realestateworld.com.au - illawarra real estate publication, issue 14th february 2013

Post on 22-Mar-2016

220 Views

Category:

Documents

3 Downloads

Preview:

Click to see full reader

DESCRIPTION

realestateworld.com.au consists of a real estate portal supported by several leading print publications of the same name available across metropolitan and regional centres in NSW. realestateworld.com.au and its services are wholly owned and developed by the Estate Agents Co-operative Ltd.

TRANSCRIPT

Cover Details Page 3

Thursday 14 February 2013

80 PAGES OF PROPERTY | OPEN HOUSE LIFTOUT PAGES 39- 42

Illawarra

LOVE TO CONNECT

BUNYA STREET

BONG BONG ROAD

MORSON AVENUE

BR

OO

KS

REA

CH

RO

AD

14 February 2013 314 February 2013 3

AUCTION

WHERE

CONTACT

WEB

INSPECT

AGENT

Saturday 23rd March at 2pm on site

8 Beach Drive, Woonona

Troy Gibson 0433 433 168 [e] troy.gibson@bevans.com.au

corrimal.bevans.com.au

Sunday 17th February 1pm - 1.30pm

Bevans Corrimal - 42 442 442

Live at the Beach!Front Cover Feature Property

Stunning ocean views exemplify this striking beachfront home. You will never tire of the unique sunrises cresting the horizon, watching the waves roll in or being able to feel the sand beneath your feet across from your front door. With exquisite spacious and modern features inside and lovely lawns and gardens outside, this is unquestionably a perfect choice for beachfront living and entertaining. It offers stylish low maintenance comfort with easy access to shops, schools and an outdoor lifestyle. This stunning family beachfront home is currently used as a profitable holiday letting. This creates a fantastic investment opportunity with well above average rental returns.

3 Terrell Place, Balgownie $685,000• Quiet cul-de-sac street, very private, split level design • Warm and inviting interiors, loads of room to relax• Self-contained flat, generous garages, so much to see• Surrounded by quality gardens, plenty of street appeal• Properties like this do not last, be quick not to miss this

5 3 2

BY APPOINTMENT

8 Petrel Place, Blackbutt Offers Above $560,000• High side of cul-de-sac capturing fantastic lake views• Large mutliple living & dining areas, timber kitchen • Floor to ceiling BIW’s to b/rs, walk-in & ensuite to main• Landscaped pool, entertaining patio, l/up garage & alarm• Short stroll to Stocklands Shellharbour & transport

4 3 2

BY APPOINTMENT

12/31-33 Princes Highway, Fairy Meadow $379,000• Ideally located in the heart of Fairy Meadow • Light filled open living leading onto balcony• Modern kitchen & bathroom, ensuite to main• Security complex, lift access, secure parking• Level walk to shops, café´s, transport, parks

2 2 1

BY APPOINTMENT

13 Garden Avenue, Figtree $419,000• Ideal family or 1st home setting in sought-after location• Large living & dining areas plus separate rumpus• Original & neat kitchen & bathroom with separate WC• Balcony overlooking lush backyard and rear reserve• Prime location close to schools, shops, parks & transport

3 1 1

BY APPOINTMENT

40 Edgeworth Avenue, Kanahooka $395,000• Modernished family home with generous floor plan• Renovated kitchen with granite bench & splashback• Tiled living & dining, undercover entertaining deck• Lush landscaped gardens overlooking lake & escarpment• Go to www.taranto.com.au to view the properites video

4 2 1

OPEN SAT 1.00-1.30PM

18 Herne Street, Figtree $495,000• Spacious open plan living & dining area + air-conditioning• Beautiful timber kitchen with lots of storage space• Large bdrms with built-in wardrobes & ensuite bathroom• Separate laundry area, double remote garage• Location, luxury, lifestyle, great finish & great value

3 2 2

OPEN SAT 2.30-3.00PM

52 Sunninghill Circuit, Mount Ousley $509,000• Solid dual level family home, northern aspect • Open living plan with balcony, separate dining• Neat kitchen and bathroom, 2nd wc & shower• Rumpus room with kitchenette, 1.5 car garage• Large level yard, storage, high demand location

4 2 2

BY APPOINTMENT

8/7 Pleasant Avenue, North Wollongong $225,000• Nth facing, fully renovated with new kitchen & bathroom• Good-size open living area, full kitchen & large bedroom• 2nd floor unit, small block, close to beach & cafe lifestyle• Ideal investment/1st home buyer, sought-after location• Be quick to secure a slice of Nth Wollongong Real Estate

1 1 1

BY APPOINTMENT

6 Parkman Place, Mount Keira $720,000• North facing, private & secluded large family home• Open plan gourmet kitchen with adjoining sunroom• Multiple living rooms flowing to outdoor deck & c/yard• Teenage retreat, study downstairs & in-ground pool• Minutes to Private Schools, University, parks & transport

4-5 3 3

OPEN SAT & SUN 11.00-11.30AM

2 Georgina Avenue, Keiraville $569,000• North facing home with 2 x living rooms & timber floors• Charming modern open plan kitchen with gas cooking• Spacious garage with workshop plus 2 large storerooms• Covered deck overlooking sparkling in-ground pool• Minutes to University, Botanical Gardens & Village Shops

3 1.5 1.5

OPEN SAT & SUN 1.00-1.30PM

61 Minnamurra Street, Kiama $989,000• Solid family home with amazing ocean views• Excellent potential, spacious living, balcony• Neat kitchens and bathrooms, rumpus room• Large balcony and entertaining area, garage• Development potential STCA, move in/invest

4 2 1.5

BY APPOINTMENT

53 Taronga Avenue, Mount St Thomas $375,000• Inviting & charming home filled with natural light• Spacious interiors, neutral tones to make your own• Kitchen area with adjoining dining opening to yard• Tandem garage, external laundry, versatile layout• Ideally suited to 1st home buyer, handy location

2 1 2

OPEN SAT 11.00-11.30AM

35 Eastern Street, Gwynneville $595,000• Open plan living with spotted pine timber floors• Great for development (STCA) 1,051sqm block• Private & sunny garden area great for entertaining• Modern & neutral colour scheme, air-conditioning • Large lock-up garage with storage. Must see!

3 2 2

OPEN SAT 1.45-2.15PM

44 Ocean Street, Mount St Thomas $395,000• Refurbished with a perfect blend of new & old charm• Solid home with a quality galley styled timber kitchen• Plenty of size throughout the living area & bedroms• Initingly private, yet suprisingly peaceful location• Ready for immediate enjoyment with a sunny aspect

3 1 1

OPEN SAT 12.00-12.30PM

9/17-21 Virginia Street, North Wollongong $589,000• North east corner, full of natural light, very airy• Good size bedrooms all with BIW’s, esnuite to main• Central location, close to beaches, parks & more• Modern kitchen & bathroom, deluxe finishes• Great investment, huge balcony, often sought after

3 2 2

BY APPOINTMENT

20/7 Edward Street, North Wollongong $979,000• Luxury living, relaxed dining with ocean & escarp views• Nth facing, gas kit w Miele appli & stone bench tops• Spac b/rs w BIW, main b/r w WIW, flow to balconies• Pool & BBQ area, sec. bldg, sep laundry,DLUG ,a/c• Mins to beach, harbour, restaurants, Cliff Rd, CBD

3 2 2

OPEN SAT & SUN 3.00-3.30PM

37/59-67 Corrimal Street, North Wollongong $520,000• Enjoy resort style living in the Watermark Apartments• Contemporary open plan living & dining areas• Poly kitchen with stone tops & Smeg appliances• Covered sunny balcony, full security & ducted air• Resort pool & gym plus short walk to beach & city

2 2 2

OPEN SAT 11.00-11.30AM

12/11-15 Church Street, North Wollongong $849,900• Wave Apartments... Contemporary styled luxurious living• Open & flowing living & dining area with high ceilings• Poly kitchen with b’fast bar, s/s appliances, stone tops• Spacious b/rs, open & separate study or media room• Large covered balcony with ocean & escarpment views

3 2 2

BY APPOINTMENT

5/54-58 Cliff Road, North Wollongong $1,395,000• Luxurious resort style apartment with pool & tennis court• Stylish open plan living & dining with ocean backdrop• Designer kitchen, integrated stainless steek appliances• Floor to ceiling tiled bathroom, sumptuous bdrm suites• Entertainers terrace/balcony, ocean & harbour views

3 2.5 2

OPEN SAT 1.00-1.30PM

6/60-62 Cliff Road, North Wollongong $1,590,000• Acquire a sub-penthouse lifestyle within the Rockpool• Open plan lounge & dining amongst ocean backdrop• Central designed kitchen with stone tops & s/s appli.• Sophisticated bathrooms with quality, fixtures & fittings• Entertainers balcony with breathtaking harbour views

3 2.5 2.5

BY APPOINTMENT

24/1 Sparta Avenue, Warilla $309,000• Easy access to the common pool area & garden• Short walk to beach, transport and shops• Open plan living/dining, great size• Internal laundry, separate bathroom & toilet• Great buy and keep as an investment

2 1 1

OPEN SAT 10.00-10.30AM

15/27 Church Street, Wollongong $315,000• Neat & tidy apartment, main bedroom with built-in robe• Stylish & modern kitchen, renovated bathrooms• Bright & airy, open plan living & dining with balcony• Moments to shops, beaches & restaurants• Already tenanted, great investment with good return

2 1 1

BY APPOINTMENT

35/26 Market Street, Wollongong $399,000• Sunrise Apartments, live in the heart of the city• Open plan lounge, dining & modern kitchen• Large bedrooms with BIW’s, main with ensuite• Security building with secure parking space• Sunny north eastern aspect & close to everything

2 1 1

OPEN SAT 10.00-10.30AM

22/80-84 New Dapto Road, Wollongong $399,500• Impressive top floor apartment, quality finishes & fixtures• Wake up or entertain with breath-taking mountain views• Spacious open floor plan, full security building w/ parking• A statement in style & sophistication, convenient location• Fantastic investment, excellent for deprecation

2 1 1

BY APPOINTMENT

2/143-149 Corrimal Street, Wollongong $489,000• Light-filled ultra-modern apartment in CBD location• Oversized bedrooms with built-ins, ensuite to main• Stone kitchen, s/steel appliances, glass splashbacks• 56sqm entertaining terrace with city skyline views• 2 minutes walk to Wollongong CBD, cafes & beaches

3 2 1

OPEN SAT 11.00-11.30AM

43/59-67 Corrimal Street, Wollongong $675,000• Stroll to the ocean pool, harbour, beaches, CBD & cafes• Open lounge & dining flowing to spacious balcony• Stylish kitchen, s/s appli., granite tops, neutral colours• Ducted reverse cycle a/c + restort style pool & gym• Ensuite to main, 2nd deluxe bthrm, security lift & DLUG

3 2 2

OPEN SAT 12.00-12.30PM

1 Larkins Lane, Yallah $1,260,000• Master built spacious and light filled residence• Single level, formal lounge and dining, rumpus• Gourmet kitchen, walk in pantry, meals area• Heated inground pool, detached garage/shed• Impressive finish & position, superior lifestyle

6 4 3

BY APPOINTMENT

R E A L E S T A T E

140 Keira Street, Wollongong www.taranto.com.au Ph: 4228 1622

R E A L E S T A T E

140 Keira Street, Wollongong www.taranto.com.au Ph: 4228 1622

the esplanade

2 3

• This amazing villa features high ceilings, air-conditioning, big rooms and beautifully landscaped grounds• Three generous sized bedrooms all with built-in wardrobes• Three way ensuite bathroom and second toilet• Modern kitchen with stainless steel appliances and dishwasher

OPEN

13 Darragh Drive FigtreeOPEN SATURDAY 12.30 - 1.15pm

Carla Veljanoski 0431 086 264

FIGTREE O/Above $420,000

• Spacious lounge area, separate dining area and large internal laundry• Immaculate gardens, undercover courtyard and single remote drive through garage with internal access• Rare villa with no strata fees

3 1 1

• 2 bedroom brick and cement rendered home is located in a sought after street with sweeping panoramic ocean and lake views on 550m2 block of land

• Separate lounge room and security shutters• Solar hot water system and re-coated tile roof• Walking distance to Westfield shops and short drive to

lake foreshore and Port’s surfing beaches

Paul Spinelli 0415 112 702

NEW

PORT KEMBLA $339,0002 1 1

• Spacious 3 bedroom relocatable home featuring 2 sun rooms, 2 verandahs, separate toilet, a lock up garage as well as an extra car space and is located in the sought after suburb of Figtree

• Only an 8 minute walk to Figtree Westfield Shopping Centre, minutes walk to public transport, primary and high schools

Paul Spinelli 0415 112 702

NEW

FIGTREE O/A $240,0003 1 1

• Affordable entry point into the market, this 2 bedroom unit is ideally located close to Port Kembla CBD, beaches and transport

• With open plan living area and good sized bedrooms this unit also has an internal laundry and balcony overlooking the adjacent park with designated off street parking

Carla Veljanoski 0431 086 264

OPEN PORT KEMBLA $189,0002 1 1

• 3 large bedrooms with an additional sunroom• New carpets and paint • Double lock up garage with extra room • Large flat block • Lovely views of Lake Illawarra• Close to transport, shops and hospital

Carla Veljanoski 0431 086 264

OPEN LAKE HEIGHTS O/A $399,000 3 1 2

• This 4 bedroom, 2 living area, northwest facing home is located approx. 30 metres from Lake Illawarra

• The interior has been freshly painted and comes with air-conditioning

• Has a large balcony overlooking the backyard and a generous sized double garage/work shed (approx. 8x8m)

Paul Spinelli 0415 112 702

OPEN PRIMBEE O/A $430,0004 1 2

• Upon entering this two storey executive family residence; discover quality, tranquility and space

• 4 large bedrooms all with BIW’s plus a study• 3 bathrooms with spa plus ensuite• Indoor sauna, theatre room games room with snooker

table and wet bar• 3 car garage with internal access

Carla Veljanoski 0431 086 264

MT PLEASANT $1,250,0004 4 3

• 4 large bedrooms all with built in wardrobes• 2 large living areas, large eat in kitchen, modern bathroom with separate

toilet • In ground saltwater pool and huge pergola• Over sized double garage• This home is located within walking distance to the lake foreshore,

schools, bus stops and other amenities

Carla Veljanoski 0431 086 264

OPEN BERKELEY $399,0004 1 2

2 3

DEVELOPER’S SPECIALOVER 50 SOLD!Free stamp duty rebate on settlement for next 20 sales For e.g $420,000 purchase price equates to a rebate of $14,390. Each apartment delivers its own unique view - be it the city lights, mountain backdrop or glistening ocean views, there is an apartment that can suit your needs.The Vantage is perfectly located opposite to Wollongong train station making it the ideal home for the commuter or student with both TAFE and Wollongong University nearby. Estimated Completion by December 2013 - Visit the website....www.thevantage.com.au

22-32 GLADSTONE AVENUE

Stadia - City Living by The SeaBoutique complex offering 24 luxuriously appointed apartments with 4 per floor. Most apartments have stunning views of the Pacific.

Perfectly placed in one of the most sought after and vibrant parts of Wollongong, Stadia is located within easy stroll to the city centre, as well as being ideally located within the entertainment district of town, Wollongong Golf Club, and pristine beaches virtually at your doorstep.

All units come furnished and are in excellent condition.

1-24/5-7 STEWART STREET

Clever in Design

• Fully refurbished apartment with little hidden features like energy efficient lighting, pay TV accessible and insulation in ceiling space for both sound and temperature control. • Good size lounge leading out to a wonderful balcony space that offers not only indoor/outdoor living but a nice view of ocean as well. Contemporary eat in kitchen with an adaptable laundry option, exceptional bathroom and BIW’s in both b/rms. Own car space and storage area as well as visitor parking. The apartment complex is tucked away creating a more peaceful and secure place to live and is positioned only seconds away from transport and just minutes from Wollongong CBD,TAFE and the Hospital. Previous return of $340 per week.

