BH2 Jan-15 Rawalpindi Male 9 Months 37.5 Watery diarrhoea LIC Severe C9 0.71
BH3 Jan-15 Rawalpindi Male 3 Months 38 Watery diarrhoea LIC Severe C1/C2/C3 0.57
BH4 Jan-15 Rawalpindi Male 8 Months 37 Watery diarrhoea LIC Severe C7/C8 0.50
BH5 Jan-15 Rawalpindi Male 3 years 38 Diarrhoea LIC Some C7/C8 0.57
BH6 Jan-15 Rawalpindi Male 3 years 37.5 Watery diarrhoea LIC Severe C7/C8 0.64
BH7 Jan-15 Rawalpindi Female 5 months 38 Watery diarrhoea LIC Severe C7/C8 0.43
BH11 Jan-15 Rawalpindi Female 3.5 Months 38 Watery diarrhoea LIC Severe C9 0.64
BH12 Jan-15 Rawalpindi Female 1 year 38 Watery diarrhoea LIC Severe C4/C6 0.79
BH14A Jan-15 Rawalpindi Female 10 months 37.5 Diarrhoea LIC Some C1/C2/C3 0.79
BH15 Jan-15 Rawalpindi Male 7 Months 38 Diarrhoea LIC Some C5 0.71
BH20 Jan-15 Rawalpindi Female 1.5 years 37.5 Diarrhoea LIC Some C4/C6 0.64
BH21 Jan-15 Rawalpindi Female 8 Months 37 Diarrhoea LIC Some C5 0.71
BH22 Jan-15 Rawalpindi Male 11 months 37 Diarrhoea LIC Some C4/C6 0.50
BH24 Jan-15 Rawalpindi Female 8 Months 37 diarrhoea LIC Some C7/C8 0.57
190
BH26 Jan-15 Rawalpindi Male 8 Months 38 Watery diarrhoea LIC Severe C9 0.43
BH28 Jan-15 Rawalpindi Male 10 months 38 Diarrhoea LIC Some C9 0.43
BH31 Jan-15 Rawalpindi Female 4 months 37.5 Watery diarrhoea LIC Severe C7/C8 0.64
BH35 Jan-15 Rawalpindi Female 2 months 38 diarrhoea LIC Some C7/C8 0.43
BH37 Jan-15 Rawalpindi Male 9 Months 38 diarrhoea LIC Some C1/C2/C3 0.71
BH39 Jan-15 Rawalpindi Male 4 months 37.5 Watery diarrhoea LIC Severe C7/C8 0.57
BH44 Jan-15 Rawalpindi Male 7 Months 38 Watery diarrhoea LIC Severe C4/C6 0.79
RPH1 May-15 Islamabad Female 5 months 37.5 Diarrhoea MIC Some C4/C6 0.71
RPH2 May-15 Islamabad Female 2 years 37.5 Watery diarrhoea MIC Severe C1/C2/C3 0.71
RPH3 May-15 Islamabad Male 3month 37.5 Watery diarrhoea MIC Severe C9 0.50
LH1
(s1)
May-15 Lahore Male 5years 37.5 Watery diarrhoea MIC Severe C4/C6 0.79
LH3
(s2)
May-15 Lahore Male 3 years 37.5 Watery diarrhoea MIC Severe C4/C6 0.79
st Aug-15 Peshawar Female 1 year 38 Bloody Diarrhoea MIC Severe C9 0.64
SH6 May-15 Khairpur Female 10 months 37.5 Watery diarrhoea LIC Severe C1/C2/C3 0.64
SH8 May-15 Khairpur Female 4.5 years 37.5 Watery diarrhoea LIC Severe C4/C6 0.79
SH10 May-15 Khairpur Male 2.5 years 37 Watery diarrhoea LIC Severe C1/C2/C3 0.79
SH10J May-15 Khairpur Female 1 year 37.5 Watery diarrhoea LIC Severe C4/C6 0.71
191
SH11 May-15 Khairpur Female 3.5 years 37 Watery diarrhoea LIC Severe C5 0.71
SH17 May-15 Khairpur Male 10 months 37 Watery diarrhoea LIC Severe C7/C8 0.50
SH19 May-15 Khairpur Male 4 years 37.5 Watery diarrhoea LIC Severe C5 0.71
SH32 May-15 Khairpur Female 3 years 37.5 Watery diarrhoea LIC Severe C4/C6 0.64
SH56 May-15 Khairpur Female 11 months 37.5 Watery diarrhoea LIC Severe C1/C2/C3 0.71
SH58 May-15 Khairpur Female 2.5 years 37.5 Watery diarrhoea LIC Severe C4/C6 0.79
SH60 May-15 Khairpur Male 5 years 37.5 Watery diarrhoea LIC Severe C4/C6 0.64
SH61 May-15 Khairpur Female 3.5 years 37.5 Watery diarrhoea LIC Severe C7/C8 0.71
SH64 May-15 Khairpur Female 1 year 37 Watery diarrhoea LIC Severe C4/C6 0.71
PH2 Jul-15 Peshawar Male 2.5 years 37.5 Watery diarrhoea MIC Severe C5 0.71