3/15 MYRTLE STREET

• In a block of only 3 this 2 b/rm unit is a great little investment or starter for the first home buyer.

• BIW´s in both rooms, modern carpet and an undercover carport. • You will be only seconds away from town, transport, schools and only

minutes from the lake and Shellharbour Shopping Centre. • Currently rented at $200 per week.

2/22 DAVID AVENUE

$189,000

• This 2 b/rm unit is part of a well maintained complex of 8 units, situation on the second floor with a bright northerly aspect.

• Long term tenants anxious to stay currently paying $260 p/w rent. • The unit has a renovated kitchen, internal laundry and a single lockup

garage. • Short walk to beach, shops and transport at the door.

4/102 CAWLEY STREET

$259,000

• Good size lounge, separate dining and polished floors throughout, a recently re-modelled bathroom and a neat timber kitchen.

• BIW´s, gas heater, ceiling fans are also thrown in as little extras. • On external viewing you will find both front and rear decks, a very

generous 803m2 size block and nice lake views. • Currently rented at $335 per week (expired lease).

1 GILLARD PLACE

$284,000

• Looking for the perfect investment, set and forget, this unit fits the bill. • Loft style 2 b/rm unit fully furnished with new 6 month lease in place,

tenants paying $430 pw. • Small Crown Street development, walking distance to CBD, beaches and

transport. Unique in design, central courtyard servicing all units, security building and parking.

10/290 CROWN STREET

$329,000

• 4 b/rms (or 3 b/rm + study), huge living space with air conditioning, spacious kitchen with both Smeg and Miele appliances including dishwasher. Freshly polished floorboards, great size bathroom + ensuite, large free standing rumpus room downstairs, front and rear entertaining areas, balcony with views and an amazing landscaped private yard.

• Remote double garage and a stack load of storage around the home.

101 BEATUS STREET

$445,000

• This immaculate villa will surely impress, contained within a boutique complex of only 4.

• The complex is meticulously maintained surrounded by beautiful gardens and a park bordering the complex, with privacy assured.

• 3 b/rms all with BIW´s, separate internal laundry, internal access from double garage and two well positioned courtyards.

1/2 PARSONS STREET

$499,000

top performers providing a diverse range of real estate solutions

Daniel Hastings0416 283 876

David Geary0418 423 782

Phil Jones0418 421 468

Paul Baxter02 4253 2743

Maurice Bertapelle0412 029 131

Daniel Frazer0408 944 434

Natalie Lowe0401 745 678

Sam O’Halloran0423 825 072

George Szymkiewicz0448 046 450

Amy Andersen02 4253 2743

Yenson Mui0421 882 541

Geoff Jones0418 421 074

Tim Jones0409 456 299

Travis Machan0447 300 800

MMJWollongong.com.au6-8 Regent Street, WollongongPhone 4229 5555 | Email ressaleswollongong@mmj.com.au

Deb Cummins0412 426 495

Pat Cummins02 4256 6666

Dale Whittaker0414 376 720

Mark De Cresci0422 744 097

Joyce Mantuano02 4256 6666

Natalie Reale0405 998 211

MMJshellharbourcity.com.au57 Central Road, Oak flats Phone 4256 6666 | Email shellharbourcity@mmj.com.au

Luke Fox0424 248 165

Julie Taylor0415 160 683

Greg Truebody0412 626 964

Troy Phipps0412 425 801

Roger Hughes0412 424 071

Greg Ellul0412 421 214

Glenice McMahon0407 293 466

Jade O’Byrne0405 180 593

Frank Belsito0416 032 986

MMJNorth.com.au251-253 Princes Highway, CorrimalPhone 4285 5999 | Email mmjnorth@mmj.com.au

Luke Collins0401 405 874

Adam Martin0408 411 723

MMJSouth.com.au231 Windang Road, Windang Phone 4296 4444 | Email mmjsouth@mmj.com.au

John Tisma0409 612 000

Ian Fitzgibbon0418 333 149

Bradd O’Brien0400 002 255

Alan Chaffers02 4261 3822

Greg Edwards0438 613 822

MMJDapto.com.au49 Princes Highway, DaptoPhone 4261 3822 | Email mmjdapto@mmj.com.au

stay connectedGet the latest news, property updates & more online. #mmjrealestate @mmjrealestatewww.facebook.com/mmjrealestatewww.youtube.com/mmjrealestate

what’s open this weekend?Find out what’s open this weekend. Scan this code with your smart phone to go straight to our open house list.

MMJ’s weekly hot tip!Preparing your house for an open home.As everybody says, first impressions are the most memorable. So, if your house is currently on the market and you are about to start open homes, make sure you keep certain things in mind to help your property look its best.

Head to our blog to read more on preparing for open homes >>>

MMJ Wollongong l 4229 5555ressaleswollongong@mmj.com.auwww.mmj.com.au

easy to fall in love with WOLLONGONG, 9/2 Church Street

Custom design kitchen stone benches and glass splash back• Built in laundry with good storage• Built in robes with extra draws, extra power points and TV points• Less than 350m² to North Wollongong Beach• Just over 700m² to North Wollongong train station• Walking distance to University and Wollongong Mall•

2 1 1

This is a fully refurbished fi rst fl oor unit, in a remodelled complex with excellent security for you and the car

for sale $339,000View Saturday 11:00 - 11:30amContact David Geary 0418 423 782Email david.geary@mmj.com.auWeb iD mmj.com.au/3P0443

dream acreages for your valentine

huntley, Avondale road

Land acreages ranging from 112.5 to 512 acres. Sitting beautifully under the escarpment, but also close to the city.

View By AppointmentContact David Geary 0418 423 782Email david.geary@mmj.com.auWeb iD mmj.com.au/3P0443

56.329 ha of rural paradise• Build a dream home or city escape• No neighbours in ear shot• Acres of clear building area•

lot 1

45.55 ha with options• Huntley mines offi ce site• Possible redevelopment s.t.c.a• Zoned E2•

lot 27

112.385 ha of retreat land• Combination of three (3) lots• Possible hobby farm / holiday retreat• Ocean, lake & suburban views•

lot 10, 49 & 55

for sale $1,00,000 for sale $900,000 for sale $750,000

New Listing!LAKE ILLAWARRA, 15 Kotari Parade

A great foot into the market, renovation project or new home site •

3 bedroom house with loads of potential•

Separate lounge and dinning rooms•

Detached single garage•

Convenient position near schools, bike track and Lake Illawarra•

3 1 1

offer above $269,900View Saturday 1:45 - 2:15pmContact Daniel Frazer 0408 944 434Email frazer.buyers@mmj.com.auWeb iD mmj.com.au/3P3772

MMJ Wollongong l 4229 5555ressaleswollongong@mmj.com.auwww.mmj.com.au

Panoramic Views & Top FloorWOLLONGONG, 14/78-82 Campbell Street

Large top fl oor unit• 3 bedrooms with built in wardrobes• Lock up garage and security entry• Panoramic mountain views• Master with ensuite and walk in wardrobe• 3 balconies and a convenient location•

3 2 2

offers above $479,000View Saturday 11:00 - 11:30amContact Daniel Frazer 0408 944 434 Bradd O’Brien 0400 002 255Email frazer.buyers@mmj.com.auWeb iD mmj.com.au/3P3636

Incredible Investment OpportunitywOLLONGONG, 7/18-20 Robinson Street

Full brick 2 bedroom unit with built-in-wardrobes•

Neutral paint and carpet throughout, tidy kitchen and bathroom•

Lock-up garage, internal laundry and private balcony•

Rental potential of $250 - $270 per week, great rental history•

Walk to the train station or free shuttle bus, 5 minutes from University•

2 1 1

OFFERS ABOVE $239,000View Saturday 12:00 - 12:20pmContact Daniel Frazer 0408 944 434Email frazer.admin@mmj.com.auWeb iD mmj.com.au/3P3717

only 3 lots left - The Rural Dream Close to Towndombarton, 246 Sheaffes Road

3 allotments ranging in size from 4,000m² to 10,950m²•

Electricity and bitumen surfaced road access to all lots•

Gently sloped building envelopes with varying degrees of elevation•

Privately situated estate for those looking to avoid the city’s hustle•

Located just 15 minutes to Wollongong’s CBD•

0 0 0FOR SALE FROM $299,000View Saturday 11:00 - 11:30amContact Daniel Hastings 0416 283 876 daniel.hastings@mmj.com.au Ian Fitzgibbon 0418 333 149 ian.fi tzgibbon@mmj.com.auWeb iD mmj.com.au/3P3634

MMJ Wollongong l 4229 5555ressaleswollongong@mmj.com.auwww.mmj.com.au

first time advertised!Figtree, 102 Bellevue Road

Original and solid brick home with generous living• Gently sloped 620m² corner lot• Versitile enclosed back verandah• Great potential or plans drawn for impressive duplex development• Local shops and bus stop within 100m, schools and Westfi eld within 2 min drive• Current lease in place•

3 1 1

offers above $399,000View Saturday 12:00 - 12:30pmContact Daniel Hastings 0416 283 876Email daniel.hastings@mmj.com.auWeb iD mmj.com.au/3P3796

here’s a proposalBALGOWNIE, 1 Elsie Court

Pleasant cul-de-sac address neighbouring impressive residences• Spacious open plan living within a split level fl oor plan • Smartly appointed stone topped kitchen• Double garage with internal access• Restaurants/cafes, retail, entertainment and transport all within a 5 min walk • Enjoy villa style living with no strata and low maintenance•

3 2 2

for sale $499,000View Saturday 10:00 - 10:30amContact Daniel Frazer 0408 944 434 frazer.admin@mmj.com.au Daniel Hastings 0416 283 876 daniel.hastings@mmj.com.auWeblink iD mmj.com.au/3P3761

Less time gardening, more time lovingdapto, 2 Shiraz Drive

Impressive outdoor entertaining accessed via french doors off the main living• 3 bedrooms with walk-in-robe and ensuite off the main• Double garage space with minor conversion• Low maintenance home purchase• Excellent affordable home and ideal for “empty nesters”•

3 2 2

for sale $419,000View Saturday 10:00 - 10:30am Contact Daniel Hastings 0416 283 876Email daniel.hastings@mmj.com.auWeb iD mmj.com.au/3P3788

romantic beach walksPORT KEMBLA, 2/4 Surfside Drive

2 bedroom unit located in one of Port Kembla’s highly sought after streets• Recently re-carpeted, both bedrooms are large in size and include built in robes• Open plan living/dining and kitchen adjoining your very own balcony• Plenty of storage, large bathroom, internal laundry plus single lock up garage• Only meters from the beach, parks, schools and public transport. Act now!•

2 1 1

for sale $269,990View By AppointmentContact Sam O’Halloran 0423 825 072Email sam.ohalloran@mmj.com.auWeb iD mmj.com.au/3P3590

Quality Townhouse & Villa Homes - Will Be Soldnowra, 8 McKinnon Street

auction if not sold prior6pm Wednesday, 6th March 2013Shoalhaven Entertainment Centre, Bridge Road, Nowra

MMJ Wollongong 4229 5555Tim Jones 0409 456 299tim.jones@mmj.com.au Clyde Poulton Real Estate 4421 2644Karl Poulton 0401 824 335karl@clydepoulton.com.au

Unit 5

Unit 10

Unit 11Unit 4

140m² (approx) level villa home• Family area with direct access to lawn•

3 2 1unit 4

Master bedroom with access to lawn area• North facing living area, 140m² (approx)•

3 2 1unit 5

Two separate living rooms and meals area• Private fenced lawn area, 150m² (approx)•

3 2 2unit 10

160m² (approx) total area• Low maintenance backyard•

3 2 1unit 11

Open for Inspection 10.00am - 11.00am Saturday 16th, 23rd Feb 2013

• Selection of three bedroom townhouse or villas to be auctioned individually• Less than 6 years old and featuring double insulation in ceilings and walls, stainless steel appliances, quality kitchens and natural gas / electrical services• Walking distance to State and Catholic High Schools and adjacent to Nowra Private Hospital • On established bus route and short drive to Nowra Town Centre

A brilliant new beachside place to call home.easy living in warilla Warilla’s newest place to call home, Sunset Private Estate, will be a breath of fresh air to the already established community.

First Home Buyers save up to $30,000 Everyone Else saves up to $5,000

Home + Land Packages from $325,000

Subject to purchasers being eligible for selected Government Grants.

Register online nowwww.sunsetwarilla.com.au}more info?

Maurice bertapelle 0412 029 131

only 4left in stage 1

hurry !3

LIFESTYLEEnjoy many lifestyle activities, including lakeside fishing, water sports, social club & walking track

Project MarketingWOLLONGONG | 4229 5555

For plans and prices go toflametreeplace.com.au

or contact Maurice Bertapelle 0412 029 131 or George Szymkiewicz 0448 046 450{ {

n ow s e l l i n gHOME +LANDPackages | Berkeley4 BEDROOMS - SINGLE STOREY - DOUBLE GARAGE + 2 LIVING AREAS.

PREMIUMPremium home + land packages on near level lots. Surrounded by quality new neighbourhood.

LOCATIONWalk easily to lake, shops and schools. Short drive to Wollongong CBD and Shellharbour

{HURRY REGISTER ONLINE NOW}

MMJ Dapto l 4261 3822mmjdapto@mmj.com.auwww.mmj.com.au

new valentines day special- open satHORSLEY, 176 Bong Bong Road

• The home features a stunning formal lounge, formal dining room• 4 bedrooms all with built in robes (main ensuite and walk in robe) • Study, ducted air conditioning, modern kitchen quality appliances • Informal dining, family room and rumpus room, internal laundry• Double garage, drive thru access, private covered entertaining area.

4 2 2

Contact Bradd O’Brien 0400 002 255 Email bradd.obrien@mmj.com.auWeb iD mmj.com.au/5P1054

For Sale $519,900 View Saturday 12.00-12.30

be mine - open sat HORSLEY, 10 Bovard Court

• Well presented brick veneer and tile home• L shaped formal lounge and dining, neat kitchen, family room• Master bedroom with walk in robe, built ins in other bedrooms• 835m2 block with side access available to generous size yard• Quiet cul de sac location, excellent value

3 1 1

Contact Greg Edwards 0438 613 822 Email greg.edwards@mmj.com.auWeb iD mmj.com.au/5P1042

For Sale $355,000 View Saturday 1.00-1.30

share the love - open sat dapto, 3 Carlyle Place

• This home is certainly a surprise package, it has size and space.• Private entry foyer, huge formal lounge, open plan formal dining• Stunning modern kitchen, separate study or 5th bedroom, sunroom• Huge games room with kitchen and bathroom, separate rumpus room• Outside is a sparkling in ground pool for summer & beautiful views.

5 4 2

Contact John Tisma 0409 612 000 Email john.tisma@mmj.com.auWeb iD mmj.com.au/5P1014

For Sale $609,900 View Saturday 12.00-12.30

SWEET VALENTINE - OPEN SATKANAHOOKA, 55 Edgeworth Avenue

• Take a look at this modern single level home in Kanahooka• The home features formal lounge, formal dining, family room• Modern kitchen & informal dining area, spacious bathroom• 4 bedrooms all with built in’s, main with ensuite walk in robe • Outdoor entertaining area and double garage with internal

4 2 2

Contact Alan Chaffers 4261 3822 Email alan.chaffers@mmj.com.auWeb iD mmj.com.au/5P0953

For Sale $469,900View Saturday 12.00-12.30

HOUSE OF LOVE - OPEN SATHORSLEY, 6 Greenbrook Place

• Immaculate 3 bedroom brick & tiled family home all with built in’s• New kitchen with granite bench tops, plus gleaming new bathroom • Featuring new fl oating fl oors with R/C air conditioning • Large lock up garage with side access to good size yard • Located in safe & quiet cul de sac only a short stroll to local shops

3 1 1

Contact Greg Edward 0438 613 822Email greg.edwards@mmj.com.auWeb iD mmj.com.au/5P0982

For Sale $335,000 View Saturday 12.00 - 12.30

AN ENDLESS LOVE - OPEN SAT dapto, 21 Brown Ave

• 4 Bedroom family home situated in a quiet cul de sac.• Ensuite to main, BIR’s, spa to main bathroom, separate w.c• Formal lounge + family and dining room and meals area• Lock-up garage,double carport, level block, modern features • Great family home with great potential in a great street.

4 2 1

Contact John Tisma 0409 612 000 Email john.tisma@mmj.com.auWeb iD mmj.com.au/5P1013

For Sale $369,900 View Saturday 11.00-11.30

valentines day special - open sat dapto, 2/21 Kent Road

• Great investment in a handy location close to CBD • 2 good sized bedrooms, main with large built-in robe • Modernise bathroom, kitchen & décor, open plan design• Currently leased to great tenants receiving $275 pw• Off street parking, small complex, low maintenance

2 1 0

Contact John Tisma 0409 612 000 Email john.tisma@mmj.com.auWeb iD mmj.com.au/5P1044

For Sale $249,900 View Saturday 2.00-2.30

FALL IN LOVE - OPEN SAT DAPTO, 30 Burrell Crescent

• LIKE NEW - Fully renovated from top to bottom• 3 bedrooms, impressive new bathroom, Open plan design• Timber fl oors, air conditioning, tasteful bright décor • Rear deck with shade sail & a covered BBQ pergola• Double garage, yard for kids and park down the road

3 1 2

Contact John Tisma 0409 612 000 Email john.tisma@mmj.com.auWeb iD mmj.com.au/5P0945

For Sale $349,900 View Saturday 1.00 - 1.30

a hearts desire - OPEN SAT dapto, 25 Bright Parade

• This home has size and space for the growing family to enjoy• Formal lounge and formal dining with escarpment views• Features an impressive 5 brms with BIR’s, spacious kitchen• Double garage and room for workshop• There is a spacious 2 car garage and loads of room for workshop

5 1 2

Contact John Tisma 0409 612 000 Email john.tisma@mmj.com.auWeb iD mmj.com.au/5P1015

For Sale $399,900 View Saturday 10.00-10.30

land land land!Kanahooka, Lot 1/56 Rushton Drive

• Prestigious location, minutes to lake foreshore,• Generous frontage over 17 metres, 454m2 gently sloping site.• Suits a variety of building designs and styles.• Close to local shops & transport• Appreciate the lifestyle available here

Contact Ian Fitzgibbon 0418 333 149 Email ian.fi tzgibbon@mmj.com.auWeb iD mmj.com.au/5P1033

For Sale $239,000 View By Appointment

cute enough to buy KANAHOOKA, 60 Angophora Crescent

• Situated in the security of Lakeline Village Estate• Air conditioned lounge room, separate dining area.• Spacious kitchen with ample cupboards• Two bedrooms, main with built in mirror robe.• Carport under main roof, loads of storage available

2 1 1

Contact Ian Fitzgibbon 0418 333 149 Email ian.fi tzgibbon@mmj.com.auWeb iD mmj.com.au/5P0957

For Sale $179,000View By Appointment

cherish for a lifetimeKANAHOOKA, 3 Orpheus Close

• Master built executive residence on 816m2 landscaped block.• Formal lounge, formal dining, timber kitchen, family room, rumpus • 4 bedrooms, master with e/s and wir, main bathroom with corner spa• Extended double garage, side access available• Outstanding views of lake and mountains, cul de sac location

4 2 2

Contact Ian Fitzgibbon 0418 333 149 Email ian.fi tzgibbon@mmj.com.auWeb iD mmj.com.au/5P1027

For Sale $675,000 View By Appointment

NEW PRICE, THIS IS LOVE - OPEN SATHorsley, 19 Kerang Court

• This home is immaculate, & located in a cul de sac location• The home feature’s formal lounge, defi ned formal dining• Spacious modern kitchen, rumpus or family room• 4 good bedrooms, with built ins, main ensuite & walk in robe• Quality cover entertaining area and a stunning in ground

4 2 2

Contact Bradd O’Brien 0400 002 255 Email bradd.obrien@mmj.com.auWeb iD mmj.com.au/5P1040

For Sale $459,900 View Saturday 1.00-1.30

new! YOU’LL LOVE IT- open satkanahooka, 13 William Beach Road

• This family home features 3 good size bedrooms 2 with built in robes• Modern formal lounge, formal dining, new kitchen stainless appliances• Bathroom consist of shower bath and vanity, detached workshop• Side access to the back yard, covered decked entertaining area • Air-conditioning, access to Lake Illawarra fi sh out of the back yard.

3 1 0

Contact Bradd O’Brien 0400 002 255 Email bradd.obrien@mmj.com.auWeb iD mmj.com.au/5P1055

For Sale $359,900 View Saturday 3.00-3.30

valentines day surprise - open satHORSLEY, 162 Edgeworth Avenue

• The home consists of spacious formal lounge & difi ned formal dining• Modern timber kitchen with quality appliances, 4 bedrooms 2 with BIR• Huge family room that opens onto decked entertaining area, • Detached 12m x 7m single garage & above ground pool.• You can even throw a fi shing line from your own backyard

4 1 6

Contact Bradd O’Brien 0400 002 255 Email bradd.obrien@mmj.com.auWeb iD mmj.com.au/5P1046

For Sale $459,900 View Saturday 2.00-2.30

choose the love - open sat WOLLONGONG, 2/18 Rowland Avenue

• Take a look at this rare custom designed private gated Villa• The home features 3 spacious bedroom all with built in robes,• Formal lounge, defi ned dining, alarmed & air conditioning• Double garage & workshop space, private entertaining area.• Only minutes to the Hospitals, train station and Wollongong

3 1 2

Contact Bradd O’Brien 0400 002 255 Email bradd.obrien@mmj.com.auWeb iD mmj.com.au/5P0925

For Sale $429,900 View Saturday 10.00-10.30

MMJ Dapto l 4261 3822mmjdapto@mmj.com.auwww.mmj.com.au

spoil your loved ones this valentines day - open saturday!horsley, 48 Huxley Drive

• Unique architecturally designed residence with many individual features

• Sunken formal lounge, separate dining, loft area

• Near new timber kitchen, family room, large covered entertaining area

• 3 bedrooms all with built in robes, main with new ensuite

• Double garage, extensively landscaped yard, privacy and security assured

3 2 2

for sale $449,900View Saturday 1.00-1.45Contact Alan Chaffers 4261 3822 Email alan.chaffers@mmj.com.auWeb iD mmj.com.au/5P1032

NEW LOVE NEW PRICE - OPEN SATDAPTO, 2 Kundle Street

• The family home features a combined formal lounge and dining area• Spacious family room, front patio/sunroom, kitchen, internal laundry• 3 bedroom’s, possible 4th bedroom with a modifi cation to bedroom 2• There is a detached garage loads of room for a car & work benches• Kids retreat above garage, Entertaining area over looking level yard

3 1 1

Contact Alan Chaffers 4261 3822 Email alan.chaffers@mmj.com.auWeb iD mmj.com.au/5P1049

For Sale $309,900 View Saturday 11.00-11.30

first home, first love - open satDAPTO, 47 Craig Crescent

• Well maintained and presented family home• Formal lounge, separate dining, timber kitchen.• Beaut sunroom, 3 bedrooms, tiled bathroom• Sparkling in ground pool, detached garage• Short walk to main shopping centre

3 1 1

Contact Greg Edwards 0438 613 822 Email greg.edwards@mmj.com.auWeb iD mmj.com.au/5P0998

For Sale $325,000 View Saturday 11.00-11.30

valentines day special KANAHOOKA, 6 Grantham Close

• Located in popular Forest Grove being a secure & gated estate• Immaculate 3 bedroom home with quality inclusions through out• Spacious living areas & main bedroom with two walk in robes• 2 bathroom plus 3 air conditioners & heaps of cupboard space.• All in a safe cul de sac being ideal for the retiree or working couple

3 2 2

Contact Greg Edwards 0438 613 822 Email greg.edwards@mmj.com.auWeb iD mmj.com.au/5P1018

For Sale $479,900 View By Appointment

CHOOSE THE LOVE - OPEN SATwollongong, 1/18 Rowland Ave

• Take a look at this spectacular fully renovated 2 brm villa • Formal lounge, timber kitchen & spacious combined formal dining. • Brand new bathroom,new carpets & freshly painted throughout• There is a spacious single car garage, outdoor BBQ/ent. area . • Electronic security gates at the front of the home for that added

2 1 1

Contact Bradd O’Brien 0400 002 255Email bradd.obrien@mmj.com.auWeb iD mmj.com.au/5P1030

For Sale $389,900 View Saturday 10.00-10.30

A HEARTS DESIRE! calderwood, 102 Mellows Road

• Approximately 120 acres set at the foothills of the escarpment with stunning views• Located at the end of the street this property is private and truly impressive• Open prime pastures, tall cedar trees, rainforest walking tracks & permanent stream• Unique three bedroom family home with IG pool nestled unobtrusively into its local• Large machinery shed, spring fed water supply, 100% solar electricity, stunning

3 1 3

120 acres (approx), private & truly stunningBeautiful home with in-ground pool Self-sustaining solar & spring fed waterOpen pastures, rainforest tracks & views

for sale $1,795,000View By AppointmentContact John Tisma 0409 612 000 Email john.tisma@mmj.com.auWeb iD mmj.com.au/5P1035

Solid Home Filled With Characterwarrawong, 46 Greene Street

• Solid brick veneer home with a taste of Europe• Big open kitchen, formal living areas & stacks of charm• Half wrap around balcony with views over lake & ocean• Centrally located to major shopping centre - 10 min drive to town

3 1 1

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1351

guide above $320,000 View By Appointment

Apartment Living At Its Bestlake illawarra, 5/78 Addison Ave

• Modern development in quiet neighbourhood• Open plan 3 bedroom top floor unit with spunk• Large sun drenched balcony with sweeping views• Hop skip and a jump to our beautiful Lake’s Entrance

3 2 2

guide above $360,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1491

Looking To Develop?port kembla, 71 Donaldson Street

• Combined total area of 1256sqm (24.43/38.05X41.91/40.28)• Plot ratio of 0.5:1 - build 5 or 6 villas/townhouses• Prime land with view of Lake Illawarra & coastline• Great Government incentive for buyer’s buying new

3 1 OSP

guide above $490,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874 Web iD mmj.com.au/6P1362

Ocean Streetwindang, 78 Ocean Street

• Here’s your chance to buy into Windang• Original cottage in great solid condition• Great location with stacks of potential• Everyday could be a holiday - CALL NOW!

2 2 1

guide above $380,000 View Saturday 10:40am - 11:00am

Contact Adam Martin 0408 411 723 Dimitty Tabor 0434 745 520Web iD mmj.com.au/6P1480

Smell The Sea Airlake illawarra, 1/74 Peterborough Ave

• Large 3 bedroom townhouse right by the beach• Huge bedrooms, spacious open plan kitchen & living• North facing courtyard/BBQ/entertaining area• 2nd bathroom downstairs and single lock up garage• 1 of 3 in complex, across the road from beach

3 2 1

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874 Web iD mmj.com.au/6P1251

guide above $330,000 View By Appointment

You Won’t Be Disappointedunanderra, 156 Princes Highway

• Big home ready for moving in and or home business• Freshly painted throughout with beds up and down stairs• Large living, great floor and undercover entertaining area• Centrally located to all amenities - 10 mins to Wollongong• Great little money making investment at this price!

4 1 1

guide above $290,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1379

Tranquil Livingalbion park, 7 Jerrara Street

• State of the art character filled home in Tullimbar• Big open plan design with formal and informal areas• High ceilings and manicured gardens• Move straight in, with nothing left to do!

4 2 2

guide above $468,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1408

First Property Or First Investment?windang, 2/232 Windang Road

• Great unit in complex of two close to Lake Illawarra• Single garage with sun drenched yard to boot• Wonderful investment opportunity currently at $270 pw• No better time to buy than today - hurry hurry

2 1 1

guide above $230,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1389

MMJ South l 4296 4444mmjsouth@mmj.com.auwww.mmj.com.au

MMJ South l 4296 4444mmjsouth@mmj.com.auwww.mmj.com.au

Options Are Plentylake illawarra, 103 Reddall Pde

• What an opportunity - 850m2 (18.67/18.29 X 44.58/46.11)• Build a new home, revamp and develop or bull dose and develop • Currently generating $490 per week in rent• A hop skip and a jump to the water’s edge

3 2 2

guide above $400,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1307

Top Spot!port kembla, 45 Parkes Street

• Superbly presented character filled residence• Big rooms, 2 bathrooms, high ceilings & Study area• Level landscaped yard & fitted garage (rumpus)• Only minutes from arguably South Coast’s best beach

3 2 1

guide above $340,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1340

Warilla Eastwarilla, 3 Terry Avenue

• Ever wanted to live by the sea?• 706m2 suitable for the biggest of family homes• Develop?? (15.54 X 45.72 ), Zoned 2b1 Residential (STCA)• 4 bedroom cottage with double garage in the heart of town• Walk to wonderful Warilla beach, property priced to sell!!

4 1 2

guide above $320,000 View Saturday 12:50pm - 1:10pm

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1479

Revamped - Will Move Quick!port kembla, 1/55 Tobruk Avenue

• Located a few minutes walk to beach & Port Kembla pool• Tastefully revamped property with balcony and car space• Suburb becoming “hot spot”, attracting great prices• 5 mins to shopping hub and 10 min to Wollongong Central

2 1 1

guide above $220,000 View Saturday 11:20am - 11:40am

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1450

Solid Investmentport kembla, 70 Darcy Road

• Rare Solid Investment Opportunity

• Block of four 2 bedroom units

• Top condition with yet more fantastic potential

• Annual rental income of $42,900 - Below market!