PH7 Jul-15 Peshawar Male 3 years 37.5 Watery diarrhoea LIC Severe C4/C6 0.64
PH8 Jul-15 Peshawar Male 4 years 37 Watery diarrhoea MIC Severe C5 0.64
PH9 Jul-15 Peshawar Male 1.25 year 37.5 Watery diarrhoea LIC Severe C5 0.50
PH11 Jul-15 Peshawar Male 8 months 37.5 Watery diarrhoea MIC Severe C1/C2/C3 0.71
PH12 Jul-15 Peshawar Male 3 years 37.5 Watery diarrhoea LIC Severe C5 0.64
PH13 Jul-15 Peshawar Male 1.5 years 37.5 Diarrhoea LIC Some C4/C6 0.57
PH14 Jul-15 Mardan Male 1 year 37.5 Watery diarrhoea LIC Severe C7/C8 0.64
PH15 Jul-15 Mardan Male 6 months 37.5 Watery diarrhoea LIC Severe C1/C2/C3 0.64
192
PH16 Jul-15 Mardan Male 2.5 years 37 Watery diarrhoea LIC Severe C5 0.71
PH17 Jul-15 Peshawar Male 2.5 years 37.5 Watery diarrhoea MIC Severe C4/C6 0.57
PH18 Jul-15 Peshawar Male 10 months 37.5 Watery diarrhoea LIC Severe C7/C8 0.50
PH19 Jul-15 Peshawar Male 3 years 37 Watery diarrhoea MIC Severe C4/C6 0.64
PH20 Jul-15 Peshawar Male 4.5 years 37.5 Watery diarrhoea MIC Severe C7/C8 0.50
PH21 Jul-15 Peshawar Male 1.5 years 37.5 Watery diarrhoea LIC Severe C1/C2/C3 0.64
PH22 Jul-15 Peshawar Male 11 months 37.5 Watery diarrhoea LIC Severe C5 0.71
PH25 Jul-15 Nowshera Male 5 years 37 Watery diarrhoea LIC Severe C4/C6 0.79
PH26 Jul-15 Nowshera Male 1.5 years 37.5 Watery diarrhoea LIC Severe C4/C6 0.64
PH28 Jul-15 Peshawar Male 1.5 years 37.5 Watery diarrhoea MIC Severe C5 0.71
PH29 Jul-15 Peshawar Male 2 years 37 Watery diarrhoea LIC Severe C4/C6 0.71
PH30 Jul-15 Peshawar Male 1.5 years 37 Watery diarrhoea LIC Severe C5 0.64
PH30A Jul-15 Peshawar Male 3 years 37.5 Watery diarrhoea MIC Severe C9 0.50
MC4 May-15 Nowshera Male 3 years 37.5 Watery diarrhoea LIC Severe C5 0.64
MC7 May-15 Nowshera Male 2.5 years 37.5 Watery diarrhoea LIC Severe C7/C8 0.57
MC8 May-15 Mardan Male 1.5 years 37.5 Watery diarrhoea LIC Severe C1/C2/C3 0.64
MC9 May-15 Mardan Male 4.5 years 37.5 Watery diarrhoea LIC Severe C7/C8 0.57
MC13 May-15 Mardan Male 3 years 37.5 Watery diarrhoea LIC Severe C7/C8 0.64
193
AS3 Aug-15 Islamabad Male 2 months 37.5 Diarrhoea MIC Some C9 0.36
AS5 Aug-15 Islamabad Female 1 year 37 Diarrhoea LIC Some C1/C2/C3 0.57
AS8 Aug-15 Islamabad Male 11 months 37.5 Watery diarrhoea LIC Severe C9 0.43
AS10 Aug-15 Islamabad Male 4 months 37.5 Watery diarrhoea LIC Severe C7/C8 0.64
AS11 Aug-15 Islamabad Male 6 months 37.5 Watery diarrhoea MIC Severe C9 0.36
AS31 Aug-15 Islamabad Female 11 months 38 Diarrhoea LIC Some C9 0.36
AS38 Aug-15 Islamabad Female 10 months 37.5 Watery diarrhoea LIC Severe C4/C6 0.71
AS51 Aug-15 Islamabad Male 4 months 38 Watery diarrhoea LIC Severe C1/C2/C3 0.71
AS59 Aug-15 Islamabad Female 8 Months 37.5 Diarrhoea LIC Some C9 0.50
AS65 Aug-15 Islamabad Male 8 Months 37 Watery diarrhoea MIC Severe C7/C8 0.50
AS70 Aug-15 Islamabad Male 1 year 37 Diarrhoea LIC Some C4/C6 0.71
AS74 Aug-15 Islamabad Female 2 years 37.5 Diarrhoea LIC Some C9 0.36
AS85 Aug-15 Islamabad Female 11 months 37.5 Diarrhoea LIC Some C9 0.64
AS89 Aug-15 Islamabad Female 3.5 years 38 Watery diarrhoea LIC Severe C7/C8 0.43
LIC-low income group
MIC- middle income group
194
195
196
197
198
199
top related