4 x 2 4 4

auction12:30pm On-Site, Sat 23rd Feb. 2013View Saturday 12:00pm - 12:30pmContact Adam Martin 0408 411 723 adam.martin@mmj.com.au Luke Collins 0401 405 874 luke.collins@mmj.com.auWeb iD mmj.com.au/6P1439

MMJ Shellharbour City l 4256 6666shellharbourcity@mmj.com.auwww.mmj.com.au

new listing - Open saturdayOAK FLATS, 117 The Boulevarde

• Enjoying a tranquil position in an exclusive waterfront location• Encompassed by a massive 1246m2 block, this spacious residence is

waterfront living at its best! Very convenient to schools, shops & transport• Beautifully presented with 3 separate living areas and home offi ce• Soak up stunning lake and escarpment views from the full width sun

soaked deck and swim in your own inground pool

4 2 2

for sale $732,000View Saturday 12.00pm-12.30pmContact Deb Cummins 0412 426 495Email deb.cummins@mmj.com.auWeb iD mmj.com.au/8P1060

new listing - open saturdayblackbutt, 20 Westwood Drive

• Secluded yet central to a host of lifestyle choices

• Moments to shopping centre, train station, schools, freeway access and more

• A generous wrap around veranda takes in the lovely rural views

• With great tenants in place who love living here, paying $360 per week,

makes this the perfect investment. Block size: 698.3m2

4 1 0

for sale $369,000View Saturday 10.00am-10.30amContact Deb Cummins 0412 426 495Email deb.cummins@mmj.com.auWeb iD mmj.com.au/8P1069

open saturdaySHELL COVE, 10 Gabo Crescent• Nestled in a quiet yet convenient location in the sea side estate “Shell Cove”• Modern in colour and design with 4 bedrooms and 3 separate living areas• Walk-in robe and ensuite to the master bedroom, natural gas & an alfresco area• Currently leased for $530 per week to great tenants. Block size 519.1m2• The perfect investment, family home and retirees’ low maintenance home

4 2 2

for sale $509,000View Saturday 11.00am-11.30amContact Deb Cummins 0412 426 495Email deb.cummins@mmj.com.auWeb iD mmj.com.au/8P1027

lake frontageprimbee, 168 Lakeview Parade• Prime north facing lakefront property in a highly sought after area• Renovated cottage with updated kitchen and bathroom• Potential to build your dream home (subject to council approval)• Imagine the lifestyle of sitting on the back deck, taking in the unrestricted water

views with a wine or beer in hand

4 1 1

for sale $419,000 View By AppointmentContact Dale Whittaker 0414 376 720Email dale.whittaker@mmj.com.auWeb iD mmj.com.au/8P1005

your slice of paradiselake illawarra, Corner of Entrance St and Pur Pur Ave

• The only thing between you and the surf is the reserve

• Waterfront property - watch the sunrise daily

• Design your dream home in this sought after location (subject to council approval)

• Metres to Warilla Surf Club and boat ramp, walking distance to all amenities

Just a 5 minute drive to Stockland Shellharbour

for sale from $395,000View By AppointmentContact Deb Cummins 0412 426 495 deb.cummins@mmj.com.au Mark De Cresci 0422 744 097 mark.decresci@mmj.com.auWeb iD mmj.com.au/8P1032

MMJ North l 4285 5999mmjnorth@mmj.com.auwww.mmj.com.au

“I’m yours”!balgownie, 10b Terrell Place

• Modern Torrens Title townhouse

• Two generous sized bedrooms both with BIW’s and balconies

• Polishedsolidtimberflooringwithanopenplanliving/diningarea

• Neattimberkitchenwithinductiongascooktop

• Secondtoiletoffthelaundryopeningouttoanoversizedprivatecourtyard

2 1 1

for sale $379,500View Sat16/0210.45-11.30amContact GleniceMcMahon0407293466Email glenice.mcmahon@mmj.com.auWeb iD mmj.com.au/4P3628

spruced up!bulli, 14CopePlace• ThistrilevelresidenceispositionedonacornerlotbackingontoGrevilleaPark• RecentlyrefurbishedinteriorswithnewBerbercarpetandfreshlypainted• Featurescathedralceilings,ensuiteandW.I.Wtomainbedroom• Separatediningplusfamilyroom.Internalaccesstogarage• Ampletimberdecksaffordtranquilviewswithchildfriendlyyardspace

4 2 2

offers above $560,000View Sat16/0211.00-11.30amContact RogerHughes0412424071Email roger.hughes@mmj.com.auWeb iD mmj.com.au/4P3621

growth opportunity!CORRIMAL, 3/15UnderwoodStreet• Riskfree,topshelfinvestment,idealforSMSF• Potentialrentof$340-$360pw• 1st class interiors with new ensuite and bathroom• Minuteswalktoeveryamenity• Vacant and able to lease before settlement

3 2 2

by neg $320,000 - $360,000View Sat16/0212.00-12.30pmContact RogerHughes0412424071Email roger.hughes@mmj.com.auWeb iD mmj.com.au/4P3536

be mine.....corrimal, 90WilgaStreet

• Spacious,wellpresentedcladandtilefamilyhome• Boasting3doublebedroomspluslargelounge• Moderneatinkitchenandseparatedining/family• Asparklingasnewbathroomandundercoverentertainersdeck• Allthisconvenientlylocatedonlyashortwalktoeverything!

3 1 2

for sale $469,950View Sat16/021.15-2.00pmContact TroyPhipps0412425801Email troy.phipps@mmj.com.auWeb iD mmj.com.au/4P3683

fall in love with my view.....WOONONA, 51GahansAvenue• Modernfamilyhomefullyrenovatedfeaturingqualityfittingsthroughout• Boastingtwo,modernopenplanlivingareasupstairswithviews• Stunningkitchenwithstonebenchtopsandgrandmarblebathroom• Downstairsrumpus/homeoffice,coveredentertainingarea,deckedpool• Aprivatelocationwithnorearneighbourcompletesthissuperbpackage

3 2 1

offers above $599,000View Sat16/0212.15-1.00pmContact TroyPhipps0412425801Email troy.phipps@mmj.com.auWeb iD mmj.com.au/4P3407

exceptional residence on quarter acrecordeaux heights, 200DerribongDrive• Ahomewherethekidscanplaycricket&footy&thenjumpinthepool

• Formal&informaldining&livingareaswithaccesstoentertainmentarea

• ModernBlackwoodkitchencompletewithadoubleovenforthefamilychef

• Separaterumpusroomwithwesternredcedarcathedralceiling&wetbar

• Ductedreversecycleair-con,3cargarage

4 3 3

by neg $750,000 - $790,000View Sat16/0211.00-11.45amContact GregEllul0412421214Email greg.ellul@mmj.com.auWeb iD mmj.com.au/4P3710

MMJ North l 4285 5999mmjnorth@mmj.com.auwww.mmj.com.au

what a stunner!corrimal, 4/37 The Avenue

• Uniquetownhouselocatedinasmallcomplexofonlyfive• Largeopenplanlivingareaupstairswithpolishedfloors&modernkitchen• Livingareaopenstolargeterracecourtyardwithbreathtakingoceanviews• Two double bedrooms, main with WIW and ensuite and BIW in the second• Doubleremotelockupgaragewithintaccessandaccesstocourtyard

2 2 2

for sale $455,000View By AppointmentContact Greg Ellul 0412 421 214Email greg.ellul@mmj.com.auWeb iD mmj.com.au/4P3686

unattached!WOONONA, 3/25 Popes Road

• Freshlypaintedlargefunctionalkitchen&openplanlivingwithnewtimberfloors• 2 double bedrooms both with BIW’s and new carpet and blinds throughout• Large bathroom set up for disable use• Locatedattherearofthedevelopmentinasmallblockof4totallyfreestanding• CompletewithdoubleremotelockupgarageandaspaciousUshapedc/yard

2 1 2

for sale $369,900View Sat 16/02 2.00 - 2.30pmContact Greg Ellul 0412 421 214Email greg.ellul@mmj.com.auWeb iD mmj.com.au/4P3678

brand new like a sparkling gemcorrimal, 1,2&3/273RotheryStreet• Architecturallydesignedformaximumbenefit.Interiorsaremodern&vibrant• Offering an abundance of light and space throughout• Townhouse 1 $480,000 - $500,000• Townhouse 2 $500,000 - $530,000• Townhouse 3 $520,000 - $550,000

3 2 2

by negotiationView Sat 16/02 12.00 - 1.45pmContact Greg Ellul 0412 421 214Email greg.ellul@mmj.com.auWeb iD mmj.com.au/4P3585

be the centre of attention....wollongong, 86 New Dapto Road

• Old world charmer in Wollongong, located across from the Hospital• Previously used as health clinic complete with 6 car spaces on site• Highornateceilings,polishedtimberfloors,3doublebedrooms• Galleystylekitchenwithseparateair-conditioneddiningandliving• Complete with large separate laundry and 4th bedroom or recreation room

3 1 6

for sale $417,000View By AppointmentContact Greg Ellul 0412 421 214Email greg.ellul@mmj.com.auWeb iD mmj.com.au/4P3674

pretty to look at...lake heights, 396 Northcliffe Drive

• Very well presented family home• SpaciousloungeanddiningareawithviewsoverLakeIllawarra• 3 double bedrooms all with BIW’s• Largekitchen,separatelaundryandsecurerearyardforthekids• Completewithsinglelockupgarageandplentyofunderhousestorage

3 1 1

for sale $319,900View By AppointmentContact Greg Ellul 0412 421 214Email greg.ellul@mmj.com.auWeb iD mmj.com.au/4P0109

lets start a new!FARMBOROUGH HEIGHTS, 222 Farmborough Heights

• Magnificentocean,cityandmountainviewsbyday• Relaxing Christmas City lights each night• Short distance to the railway station, schools and shops• Top of Farmborough Heights facing North• Gentlyslopingblockof457.6sqm

for sale $242,000View By AppointmentContact Jade O’Byrne 0405 180 593Email jade.obyrne@mmj.com.auWeb iD mmj.com.au/4P3618

not quite roses but......corrimal, 5 Mountbatten Street

• Idealfirsthomeorinvestment,waitingforsomeonetomakeittheirown• North facing home located in a friendly cul de sac, ideal for a family • Sizeable bedrooms all with built in robes • Two separate living areas • Level and practical 619sqm, easy to maintain and plenty of storage

3 2 1

for sale $400,000View Sat 16/02 11.00 - 11.30am Contact Greg Truebody 0412 626 964Email greg.truebody@mmj.com.auWeb iD mmj.com.au/4P3502

what a perfect couple!wollongong, 75 Kenny Street

• D.Aapprovedforalargewarehouse/showroomwithampleparking• Currently2flatsreturning$370p.w• Fantasticlevel660sqmblockinsoughtafterbusinessprecinct• Build your new business premises or lease out• A truly rare opportunity that will not last!

3 2 0

offers above $450,000View By AppointmentContact Troy Phipps 0412 425 801 Email troy.phipps@mmj.com.auWeb iD mmj.com.au/4P3474

22 14 February 2013

MMJ North l 4285 5999mmjnorth@mmj.com.auwww.mmj.com.au

first date!figtree, 48 Risley Road

Yes the price is right, a brick and tile home for the price of a unit3 good sized bedrooms with BIW’sBoasting modern timber kitchen and neat bathroom

Opposite acres of parkland and only minutes to Figtree Shopping Centre

3 1 1

by neg $335,000 - $355,000View Sat 16/02 11.00 - 11.45amContact Troy Phipps 0412 425 801Email troy.phipps@mmj.com.auWeb iD mmj.com.au/4P3620

oh so sexy!BALGOWNIE,

Four spacious bedrooms with BIW’s main with ensuite

North facing yard with sparkling i/g pool and ample entertaining space

4 2 2

for sale $749,950View Sat 16/02 12.15 - 1.00pmContact Troy Phipps 0412 425 801Email troy.phipps@mmj.com.auWeb iD mmj.com.au/4P3511

fifty shades of fantasticcorrimal, 6/225 Princes Highway

Secure underbuilding parkingLuxuriously appointed throughoutCentrally located in Corrimals CBD

3 1 2

for sale $429,950View By AppointmentContact Troy Phipps 0412 425 801Email troy.phipps@mmj.com.auWeb iD mmj.com.au/4P0075

artists impression

“chocolates & roses”woonona, 1/105-107 Campbell Street

An ideal retirement package, only a short walk to shops and beach

2 1 1

offers above $390,000View By AppointmentContact Troy Phipps 0412 425 801Email troy.phipps@mmj.com.auWeb iD mmj.com.au/4P3435

LOCATION SHOT

MMJ North l 4285 5999mmjnorth@mmj.com.auwww.mmj.com.au

Fairy

Mea

dow

Owner Loves• Quiet complex with lots of natural light• Conveniently located close to the Tafe, Wollongong University, shopping centres

and beaches with the Free Shuttle bus right at your doorstep

Inspect: Sat 16 February 12:00-12:40pmSale: $279,990Contact: Danny O´Neill 0416 089 884 dannyo@southernestates.com.au

21/192-198 Princes Highway$279,990

2

1

1

Plus• Updated bathroom and neat & tidy kitchen with plenty of cupboard space• Enclosed balcony providing extra living space plus large secure storage room• Great investment opportunity

Wol

long

ong

Owner Loves• Oversized 2 with potential for 3 bedroom townhouse• Small complex of 3• Generous bedrooms with built-in wardrobes

Inspect: Sat 16 February 11:00-11:40amSale: $443,000Contact: Jason Capelo 0424 372 722 jasonc@southernestates.com.au

3/8 Gilmore Street$443,000

2

2

2

Plus• Internal access from double garage• Large courtyard, great for entertaining• Handy location near public transport

Kei

ravi

lle

Owner Loves• Renovated 2 bedroom unit• Outdoor patio area great for entertaining• Polished floorboards throughout living areas

Inspect: By AppointmentSale: $289,000Contact: Jason Capelo 0424 372 722 jasonc@southernestates.com.au

3/48 Robsons Road$289,000

2

1

1

Plus• Located close to public transport & Wollongong Uni• Single lock up garage• Both bedrooms have built-in wardrobes

Cor

dea

ux H

eigh

ts

Owner Loves• Beautiful quiet cul-de-sac location with great neighbours• Timber floors• Modern kitchen with stainless steel appliances

Inspect: Sat 16 February 11:00-11:40amSale: $424,000Contact: Danny O´Neill 0416 089 884 dannyo@southernestates.com.au

19 Serrata Place$424,000

3

1

Plus• Newly renovated bathroom• Low maintenance level block• Fully fenced rear yard

Lake

Hei

ghts

Owner Loves• Majority of blocks still available are north facing• Close to schools, Westfield Warrawong & Lake Illawarra• Just 10 minutes by car to Wollongong CBD and Shellharbour

Inspect: Direct - Vacant BlocksSale: $142,500Contact: Jason Capelo 0424 372 722 jasonc@southernestates.com.au

Lot Shearwater Dr & Whimbrel AveAll Blocks $142,500

Plus• Only 6 blocks remaining• Blocks ranging from 555.8 - 916.3sqm • Perfect opportunity to build your dream home!

R E A L E S T A T E

Level 1, 65 Market Street, Wollongong

View more properties: www.mcphailrealestate.com

STUNNING VIEWS!

9/1 View Street North WollongongOpen for Inspection: Saturday 11:00 am to 11:45 am

• Stunning views along the coastline from this unique top floor 4 bedroom Penthouse apartment - conveniently located just a short 5 minute walk from glorious North Wollongong Beach.• Generous open plan living areas incorporating quality soft furnishings and finishes, fully ducted air conditioning, integrated surround sound music and television system.• Ensuite and walk-in robe to master suite, 3 additional BIW’s, security lift access and alarm system. Large 4+ car remote control garage with further storage and wine cellar.• Sparkling white polyurethane and granite kitchen with quality stainless steel appliances. Extensive fully tiled outdoor wrap around terraces with outdoor BBQ gas point. • Exceptionally well maintained building, common areas, gardens and grounds. A truly unique offering that must be inspected to be fully appreciated!

Contact: Nick Logan 0418 420090

4

2

4

North Wollongong $1,250,000

190G/210 Windang Road, Windang -Oasis VillageOpen For Inspection : By Appointment

• Featuring 3 genuine bedrooms, air conditioned living with high ceilings, spacious kitchen with separate dining, bathroom with showerand a 2nd toilet off the laundry.

• The home has superior street appeal featuring a large front balcony the length of the home with ramp access.

Contact: Daniel Ellem 0410 868632

3

1

1

Windang $280,000

NEW LISTING

89 Chillawong Circuit Open For Inspection: Saturday 11.00 am till 11.30 am

• Smartly designed & neat presentation sets this 4 bedroom home apart from the rest!• Conveniently located in a quiet side street walking distance to Shellharbour Square.• Open plan living areas - Modern kitchen with dishwasher - Bar and entertainment area.• Fully enclosed sunny pool area plus easy garden and grounds - Single car garage.• One of the best we’ve had the pleasure to present! Come along and have a look!

Contact: Daniel Ellem 0410 868632

4

1

1

Blackbutt $390,000

NEW LISTING

4/30 Urunga ParadeOpen For Inspection: Saturday 12.30 pm till 1.00 pm

• Convenient CBD fringe location close to W’gong Hospital with short walk to train or town.• Top floor north facing 2 bedroom unit with large lock-up garage in small block of 4.• Spacious bedrooms, modern kitchen, internal laundry, sun room and intercom entry.• Currently leased to excellent long term tenant or vacant possession avilable for owner

occupier. Perfect entry level property for investor or first home purchaser alike!Contact: Nick Logan 0418 420090

2

1

1

Wollongong $269,000

38/146 Windang Road, Oasis VillageOpen For Inspection : By Appointment

• 3 bedrooms with b-i-w’s and an en suite off the main• Open plan air conditioned living with large dining area• Stunning kitchen with new stove and dishwasher• Large sun room or second living room • Tandem carport, Large lock up storage shed, private courtyard area

Contact: Daniel Ellem 0410 868632

3

2

2

Windang $295,000

STUNNING

R E A L E S T A T E

Level 1, 65 Market Street, Wollongong

View more properties: www.mcphailrealestate.com

NEW LISTING

10 Kana Place , Balarang.Open For Inspection : Saturday 9.45 am till 10.30 am

• Stunning single level modern brick and tile home on a large level lot in a quiet street• 3 genuine bedrooms with b-i-w’s and a possible 4th if needed• Open plan air conditioned living with floating floors and down lights• Stunning Kitchen featuring stone bench tops, s-steel appliances and soft touch cupboards• Enclosed entertaining area overlooking the beautiful back yard and in ground pool

Contact: Daniel Ellem 0410 868632

4

1

3

Balarang Offers Above $460,000

OPEN HOME

44 Ash AvenueOpen for Inspection : Saturday 10.00 am Till 10.30 am

• 3 good size bedrooms all featuring BIW’s ( main comfortably accommodates king size bed)• Air conditioned living area with polished floor boards • Renovated kitchen with free standing stainless steel gas range• French doors off the kitchen to a gorgeous covered entertaining deck• Large private fully fenced front and back yard including 2 garden sheds.

Contact: Daniel Ellem 0410 868632

3

1

1

Albion Park Rail $335,000

NEW LISTING

4/46-48 Corrimal Street WollongongOpen For Inspection : By Appointment

• Only one block from Cliff Road - modern three bedroom home unit in small block of 6 • Spacious kitchen, adjacent dining and sunny lounge area & recently carpeted throughout.• Light, bright and airy with wrap around balconies and sliding glass doors• Three generous bedrooms with BIW’s, master with ensuite and access to private balcony• Well maintained gardens and grounds, no lift plus double remote control lock-up garage.

Contact: David Meikle 0412 422 294

3

2

2

Wollongong $519,000

290/19 Judbooley ParadeOpen For Inspection : By Appointment

• This one and a half bedroom renovated caravan with annex will make a perfect home.• The park features security boom gates, heated in ground pool, community hall, BBQ facili-

ties, lawn maintenance and edging provided as part of your site fee.• Good size bedroom with walk in robe,air conditioned living, 2 way bathroom, study area,

front balcony, carport and a lock up shed.Contact: Daniel Ellem 0418 420090

Windang $95,000

NEW LISTING

46/Third ave , 120 Osborne ParadeOpen For Inspection : By Appointment

• Only 15 metres to the waters edge and in great condition.• 2 bedrooms with the main big enough for a queen size bed• Open living plus a second entertaining area• Carport enclosed with alfresco blinds, instantaneous hot water, security grills privacy

screens!Contact: Daniel Ellem 0410 868632

2

1

1

Warilla $64,000

NEW PRICE

3/9th Ave 120 Osborne Parade- Lake Windermere ParkOpen For Inspection : By Appointment

• Located in the Lake Windermere Village, this 2 bedroom van is a cheap entry to a lifestyle.• Featuring 2 bedrooms, good size living area, spacious kitchen, bathroom and laundry, car

port and 2 lock up sheds. • A permanent site and with a lower site fee than its neighbours, you don’t want to miss this

one.Contact: Daniel Ellem 0410 868632

1

1

1

Warilla $90,000

NEW LISTING

29/146 Windang Rd ,Oasis VillageOpen For Inspection : By Appointment

• 1 good size bedroom with double bed, bed side tables, walk in robe and en suite• Spacious open plan living-kitchen-dining area with reverse cycle air conditioning• Small area for office setup• Large single carport with leafy courtyard at the rear

Contact: Daniel Ellem 0410 868632

1

1

1

Windang $135,000

NEW LISTING

THIRROUL $850,000

This dbl lot consisting of a residence & a block of land is being sold as one. The three bed home consists of modern kitchen & bathroom, large rear deck & a sgl LUG with an approx value of $650,000. The land located at the rear of the house would be worth an approx $200,000. DA Approval to construct a four bed, 2 bath & double garage home on the vacant block of land. Once your new home or investment is constructed split the two blocks & sell one to create a great lifestyle choice by reducing your mortgage.

COLEDALE $649,000

Entertaining will be a delight with a flat backyard, downstairs room, rear lane access & single LUG its easy to see this location is so sought after. Offered for the first time in nearly 30 years & with low interest rates now may be your best time to move North.

WOONONA $835,000

Designed for family living with 3 lounge areas, a gourmet kitchen & formal & informal dining areas. Other Features include 5 bedrooms plus study, large master bedroom with ocean views, entertainers deck & a stunning inground solar heated pool.

WOMBARRA $939,000

This immaculate property is nestled in the foothills of the escarpment and has privacy and tranquillity in mind. See nothing but trees from every outlook of this home yet you´re only minutes to Wombarra Beach.

WOONONA $650,000

Large & modern best describes this property. Offering 4 beds, main with ensuite & WIR, large living area, separate dining off modern kitchen opening out to entertaining area. Dbl garage & landscaped gardens complement this immaculate home.

WOONONA $525,000

This 3 bedroom home, plus study is ready for you to move straight into. Rare for this area, you have a flat private yard with a good-sized deck that comes off the lounge/kitchen area so it´s perfect for entertaining and watching the kids play.

RUSSELL VALE $579,000

Newly renovated top level has 2 beds, rumpus room for the kids and a new bathroom. Downstairs, the large kitchen, separate lounge and dining, 2 bedrooms second bathroom & a beautiful pool will definitely not disappoint.

BULLI $528,000

Beautiful leafy backdrop and located in a quiet street of Bulli, this home features 3 bedrooms, separate lounge & dining, large kitchen and a beautiful in-ground pool with a bathroom attached. It has the tranquillity you have been looking for.

CORRIMAL $649,000

An impressive double fronted two level family home on a 746m2 approx block. Open plan living & dining, designer gourmet kitchen & entertaining terrace. 5 beds, main with ensuite & WIR. Rumpus room, Internal laundry & LUG with internal access.

WOONONA $249,900

Immaculate renovated unit with beautiful leafy outlook. Walk to shops, beaches and ocean pool from this great central location. Features include modern kitchen and bathroom, combined lounge & dining area opening out to balcony and single garage.

WOLLONGONG $649,000

Located 1km from the hospital & close to CBD this investment will be paying for itself. Currently tenanted as a 7 bedroom townhouse & in the medical precinct of Wollongong, this property is DA approved for a medical practice or residential.

JUST LISTED

WOONONA $495,000

This spacious townhouse features a large north facing sun-filled dining & living area. Generous sized grassed yard, private deck with cafe blinds perfect for undercover alfresco entertaining & a stunning kitchen with granite bench tops.

JUST LISTED

WOONONA $260,000

Don´t miss this opportunity to be in a new home located in a quiet street of Woonona. This location is in one of the best spots of the beautiful Woonona area and on a near level block leaving your imagination free to run wild (Subject to WCC Approval).

Coastside

coastsidefn.com.auShop 4/20-26 Addison St, Shellharbour

4295 5033

Set within a boutique complex of three, this sleek low maintenance townhouse balances the needs of convenient family living with contemporary style. Perfectly located close to shops, schools, parks and public transport, enjoy the peacefully quiet surrounds while you sit, back and relax.

OPEN SAT 11.00-11.30AM

3 1 2

Contact Matt Hutchinson 0423 507 488

OPE

N

HOUSE

NEW

LISTING

UNANDERRA 2/46 Central Ave $359,000

More Than Meets the EyeThis is your chance to step into the property market or increase your existing property portfolio. Now on offer is a very neat and complete 2 bedroom villa. Good sized lounge room with nice sunny windows. Tidy kitchen with breakfast bar. Upstairs main bedroom has its own balcony. And there is also your own garage. Currently tenanted for $290 p/wk. This one is a great little investment.

OPEN SAT 12.30-1.00PM

2 1 1

Contact Maria Field 0411 306 323

OPE

N

HOUSE

NEW

LISTING

ALBION PARL RAIL 9/30 Bateman Ave $242,000

Neat Modern Unit

Showcasing an elevated setting, open plan interiors and a versatile floorplan, this modern family home is sure to have something for the whole family. Situated in prestigious Hermitage Estate, it features a large open kitchen and casual living/dining area that overlooks the raised and enclosed entertainment area. With an easy walk to the corner store and close to schools and public transport, this property is well worth a closer look.

OPEN SAT 11.30-12.004 2 2

Contact Maria Field 0411 306 323

OPE

N

HOUSE

NEW

PRICE

DAPTO 9 Chardonnay Ave $448,000

Perfect Family Haven

Located in a tranquil family-friendly pocket, this striking residence presents an inviting living environment. Neatly presented, it offers a relaxed and low maintenance lifestyle ideal for family living. Within a short walk to schools, parks, shops and public transport this property is the perfect family starter.

OPEN SAT 12.00-12.30PM

3 1

Contact Matt Hutchinson 0423 507 488

OPE

N

HOUSE

KOONAWARRA 19 Culgoa Crescent $279,000

Perfect Family Starter

Commanding an elevated position in a peaceful location, this eye catching character filled residence will please the senses and ignite the imagination. Situated in a highly sought after location, this prized property is an opportunity not to be missed. Offering three good sized bedrooms, all with built in robes, neat open kitchen with ample cupboard and benchspace, entertaining courtyard with enchanting gardens and double lock up garage with workshop area.

OPEN SAT 10.30-11.00AM

4 2 2

Contact Maria Field 0411 306 323

OPE

N

HOUSE

NEW

PRICE

FIGTREE 12 Zelang Ave $438,000

Character And CharmOffering a blissful lifestyle only a short drive from the town centre, this private oasis, set on 2.3 acres, boasts limitless possibilities. Featuring panoramic rural views, you´ll admire both the simplicity and self sustainability of this stunning architecturally designed modern masterpiece. Offering style, sophisticated indoor/outdoor living, and a second residence, this eco friendly property is unmatched. Agents Interest Declared.

4 3 4+

Contact Maria Field 0411 306 323

YALLAH 27 Larkins Lane $1,198,000

Priceless Outlook

Located moments away from Shellharbour´s cafes and beaches this 2 bedroom unit complete with open plan kitchen/dining/lounge is a must for any first home buyer or couple that want to downsize in a relaxed environment. Potential rental income of $285 per week.

2 1 1

Contact: Darren Mansell 0413 747 322

BARRACK HEIGHTS7/4 Blackbutt Way $229,000

All At Your Fingertips!

This exceptional family residence emanates contemporary luxury and elegance. Providing a choice of formal and casual living areas that spill outdoors to the enclosed entertainment area and a large landscaped backyard, this residence is perfect for the family. Four large bedrooms, complete with built in wardrobes, magnificent master bedroom featuring large en-suite, walk in robe and separate sitting area, separate study area with internal garage access.

4 2 3

Contact Maria Field 0411 306 323

SHELL COVE 3 Green Cres $644,500

Designer LivingPositioned on a generous 601sqm parcel in a peaceful setting, this completely renovated single level home is ideal for the young family while providing a great start to life. Featuring quality finishings and in a desired location, this is the perfect opportunity to sit back and relax because all the hard work has already been done.

3 1 4

Contact Maria Field 0411 306 323

DAPTO 7 Kapooka Ave $419,000

All the Hard Work is Done

Nestled in a highly sought after location with escarpment views, a unique opportunity exists to purchase two great homes on one large 1000m2 block of land. Main residence with private in ground solar heated pool. Secondary is ideal for grandparents or to rent out for of $280 - $300 p/w

6 2 3

Contact: Darren Mansell 0413 747 322

CORDEAUX HTS2 Mungurra Hill Rd $799,000-$835,000

Two Homes For One Price

This tastefully decorated ground floor unit has it all and is in close proximity to just about everything. Offering polished floors, brand new kitchen, BIW to main bedroom, internal laundry, off street parking and a massive common backyard. Close to shops, schools, public transport and a stone´s throw to the beach.

2 1

Contact: Matthew Hutchinson 0423 507 488

BELLAMBI4/20 Owen Park Rd $269,000

Get In On The Ground Floor

An opportunity presents to purchase the final block available on prestigious Southern Cross Boulevard in Shell Cove. Why not build your dream home right here on this lovely flat block surrounded by quality homes. Only minutes away from Shellharbour Village and the proposed marina.Contact: Maria Field 0411 306 323

SHELL COVE56 Southern Cross Bvd $289,000

Lifestyle, Position And Potential

Fall in love with this beautiful family home. Three bedrooms and a fully renovated bathroom. Good size kitchen/dining room and separate lounge. Brand new Colourbond roof and gutters on the house and garage. Flat block and great size backyard for the kids to play. Oversized single garage for your car.

OPEN SAT 2.30-3.00PM3 1 1

Contact: Darren Mansell 0413 747 322

OPE

N

HOUSE

WARILLA19 Spofforth St $269,900

First Home Buyers Delight

Nestled in the heart of Port Kembla´s thriving CBD, this fantastic unit is an investement opportunity not to be missed. Featuring 2 large second floor bedrooms and an open plan kitchen/dining area, the first to see this property will buy. Complete with undercover parking and currently rented out at $230 per week.

OPEN SAT 1.30-2.00PM2 1

Contact: Darren Mansell 0413 747 322

OPE

N

HOUSE

NEW

PRICE

PORT KEMBLA2/173 Wentworth St $189,900

Owner says SELL!!!Located only moments from the South Shellharbour beach and within walking distance to picturesque Shellharbour this perfectly flat 751sqm parcel of land offers a wonderful opportunity to build your dream home. Currently the only flat block of land within walking distance to the beach.Contact: Darren Mansell 0413 747 322

SHELLHARBOUR19 Boollwarroo Prd $550,000

Location, Location, LocationSituated in "The Pines" release of the exclusive Shell Cove estate, this prime parcel of land is surrounded by quality homes and sits right next door to a park complete with a children´s play centre. Handily positioned close to Schools, Community Centre and the new Medical Centre.Contact: Maria Field 0411 306 323

SHELL COVE6 Montague Cres $249,000

Magical Montague

Domain

112 Central RoadUnanderra

domainfirstnational.com.au 4271 7444

Positioned in a great area of Dapto Heights is this beautiful split level modern design home. Only 6 months young & surrounded by other quality homes, it features BIW’s to 3 of the 4 spacious b/r’s with ensuite to main. Large open plan living area & dining area with a separate family room leading out to alfresco area all capturing the pictu- resque mountain views. Remote 2 car x-large garage with internal access. Why build when this home has it all & more. Currently leased to excellent tenants at $540 p/w

INSPECT 11:00-11:30AM

4 2 2

Contact Ali Yagmur 0412 717 444Inspect Saturday, 16 February 11:00-11:30am

OPEN

DAPTO 16A Carlyle Close $469,000

Your Dream Home Awaits YouCapture the magnificent lake and escarpment views from the decking or your huge double lounge room. Featuring 3 good size bedrooms, polished floorboards throughout, a modern kitchen with gas stove and dishwasher and an updated bathroom. Outside features a enclosed undercover decking and BBQ area, second shower and toilet in laundry with ample storage. Landscaped gardens with carport & 2nd off street parking area.

INSPECT 11:45-12:15PM

4 2 1

Contact Ali Yagmur 0412 717 444Inspect Saturday, 16 February 11:45-12:15pm

OPEN

BERKELEY 86 Nottingham Street $299,000

Magnificent Outlook

3 bedroom home plus a fully self-contained studio. The lovely home features 3 b/r’s with BIW’s to 2 of the 3 spacious b/r’s & an updated bathroom. Large sunny lounge room & modern kitchen with open plan dining & fire place. Balcony off the rear leading out to the back yard, with shed, carport & detached fully self-contained Studio. Be impressed, the studio features a modern renovated kitchen & bathroom, large open plan lounge & bedroom, great teenagers retreat or potential rental of $170 p/w.

4 2 1

Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment.

BERKELEY 1 Barnes Street OFFERS ABOVE $300,000

Must Sell / All Offers Considered

Set back from the street is this lovely 3 bedroom brick veneer home. Featuring a beautiful open plan living with neat and tidy kitchen with gas appliances. The bathroom features shower and bathtub with separate wc. Relax and step outside to the undercover entertainment area with a small landscaped yard and a natural watercourse. Huge garage with heaps of storage. Ideal first home in a sought after area.

INSPECT 12:30-1:00PM

3 1 1

Contact Ali Yagmur 0412 717 444Inspect Saturday, 16 February 12:30-1:00pm

OPEN

FARMBOROUGH HEIGHTS 50 Loch Carron Avenue $349,000

Hidden Delight

Newly renovated 3 b/r apartment situated in a prime position in Market Street. Featuring a large tiled open plan living area opening out onto a spacious tiled balcony. Brand new, high gloss kitchen with an island bar, caesar stone bench tops, tiled splash-back & gas cooking. Modern & newly renovated bathroom with internal laundry. Mirrored BIW’s to all 3 spacious b/r’s with the main bedroom also opening out onto the 2nd tiled balcony. Remote lock up garage to fit 2-3 cars.

INSPECT 1:30-2:00PM

3 1 3

Contact Krystal Cassoli 0403 521 007Inspect Saturday, 16 February 1:30-2:00pm

OPEN

WOLLONGONG 6/24 Market Street EXPRESSION OF INTEREST

City Living - All Serious Offers ConsideredRequiring a little T.L.C. to bring the beauty back is this north facing 3 bedroom home. Featuring 3 spacious bedrooms with a large living area. Neat and tidy bathroom with a simple kitchen and separate dining room. Ideal home for the first home buyer, renovator and or great investment opportunity.

3 1 1

Contact Ali Yagmur 0412 717 444 Inspect As advertised or by appointment.

NEW

CRINGILA 25 Steel Street $229,000

Good Buying!

28 14 February 2013

O’ConnorO’Connor

O’ConnorO’Connor

4226 60551/55 Kembla Street Wollongongwww.oconnors.com.au

REAL ESTATE

arre.com.au 4228 2555 (formerly FANNING REAL ESTATE)

Worrigee

Opportunity KnocksFor Sale: Offers From $309,000Open: Sat 11:30am - 12:00pm

• Well maintained family home spanning a single level • Open plan dining and lounge room with a new dishwasher and oven• Three bedrooms, all with built-in wardrobes• Alfresco entertaining area, private low maintenance gardens• Freshly painted and featuring new carpet• Oversize single garage with additional off street parking

26 Socrates Place

Chris Atlee 0466 631 545

arre.com.au/2052

Koonawarra

14 Aldinga Avenue

Looking For A First Home?For Sale: $289,000

Open: By Appointment

• Immaculately presented three bedroom family home• High ceilings, mostly polished floors & practical design• Lounge with split system reverse cycle air conditioner• Great sized functional kitchen with defined dining• Detached large single garage plus two carports• Fully fenced backyard on a very desirable block

Renee Lambert0418 423 636

arre.com.au/2056

Lake Heights

37 Northcliffe Drive

Spectacular Lake Views

For Sale: $425,000Open: Sat 2:00-2:30pmSharyn Moffat 0499 989 998arre.com.au/2036

• Almost 900m2 backing on to Lake Illawarra• Two large bedrooms with built in robe to main• Recently painted with new floor coverings throughout• Level manicured yard - enjoy the lakeside location

Towradgi

104 Towradgi Road

Perfectly Positioned For Sale: Offers above $450,000

Open: Sat 10:00-10:30am

• Brick home with high ceilings and great cornices• Three large bedrooms, two with built in wardrobes• Original kitchen and bathroom with bath and shower• Big level, north facing backyard that is child safe• For the car there is a single garage plus a carport• Easy access to train station, Memorial Drive & beach

Sharyn Moffat0499 989 998

arre.com.au/2047

Woonona

94J Popes Road

Block To Suit Split Level

For Sale: $295,000Open: By AppointmentSharyn Moffat 0499 989 998arre.com.au/2028

• Gently sloping 600m2 cleared block • Positioned at the very end of Popes Lane• Electricity, gas and water are at the block • Take advantage of Grants & Concessions

Barrack Heights

2/42 Loftus Drive

Priced To Go ...

For Sale: $229,000Open: By AppointmentScott Phillips 0422 183 341arre.com.au/2057

• Immaculate two bedroom villa style unit• Located at rear of small complex of two• Fantastic rental return of $220 per week• Carport and private rear sunny courtyard

Oak Flats

40 Devonshire Crescent

Two Good Size Homes

For Sale: Price By NegotiationOpen: By AppointmentScott Phillips 0422 183 341arre.com.au/2038

• Dual occupancy, two houses on level 1126m2 block• House One - 5 bedrooms, 2 bathrooms, carport• House Two - 2 bedrooms, double lockup garage • Walking distance to lake & Shellharbour Square

Dougmal Harcourts Kiama4232 1322dougmalkiama.harcourts.com.au

AUCTIO

N

DA approved luxury duplex site on a magnificant water front reserve block. Or design and build your dream home on this fantastic location.• Coastal views, quiet location• 5 minutes drive to Gerringong, shops, schools, golf & surf• Access to walking trails around headlands to Kiama & Gerringong• Land size: 892sqm approx

OPEN HOME: By AppointmentAUCTION: 23rd February 2013

11am on siteunless sold beforehand

WEB ID# NKM4322

Andy WhartonM: 0412 638 708E: andyw@dougmal.com.auDougmal Harcourts Kiama 4232 1322

Kiama Heights 18 Elanora Road AUCTIONRare vacant water front block

VIEW AT: dougmalkiama.harcourts.com.au

NEW LIS

TING

OPEN

Commanding an enviable position overlooking the dramatic southern coastline and built to capture aspect and views this eye-catching property leaves nothing to be desired.• Parents retreat with separate living & ensuite bathroom• 2nd bedroom with walk-in robe & sitting area• Modern, well appointed kitchen accessing outdoor entertaining & pool

OPEN HOME: Saturday 16 February 201311.00 - 11.30am

WEB ID#: NKM4493

3 2 2

Susan SpenceM: 0412 271 091E: susans@dougmal.com.auDougmal Harcourts Kiama 4232 1322

Kiama Downs 38 Eureka Avenue $1,150,000Surf watch

VIEW AT: dougmalkiama.harcourts.com.au

3 2 1

Andy WhartonM: 0412 638 708E: andyw@dougmal.com.auDougmal Harcourts Kiama 4232 1322

Capitalise on the size, versatility and position waiting for you in this sturdy home. • 620sqm block with wide frontage• Level living and northerly aspect• Ocean glimpses • Excellent neighbourhood and sought after area• Room to improve and value add

OPEN HOME: By AppointmentWEB ID#: NKM4274

Kiama 67 Marsden Street offers above $570,000So many advantages!

VIEW AT: dougmalkiama.harcourts.com.au

OPEN

3 1 2

Susan SpenceM: 0412 271 091E: susans@dougmal.com.auDougmal Harcourts Kiama 4232 1322

Uninterrupted rural and district views over Kiama Downs and Jamberoo valley perfectly set the scene for a peaceful lifestyle in this charming family home. Situated on a sunny 680sqm block in a tightly-held family neighbourhood the location is within walking distance to shops and beach.• Split level living room & study area downstairs• Spacious entertaining deck

OPEN HOME: Saturday 16 February 201312.00-12.30pm

WEB ID#: NKM4495

Kiama Downs 34 Alexander Avenue $530,000Expand your horizons......

VIEW AT: dougmalkiama.harcourts.com.au

2 1 1

Andy WhartonM: 0412 638 708E: andyw@dougmal.com.auDougmal Harcourts Kiama 4232 1322

Everything has been done so just bring your furniture or favourite tenant• Right in town - walk to everything• Light and beachy feel• Fabulous new kitchen• Ground level apartment• Single lock up garage

OPEN HOME: By appointmentWEB ID#: NKM4428

Kiama 30/59 Collins Street $300,000Fresh from a complete make-over

VIEW AT: dougmalkiama.harcourts.com.au 5 2 2

Susan SpenceM: 0412 271 091E: susans@dougmal.com.auDougmal Harcourts Kiama 4232 1322

Located in an established area with easy access to shops and transport this generous home has a renewed bathroom and kitchen but still offers opportunity to refresh with your own style.• 5 substantial bedrooms• Two living areas• Inground swimming pool

OPEN HOME: By AppointmentWEB ID#: NKM3799

Kiama Downs 49 Hoskings Crescent Offers above $560,000Family Friendly

VIEW AT: dougmalkiama.harcourts.com.au

Dougmal Harcourts Dapto4261 3211dougmaldapto.harcourts.com.au

OPEN

HOUSE

• 3 great sized bedrooms, all with new carpet, mirrored BIWs and main with a/c• Open plan living, dining and kitchen area with floating floors and air conditioning• Brand new modern kitchen with electric cooktop, wall oven and boasting a great

amount of cupboard space and storage• Brand new two way bathroom with bath, shower and combined toilet• Single detached garage with remote controlled door

OPEN HOME: Saturday 16 February10.40am - 11.00am36 Parkside Drive, Dapto

WEB ID#: NDP5379

3 1 1

Ben JamesM: 0422 244 098E: ben@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Dapto 36 Parkside Drive $335,000Premium Renovation Complete, the Ultimate Buyer Wanted

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

• Three great sized bedrooms, 2 with built in robes and all carpeted• Lovely timber kitchen with wall oven, gas cooktop, heaps of cupboard space• L shaped living area with reverse cycle air conditioning and access to the dining• Separate rumpus room at the back - a huge tiled space • Tandem double garage with automatic door • Neat yard front and back with great entertaining space at the rear

OPEN HOME: Saturday 16 February10.00am - 10.20am18 Craig Crescent, Dapto

WEB ID#: NDP5375

3 1 2

Mitchell James M: 0413 097 710E: mitchell@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Dapto 18 Craig Crescent $360,000A Great Family Home

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

• 3 great sized bedrooms, all carpeted with built in robes, main has a walk in robe and ensuite• Modern timber kitchen with marble benchtops, dishwasher, wall oven and long breakfast bar• Nice living area complete with air conditioning and separate formal dining room which could be

utilised as a study or extra bedroom if needed • Single garage with third shower, toilet and vanity - brilliant if you´ve been working in the yard

and want to tidy up before coming inside• The backyard boasts an ideal entertaining pergola and shed, plus leaves plenty of yard space

OPEN HOME: Saturday 16 February10.00am - 10.20am9B Gilba Road, Koonawarra

WEB ID#: NDP5383

3 3 1

Ben JamesM: 0422 244 098E: ben@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Koonawarra 9B Gilba Road $339,000Feature Fantastic

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

• Three bedrooms with polished timber floors, ceilings fans and 2 with built in robes• Fantastic modern kitchen boasting a large stainless steel 5 burner gas stove,

perfect for the chef of the home, as well as dishwasher and a large pantry• Meals area off the kitchen to the formal dining room with parquetry floors, the

living room with air conditioner to the family room • Fully fenced yard, great covered back deck plus detached games room

OPEN HOME: Saturday 16 February11.20am - 11.40am8 Prince Edward Dr, Dapto

WEB ID#: NDP5395

3 2 1

Mitchell James M: 0413 097 710E: mitchell@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Dapto 8 Prince Edward Drive $329,000Here’s a Gem and so Close to Town!

VIEW AT: dougmaldapto.harcourts.com.au

Dougmal Harcourts Dapto4261 3211dougmaldapto.harcourts.com.au

OPEN

HOUSE

• 3 bedrooms, main with his and hers WIR, all are carpeted and have room to move• Open plan design with timber floating floors flowing from the modern kitchen

through to the rear yard, complete with air conditioning• Modern kitchen with dishwasher, gas cooktop, wall oven, large pantry plus lovely

breakfast bench opening onto the open living• Fully fenced, near level yard with fantastic deck - the ideal entertaining space

OPEN HOME: Saturday 16 February1.20pm - 1.40pm62 Robins Creek Dr, Horsley

WEB ID#: NDP5385

3 1 1

Mitchell James M: 0413 097 710E: mitchell@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Horsley 62 Robins Creek Drive $359,000A Sight for Sore Eyes

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

• 4 bedrooms, main with ensuite and all with BIW, downstairs study or 5th bedroom• Modern timber kitchen featuring s/s appliances and gas cooktop and dishwasher• Formal lounge and dining area which can be shut off from the rest of the house• Family room off kitchen with access to back paved undercover entertaining area• Granny Flat featuring kitchenette, own bathroom, great sized living area and huge

bedroom with air conditioning plus its own private side access

OPEN HOME: Saturday 16 February1.20pm - 1.40pm12 Glengarry Way, Horsley

WEB ID#: NDP5373

6 3 2

Ben JamesM: 0422 244 098E: ben@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Horsley 12 Glengarry Way $550,000Executive Style Family Home

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

4 1 2

Mitchell James M: 0413 097 710E: mitchell@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

• 4 bedrooms, all carpeted, modern 3 way bathroom, separate bath to shower• Front tiled living room plus open plan living, dining and kitchen area, a great

space for the family to spend time together • Modern kitchen with dishwasher, walk in pantry and breakfast bar• Enclosed entertaining space, garden shed and side access for a boat or trailer

plus a double garage, roller shutters on most windows and ducted a/c

OPEN HOME: Saturday 16 February12.20pm - 12.40pm14 Ashburton Dr, Albion Park

WEB ID#: NDP5346

Albion Park 14 Ashburton Drive $390,000 - $410,000Great Family Home In The Best Location

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

3 1 1

Mitchell James M: 0413 097 710E: mitchell@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

• Great free-standing villa, 3 double sized bedrooms, all large with built in robes• Open plan layout with carpeted living, great functional kitchen with large pantry

and upright gas stove and combined dining area • Nice fenced yard plus room for underhouse storage and paved undercover area• Located at the back of the 4 villa complex, this villa has a single drive through

garage plus parking space

OPEN HOME: Saturday 16 February11.40am - 12.00pm4/72 Daintree Dr, Albion Park

WEB ID#: NDP5325

Albion Park 4/72 Daintree Drive $310,000Brilliant Villa, it has everything you need!

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

4 2 -

Mitchell James M: 0413 097 710E: mitchell@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

• All 4 bedrooms have timber floorboards and ceiling fans, main bedroom has a shower and toilet and 3 of the bedrooms have built in robes

• Airy kitchen with dishwasher and electric cooking facilities which overlooks the backyard and escarpment views, dining area off the kitchen and living room

• Separate living with air conditioning, combustion fireplace and balcony access• From the fourth bedroom or study, you can access the paved entertaining area

OPEN HOME: Saturday 16 February10.40am - 11.00am56 Compton St, Dapto

WEB ID#: NDP5227

Dapto 56 Compton Street $329,000Your Chance to Own a Unique Slice of Dapto

VIEW AT: dougmaldapto.harcourts.com.au

• Imagine waking to view some of the most stunning rural and escarpment views the south coast has to offer.

• Here´s an opportunity to build on this gently sloping 656m2 block that is north facing.

• Situated in a family friendly, quiet cul-de-sac and surrounded by quality homes, this property offers a great opportunity to build your dream home, then sit back and enjoy the breathtaking views.

VIEW AT: harcourts.com.au/ndp4965

Michael GarsideM: 0414 490 595E: michael@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Dapto 44 Carlyle Close $165,000Carlyle Land - Premium Block, Bargin Price

• Brimming with potential, this single level three bedroom home is located on a mixed use 896sqm block and has a prime highway position.

• With high ceilings, a front enclosed porch, dining area off the kitchen and combined toilet and laundry, there is opportunity to improve the current property or knock down and take advantage of the positioning

OPEN HOME: By AppointmentVIEW AT: harcourts.com.au/ndp5293

Michael GarsideM: 0414 490 595 E: michael@harcourtsdapto.com.auDougmal Harcourts Dapto 4261 3211

Dapto 15 Princes Highway $435,000Zoned B4 Mixed Use

Dougmal Harcourts Wollongong4229 8255 dougmalwollongong.harcourts.com.au

NEW PR

ICE

4 2 1

Joanne DreiziM: 0421 283 530E: joanned@dougmal.com.auDougmal Harcourts Wollongong 4229 8255

Beautifully appointed for relaxed family living with an easy indoor/outdoor flow, this home has a generous single level floor plan & a desirable rear North aspect. Situated, just a short stroll from Port Kembla beach, schools & shops. Including distinct lounge, dining & kitchen area with an open layout, main with sleek ensuite & walk-in-robe. Stylishly appointed kitchen with quality ceasar stone bench tops & a modern main bathroom. Paved under cover entertainment area, large single lock-up garage

OPEN HOME: Saturday 16th February2-2.30pm

WEB ID#: harcourts.com.au/nwg4722

Port Kembla 10 Fifth Avenue $499,000 - $519,000A Great Home Not to be Missed

VIEW AT: dougmalwollongong.harcourts.com.au 3 1 1

Adrian D’Amico M: 0402 224 559E: adriand@dougmal.com.auDougmal Harcourts Wollongong 4229 8255

Presenting a practical dual level floor plan providing low maintenance family living, 3 bedrooms plus rumpus room down stairs. Large neat and tidy laminate kitchen with meals area overlooking a large covered balcony and well preserved rear yard offering private outdoor entertaining. Split system air conditioning unit & sparkling pool. Convenient location with close to schools, shops and transport. Single car port with driveway parking for an additional vehicle.

OPEN HOME: Saturaday 16th February 1 -1.30pm

Kanahooka 25 Thirroul Road Offers above $349,000Perfectly Located with Endless Scope for Potential!

VIEW AT: dougmalwollongong.harcourts.com.au

Well-presented 4 bedroom home, offering a parents retreat with large study nook and walk in robe & ensuite. 2 Large bedrooms with double Built in robe with mirrors & one extra large bedroom with triple built in robe with mirrors. Modern kitchen & bathroom with separate toilet, large covered entertaining area, easy care gardens and plenty of off street parking, & garden shed. Close to shops, schools & buses.

OPEN HOME: Saturday 16th February, 10 -10.30amVIEW AT: dougmalwollongong.harcourts.com.au

Greg ChadwickM: 0408 422 644E: gregc@dougmal.com.auDougmal Harcourts Wollongong 4229 8255

Unanderra 7 Stratford Road $359,000Fresh, Bright and Amazing

• Recently renovated 3 bedroom home all with built in robes• Polished Timber flooring, modern kitchen & large open plan living • Covered deck perfect for outdoor entertaining, as well as yard • Walk to Cedars Christian college, Farmborough Road Public as well

as Unanderra CBD & child friendly parks.• Land Size 720sqm, great starter or investment.

OPEN HOME: Saturday 16th February 12 -12.30pmVIEW AT: harcourts.com.au/nwg4769

Adrian D´AmicoM: 0402 224 559E: adriand@dougmal.com.auDougmal Harcourts Wollongong 4229 8255

Farmborough Heights 75 Waples Road Offers above $319,000The Price is Right

Adrian D´AmicoM: 0402 224 559E: adriand@dougmal.com.auDougmal Harcourts Wollongong 4229 8255

A not to be missed opportunity, arguably the most inexspecnsive block onthe market in this area. Someone once tiold me, real estate is exspensive today & cheap tomorrow and this is no acception! Take advantage of the New Home Owners Grant offers $15,000 to eligible buyers building their own home. In addition, you may be eligible for stamp duty concessions and rebates of up to $20,000! Copy this short Video URL into your web browser to find out more http://youtu.be/lv3sgQGTUDY

OPEN HOME: By appointmentWEB ID#: harcourts.com.au/nwg424

Keiraville Lot 1,2 & 3 Cosgrove Avenue Starting from $245,000Cosgrove Gardens - All new prices

VIEW AT: dougmalwollongong.harcourts.com.au

Dougmal Harcourts Northern Suburbs4284 8833 www.dougmalwoonona.harcourts.com.au

OPEN

3 1 2

Colin RobertsM: 0412 188 171E: colinr@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

• Fantastic, modern two storey townhouse set in quality complex.• 3 double sized bedrooms main with ensuite and all with built in robes.• Spacious open plan lounge/ dining which leads to a huge sunny private courtyard.• Modern kitchen with stainless steel appliances.• 2nd up stairs living area for the kids to play, plus spacious balcony.• Huge double garage with remote garage door and internal access.

OPEN HOME: Saturday 16/2/1311.00am-11.30am

Woonona 22/14-18 Alice Street $469,000Over sized, Modern living.

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

3 1 1

Colin RobertsM: 0412 188 171E: colinr@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

• Immaculately presented clad & tile home on 604sqm block with 20m wide block.• 3 double sized bedrooms 2 with B.I.W.• Cosy sundrenched living room with log fire.• Well appointed kitchen and separate dining area.• Great yard for the kids and dogs.• Lock up garage, room for the boat- huge potential.

OPEN HOME: Saturday 16/2/1310.00am-10.30am

Corrimal 10 Robert Street $479,00020m Frontage- cul de sac location

VIEW AT: www.dougmalwoonona.harcourts.com.au

Free standing two storey townhouse with open plan lounge/ dining and modern kitchen, three large bedrooms with built in robes, a spacious bathroom with shower and bath, two toilets, double garage, ducted air upstairs, second unit down, tank water, easy care garden and much, much more.

OPEN HOME: Saturday 16/2/13 12.00pm-12.30pmVIEW AT: www.dougmalwoonona.harcourts.com.au

Rod FinlayM: 0411 385 833E: rodf@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

Woonona 8/26 Popes Road $450,000Style, Space and Presentation

OPEN

• Move Straight in and enjoy your retirement or care free lifestyle.• Spacious living and dining room.• Separate laminate kitchen.• 2 bedrooms both with built in robes.• Single modern bathroom.• Private courtyard, single garage with remote

OPEN HOME: Saturday 16/2/13 10.00am-10.30am VIEW AT: www.dougmalwoonona.harcourts.com.au

Colin RobertsM: 0412 188 171E: colinr@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

Bellambi 8/74 Cawley Road $299,000Modern Single Level Villa

OPEN

OPEN

3 1 3

Colin RobertsM: 0412 188 171E: colinr@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

• Great property with loads of potential for development.• This home has been renovated over time.• Modern laminated kitchen/dining area.• Separate cosy living area. Modern remodelled bathroom.• Polished timber floors throughout, separate study/office area.• 3 huge garages to accommodate all the toys great if you´re a tradie.

OPEN HOME: Saturday 16/2/1312.00pm-12.30pm

Corrimal 5 Robson Road $499,0002 street frontage, well maintained home.

VIEW AT: www.dougmalwoonona.harcourts.com.au

Dougmal Harcourts Northern Suburbs4284 8833www.dougmalwoonona.harcourts.com.au

JUST

LIST

ED

• Superb presentation through this immaculate two storey townhouse.• Offers open plan living/ dining which leads to a spacious paved private sundrenched courtyard.• Modern laminate kitchen.• 2 double sized bedrooms with B.I.W, main with own balcony.• Single lockup garage and only 4 townhouses in the complex, well maintained strata and all

owners.

OPEN HOME: Saturday 16/2/131.00pm-2.00pm

2 1 1

Colin RobertsM: 0412 188 171E: colinr@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

Corrimal 2/13 Coolgardie Street $345,000Modern low Maintence living

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

This home embraces the feeling of natural light with the stunning open plan indoor and outdoor living. Gourmet kitchen with 40" Caesar stone bench tops, stainless steel appliances and island bench which over looks the open plan living/dining area. Slide back the 3 door bi-folds that leads undercover outdoor alfresco living area. Huge bathroom - freestanding bath, semi-frameless shower, double free standing vanity and tiled to the ceiling. 2 huge bedrooms, polished timber floors throughout, landscaped yard and single lock up garage. Agents interest declared.

OPEN HOME: Saturday 16/2/1312.15pm-1.00pm

2 1 1

Colin RobertsM: 0412 188 171E: colinr@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

Mount Ousley 19 Greenslopes Avenue $479,000Stunning - Ultra Modern - Alfresco Living

VIEW AT: www.dougmalwoonona.harcourts.com.au

AUCTIO

N

• Two storey brick veneer tile family home.• 3 bedrooms built in robes, plus study.• 2 separate living room.• Original kitchen and bathroom.• Single lock up garage with drive thru access.• Great level block, walk to shops, CBD.

OPEN HOME: Saturdays 11.00am-12.00pm

AUCTION: Saturday 23/02/12 On Site 12.00pm

3 1 1

Colin RobertsM: 0412 188 171E: colinr@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

Corrimal 32 Thurston Crescent AUCTION Great Home with Potential

VIEW AT: www.dougmalwoonona.harcourts.com.au

AUCTIO

N

Get ready to renovate this three bedroom clad home with a pressed tin roof formal lounge and separate dining area, eat in kitchen, modern bathroom, tandem lock up garage, terraced garden with space for the kids plus a large vegetable patch. This property is only a short distance from the Corrimal shops and represents a great opportunity for the right buyer.

OPEN HOME: Saturdays11.00am-11.30am

AUCTION: Saturday 02/03/13 11.45amOn Site

3 1 2

Rod FinlayM: 0411 385 833E: rodf@dougmal.com.auDougmal Harcourts Northern Suburbs 4284 8833

Corrimal 55 Underwood Street AUCTIONA Great Opportunity

VIEW AT: www.dougmalwoonona.harcourts.com.au

Dougmal Harcourts Albion Park4256 3122dougmalalbionpark.harcourts.com.au

NEW

Extraordinary property offering a rare lifestyle of peace & quiet perfectly tucked away in the exciting Tullimbar Village. Oozing with quality this property consists of 3 double sized B/R´s + open study, master has WIR & ensuite. Two sep living quarters + formal dining, must see kitchen & two well appointed bathrooms throughout. Outdoors entertain all year round with covered pergola area overlooking sparkling I/G pool, complete with over sized double garage on remote control + reserve at rear.

OPEN HOME: Saturday 16th February 11.00 - 11.30 am

AUCTION: Saturday 2nd March 11.00 am Onsite

3+ 3 2

Daniel McConnellM: 0405 454 624E: danielm@dougmal.com.auDougmal Harcourts Albion Park 4256 3122

Tullimbar 34 Broughton Avenue AuctionMaking A Splash!!

VIEW AT: www.dougmalalbionpark.harcourts.com.au

AUCTIO

N

Truly one of a kind acreage perfectly nestled on must see 14.7 (approx) acre lot in the ever prestigious Cedar Ridge "Yellow Rock". Tidy renovated brick & tile homestead with family features throughout. Fully serviced land including aboveground power, several reliable water sources & brand new tarred road. Stunning gardens surprisingly low maintenance. Picture perfect & bristling with wildlife this tranquil acreage could very well be the Illawarra´s best kept secret. Outstanding Value!

OPEN HOME: Saturday 16th February 12.00 - 12.30 pm

AUCTION: Saturday 2nd March 12.30 pm Onsite

3 3 4

Daniel McConnellM: 0405 454 624E: danielm@dougmal.com.auDougmal Harcourts Albion Park 4256 3122

Yellow Rock 513 Yellow Rock Road AuctionDare To Compare... Tranquil Acreage!!

VIEW AT: www.dougmalalbionpark.harcourts.com.au

NEW

1 1 1

Daniel McConnellM: 0405 454 624E: danielm@dougmal.com.auDougmal Harcourts Albion Park 4256 3122

Must see "free standing" villa in extremely handy location, hands on to Albion Park C.B.D. Size will certainly surprise with large open flowing floor plan including formal lounge & dining area, spacious bedroom with built-in robe, tidy well appointed kitchen & bathroom + oversized lock-up garage with internal access. Outdoors enjoy low maintenance courtyard with landscaped gardens & off street parking. All set in lovely complex yet tucked away completely free standing with its very own drive way. Hurry!

Albion Park $259,900One Bedroom Wonder!!

VIEW AT: www.dougmalalbionpark.harcourts.com.au 4 2 2

Daniel McConnellM: 0405 454 624E: danielm@dougmal.com.auDougmal Harcourts Albion Park 4256 3122

Remember when kids could play on the street, the blocks were big & the homes were solid... well they’re back!! Stunning family home in quiet cul-de-sac on spacious 724 m2 (approx) level block. Feat 4 B/R’s all with BIW’s, master boasts WIR & ensuite. Formal lounge, formal dining, tiled family & meals area, sep rumpus, large well appointed kitchen & 3-way bathroom. Complete with large lock-up double garage + O/S parking, alfresco dining/ent area & loads of grassed yard fully fenced.

Albion Park $459,900Big Backyards Are Back!!

VIEW AT: www.dougmalalbionpark.harcourts.com.au

NEW

4 2 2

Daniel McConnellM: 0405 454 624E: danielm@dougmal.com.auDougmal Harcourts Albion Park 4256 3122

Brand new to the market & not to be missed, quality family home tucked away in quiet loop circuit all within short stroll to Albion Park C.B.D. 4 bedrooms, master with ensuite & WIR, air con formal lounge & formal dining, sep lovely light filled family room, large "modern" well appointed kitchen & bathroom + double garage. Outdoors entertain with huge covered high pitched pergola as kids play endlessly around the in-ground pool & tidy grassed yard... Enjoy stress free living at its best!

OPEN HOME: Saturday 16th February 10.00 - 10.30 am

Albion Park 39 Charlotte Crescent $459,900Family Frenzy!!

VIEW AT: www.dougmalalbionpark.harcourts.com.au

Spectacular "Torrens Titled" duplex only 12 months young all while perfectly tucked away in quiet cul-de-sac capturing jaw dropping views. Impressive even to the most fastidious of buyers. Not your average duplex, 3 large B/R’s + study , must see air con open plan living, huge covered balcony, 2 quality bathrooms, deluxe polyurethane kitchen & double garage with internal access. Outdoors enjoy this luxurious duplex with tidy level grassed yard, 2 sep entertainment areas & views forever. Best of the best, size, quality & condition!!VIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: danielm@dougmal.com.auDougmal Harcourts Albion Park 4256 3122

Albion Park $469,900A Stand Out In Today’s Market!!

Quality family home perfectly located tucked away in quiet side street, featuring 3 bedrooms, BIW´s, formal lounge, meals area + huge separate rumpus room opening out onto big open rear decking. Finished with tastefully revamped kitchen & bathroom + oversized single lockup carport. Outdoors enjoy enclosed courtyard + rear timber decking overlooking level grassed yard. A solid investment opportunity with quality tenants in current lease till 2/7/2013, paying $370 p/w. Investors hurry or 1st home buyers simply buy now & move in later!VIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: danielm@dougmal.com.auDougmal Harcourts Albion Park

Albion Park Rail $349,900Great Investment Opportunity!!

PRIC

E

REDUCT

ION

Huxley & Partnersr e a l e s t a t e

The Green Team

Ph. (02) 4286 5555 112A Railway Street, Corrimal View all these properties online at www.huxleyrealestate.com.au

Mangerton $265,000 13/1 Mangerton Road • Top fl oor two bedroom spacious unit, modern interior• Internal laundry,wrap around balcony,security building• Close to hospital, shops and transportTony Sloane 0409 299 407

2 1 1

OPEN SAT 11:30-12:30

Corrimal $219,0003/27 Underwood Street• Two bedroom carpeted unit in convenient location• Currently tenanted, great investment opportunity• Short walk through to shops, transport and parks Charles Hegyi 0408 423 051

2 1 1

Keiraville $579,000 258 Gipps Road • Great potential - brick & tiled home w separate garage• Level block with two street frontages• Close to Botanical gardens,shops, University & free busTony Sloane 0409 299 407

4 1 2

Austinmer“Sandyfeet” 12 Boyce Avenue• Only a few steps from both Austinmer beaches• Impressive designed quality family home backing onto and overlooking the exclusive Glastonbury GardensCharles Hegyi 0408 423 051

$1,300,000

• Landscaped gardens, jetty style boardwalk to a large spa • Three living areas with two found downstairs• Appropriately named you’ll be close to one of the most picturesque beaches on the east coast.

5 3 2

OPEN SAT 12:00-1:00

Corrimal $370,0003/52 Thalassa Avenue• Great location to beach, shops, schools & station• Comfort and low maintenance towhouse • BIWS, balcony to main, courtyard and single garageCharles Hegyi 0408 423 051

3 11.5

Balgownie3/38 Balmoral Street• Very sought after, well presented three bedroom villa • Features dishwasher, gas cooktop, granite benchtops • Ensuite to main bedroom, BIW’s to all bedroomsTony Quin 0414 428 401

• Private courtyard, double garage with internal access • Situated in small complex of just three villas• This is your opportunity to enjoy the Balgownie lifestyle

3 2 2

$449,000

OPEN SAT 10:00-11:00

Corrimal $289,000 4/16-20 Jones Place • Beautiful totally refurbished large two bedroom unit• Private rear balcony, security foyer, small complex• Quiet block, well off the street, close to local CBDTony Quin 0414 428 401

2 1 1

OPEN SAT 11:00-12:00

Corrimal $345,0006/16-20 Jones Place • Big three bedroom villa style unit in quiet complex• Beautiful new kitchen & bathroom, spacious living• Own carport and ample visitor parking is availableTony Quin 0414 428 401

3 1 1

OPEN SAT 11:00-12:00

Wollongong44 Matthews Street• Renovators dream, authentic older style home • Big 917sqm land parcel with wide 20m frontage • Timber fl oors, renovated kitchen, separate garageTony Quin 0414 428 401

• Development potential subject to W.C.C approval• Situated in great location close to Hospital, Schools, Shops, Restaurants & Public Transport

3 1 1

$550,000

NEW

Towradgi17/42 Carters Lane• Tranquil garden complex only minutes to the beach• Modern open living design opening onto private c/y• Beautiful kitchen with loads of bench space Charles Hegyi 0408 423 051

$379,000

• Three large bedrooms with BIW, balcony to main• Internal laundry with downstairs WC• Located so close to shops, parks & free transport to CBD

3 1 1

OPEN SAT 10:30-11:15

Coniston $289,000 3/40 Bridge Street • Fully renovated large two b/r unit, open plan living• Nothing to spend, internal laundry, timber fl oors• City & ocean views, small complex, close to CBDTony Sloane 0409 299 407

2 1 1

Woonona4 Thomas Hale Avenue• Location, location.. only 420 metres to the surf• Double storey home on beautiful level 600sqm block• Solar energy supply, stunning kitchen, outdoor living Charles Hegyi 0408 423 051

$755,000

• With three living areas, a large back yard and four good sized bedrooms there is room for the whole family!• Easy walk to shops, train station & local school

4 2 2

Keiraville P.O.A4 Cedar Grove • Big and bold brick home with open plan living areas• Ducted A/C, separate formal dining, rumpus room• Expansive decks overlooking city, ocean & escarpmentTony Sloane 0409 299 407

4 3 2

Corrimal $278,0004/267 Princes Highway• Security modern apartment building with views• BIWS, modern kitchen and bathroom, balcony • Central to Corrimal CBD,walk to shops,station, schoolsCharles Hegyi 0408 423 051

2 11Fairy Meadow $215,000214-220 Princes Highway • One bedroom unit with granite kitchen & dishwasher• Internal laundry with washing machine & dryer• Popular complex, great rental returns, invest today!Tony Quin 0414 428 401

1 1 1

• Sand, surf and rock pool of popular Austinmer beach is literally footsteps away from your front door• Large family home with great entertaining areas and scenic views• Suitable for two families, or live on one level and rent the other as holiday letting accommodation • Close to school, transport, cafes, restaurants and Thirroul shopping centre

• If architectural elegance, space & coastal views are important to you then look no further• Near new, low maintenance 3 storey residence in need of new proud owner• Approximately 500m2 residence area with garaging for 6 cars and home office• Metres from prestigious Austinmer & Thirroul beaches and local village life

Come and view this large family home in the popular Sandon Point estate. A unique design allows for single level living, if desired, with additional levels for guests or extended family.• 4-5 bedrooms, huge rumpus room on separate level• Upstairs 2nd living room or supersized mezzanine style 4th bedroom with balcony overlooking the

ocean• Swimming pool in the rear private garden and outdoor entertaining/BBQ area

AGENT:

• Charming family home on a massive 823sqm level parcel of land

• Two separate garages offering four car accommodation• Convenient location with walk to shops, train station,

schools and restaurants• Potential for dual occupancy (STCA)

• Uniquely charming holiday home in a private rainforest setting. Very private viewing deck with sweeping ocean and escarpment views

• Separate guest accommodation and artist studio downstairs. Potential to generate holiday rental income. Lock up garage and carport, access through private rear lane

• This property would make a great weekender or a holiday letting, with potential to generate rental income when not used. Wombarra provides a perfect lifestyle, with the beach and tidal rock pool

AGENT:

• Birdlife and wildlife literally at your doorstep at this funky red cedar home

• Beautiful and tranquil setting, yet walk to train station and 2 minutes drive to local beaches

• Character family cottage or a holiday home to escape the busy city life

AGENT:

Perched high and spanning two spacious levels, this solid double brick home has potential to accommodate two families comfortably. Easily split into 2 separate houses with great rental income potential. Awesome views!

AGENT:

This lovely villa will appeal to a range of buyers, due to its convenient location and affordability.• Bedrooms with BIW’s, modern kitchen and spacious

living area, single garage with storage and internal access.

• Great investment with a rental income of $320 pw

AGENT:

• Uniquely charming holiday home in a rainforest setting• Very private viewing deck with beautiful rainforest views • 765sqm parcel of land backing onto Wombarra Sculpture

Gardens• Potential to generate holiday rental income

AGENT:

This vacant block of land is located in a popular family street with easy walk to Thirroul´s shops, restaurants, cafes and transport.Additional bonus - DA approved for a family home. Use it as is, modify it, or design your own dream home.Area: 501 sqm

AGENT:

• Two beautiful blocks of land side by side, approx 500sqm each

• Beautiful sandstone features and many established botanical specimens to be retained

• Concept plans and models of homes to complement the sites available, all services connected

AGENT:

Superbly located vacant block of land with plans approved for dual occupancy. Overlooking McCauley Beach and Sandon Point and backing onto a reserve, with easy walk to McCauley Beach and Thirroul village. All amenities, such as shops, restaurants and train station with express train to Sydney are within minutes of level walk. Area: 761m2.

Thursday 14 to Wednesday 20 February

Albion Park 2527 10:00-11:00 Sat 110 Terry St Peter Taranto 4228 1622 From $339,500 V10:00-10:30 Sat 39 Charlotte Cres Doug.Harcourts 0405 454 624 $459,900 H10:00-10:30 Sat 5 Centenary Rd Right Choice +61402084026 $339,000 H10:15-11:00 Sat 15 Tomlin St LJ Hooker 0402 121 870 $499,000 H11:40-12:00 Sat 4/72 Daintree Dr Doug.Harcourts 0414 490 595 $310,000 V12:00-12:30 Sat 3 Scenic Cres Ray White 4271 4000 $345,000 H12:20-12:40 Sat 14 Ashburton Dr Doug.Harcourts 0413 097 710 $390,000 - $410,000 H

Albion Park Rail 2527 10:00-10:30 Sat 44 Ash Ave McPhail 0410 868 632 $335,000 H1:30-2:00 Sat 50 Maple St Bevans 4226 6222 O/A$309,000 H4:45-5:30 Thu 50 Maple St Bevans 4226 6222 O/A$309,000 H

Ausitnmer 2515 10:00-10:30 Sat 74 Mountain Rd Raine & Horne 0438684014 Auction H3:00-3:30 Sat 74 Mountain Rd Raine & Horne 0438684014 Auction H10:30-11:00 Sat 1/2a Headland Ave Urban 0409 368 247 $690,000 TWN11:00-11:30 Sat 38B Lawrence Hargrave Dr Urban 4267 3311 $879,000 H11:15-11:45 Sat 11 Kirton Rd Bevans 0417 330 229 O/A $799,000 H11:30-12:30 Sat 2 Kennedy Rd Ray White 0433 175 681 Auction H12:00-1:00 Sat 12 Boyce Ave Huxley 0408 423 051 $1,300,000 H1:00-1:30 Sat 6 Asquith St Bevans 0409 969 032 Auction H2:30-3:00 Sat 3/43 Mountain Rd Raine & Horne 0438684014 $499,000 V

Balarang 2529 9:45-10:30 Sat 10 Kana Pl McPhail 0410 868 632 O/A $460,000 H

Balgownie 2519 10:00-11:00 Sat 3/38 Balmoral St Huxley 0414 428 401 $449,000 V10:00-10:30 Sat 1 Elsie Ct MMJ 0416283876 $499,000 H10:45-11:30 Sat 10b Terrell Pl MMJ North 0407 293 466 379,500 TWN11:00-11:30 Sat 11 Church St Peter Taranto 0417 124 313 $309,000 H12:15-1:00 Sat 20 Wellington Dr MMJ North 0412 425 801 $749,950 H1:30-2:00 Sat 6/43 Chalmers St Scholtens 0418 689 609 $455,000 TWN

Bellambi 2518 10:00-10:30 Sat 8/74 Cawley St Doug.Harcourts 0412 188 171 $299,000 V11:00-11:30 Sat 10/74 Cawley St Wiseberry 0414 539 699 $305,000 D12:00-12:30 Sat 28 Lorking St Bevans 4226 6222 O/A$435,000 H12:30-1:00 Sat 4/102 Cawley St Clayton R/E 0421 304 248 $259,000 U

Berkeley 2506 10:30-11:00 Sat 1B York St Professionals 0411 315 450 $699,000 H11:15-11:45 Sat 332 Flagstaff Rd Park Trent 4229 1655 $399,000 H11:45-12:15 Sat 86 Nottingham St Domain First Na 0412 717 444 $299,000 H12:00-12:45 Sat 76 Essex St Right Choice +61402084026 $299,000 V12:00-12:45 Sun 76 Essex St Right Choice +61402084026 $299,000 V1.00-1.30 Sat 22 Holborn St LJ Hooker 0411 713 523 Auction H

Blackbutt 2529 10:00-10:30 Sat 1-24/1001 Albatross Dr Bevans 0412 424 226 From $399,000 U10:00-10:30 Sat 20 Westwood Dr MMJ 0412 426 495 $369,000 H11:00-11:30 Sat 89 Chillawong Cct McPhail 0410 868 632 $390,000 H

Brownsville 2530 12:30-1:00 Sat 33 Windsor Cres LJ Hooker 0402 844 636 $950,000 - $980,000 H

Bulli 2516 10:00-10:30 Sat 74 Hospital Rd Bevans 0404 003 882 O/A$630,000 H11:00-11:30 Sat 14 Cope Pl MMJ North 0412 424 071 O/A$560,000 H1:00-1:30 Sat 4 Hospital Rd One Agency 4226 5100 Auction H2:30-3:00 Sat 3 Francis St Ray White 4271 4000 Auction H5:30-6:30 Thu 74 Hospital Rd Bevans 0404 003 882 O/A$630,000 H

Clifton 2515 11:30-12:00 Sat 346 Lawrence Hargrave Dr Urban 4267 3311 $680,000 H

Coniston 2500 11:30-12:15 Sat 3/15 Myrtle St Clayton R/E 4226 1074 $295,000 U

Cordeaux Heights 2526 10:00-10:30 Sat 31 Kooranga Cres Ray White 4271 4000 $489,000 H11:00-11:30 Sat 73 Derribong Dr Ray White 4271 4000 $430,000 - $465,000 H11:00-11:40 Sat 19 Serrata Pl Southern Estate 0416 089 884 $424,000 H11:00-11:45 Sat 198-200 Derribong Dr MMJ North 0412 421 214 $750,000 - $790,000 H11:00-11:30 Sat 6 Ilkoara Gr One Agency 4226 5100 O/A$550,000 H1:00-1:30 Sat 41 Coachwood Dr Ray White 4271 4000 $390,000-$420,000 H

Corrimal 2518 10:00-10:30 Sat 10 Robert St Doug.Harcourts 0412 188 171 $479,000 H10:00-10:30 Sat 19/36 Park Rd Bevans 4226 6222 O/A$319,000 TWN11:00-11:30 Sat 55 Underwood St Doug.Harcourts 0411 385 833 Auction H11:00-12:00 Sat 32 Thurston Cres Doug.Harcourts 0412 188 171 Auction H11:00-11:30 Sat 5 Mountbatten St MMJ North 0412 626 964 $400,000 H11:00-12:00 Sat 6/20 Jones Pl Huxley 0414 428 401 $349,000 U11:00-12:00 Sat 4/20 Jones Pl Huxley 0414 428 401 $289,000 U11:00-11:45 Sat 3/14-16 Chester St Bevans 0410 426 320 O/A$429,000 TWN12:00-12:30 Sat 3/15 Underwood St MMJ North 0412 424 071 $320,000 - $360,000 TWN12:00-1:45 Sat 1/273 Rothery St MMJ North 0412 421 214 $480,000 - $500,000 TWN12:00-12:30 Sat 5 Robson St Doug.Harcourts 0412 188 171 $499,000 H12:30-1:00 Sat 6/47 Park Rd Bevans 0402 083 446 O/A$239,000 U1:00-1:30 Sat 15/3 Mountbatten St Bevans 0401 675 077 $530,000 - $560,000 V1:00-2:00 Sat 2/13 Coolgardie St Doug.Harcourts 0412 188 171 $345,000 TWN1:15-2:00 Sat 90 Wilga St MMJ North 0412 425 801 $469,950 H

Cringila 2502 11:00-11:30 Sat 6 Cringila St LJ Hooker 0411 713 523 $259,000 H

Dapto 2530 10:00-10:30 Sat 2 Shiraz Dr MMJ 0416283876 $419,000 H10:00-10:30 Sat 25 Bright Pde MMJ 0400 002 255 $399,900 H10:00-10:30 Sat 1/65-67 Mount Brown Rd Ray White 4271 4000 $360,000 - $410,000 V10:00-10:30 Sat 88 Parkside Dr PRDnationwide 4261 0333 $310,000 - $340,000 H10:00-10:20 Sat 18 Craig Cres Doug.Harcourts 0413 097 710 $360,000 H10:45-11:15 Sat 100 Laver Rd LJ Hooker 0405 373 916 $309,000 H10:40-11:00 Sat 36 Parkside Dr Doug.Harcourts 0422 244 098 $335,000 H10:40-11:00 Sat 56 Compton St Doug.Harcourts 0414 490 595 $329,000 H11:00-11:30 Sat 16A Carlyle Cl Domain First Na 0412 717 444 $469,000 H11:00-11:30 Sat 2 Kundle St MMJ 0400 002 255 $309,900 H11:00-11:30 Sat 47 Craig Cres MMJ 0418 333 149 $325,000 H11:00-11:30 Sat 21 Brown Ave MMJ 0409 612 000 $369,900 H11:00-11:30 Sat 2/77a Marshall St Bevans 0412 424 226 O/A$289,000 V11:20-11:40 Sat 8 Prince Edward Dr Doug.Harcourts 0414 490 595 $329,000 H12:00-12:45 Sat 52 North Tce O’Connor 0416 266 055 $469,000 H12:00-12:30 Sat 3 Carlyle Cl MMJ 0400 002 255 $609,900 H12:00-12:30 Sat 32 Cormack Ave LJ Hooker 0468 944 961 $380,000 - $400,000 H1:00-1:30 Sat 125 Burke Rd LJ Hooker 0468 944 961 $350,000 - $370,000 H1:00-1:30 Sat 1/65-67 Mount Brown Rd Ray White 4271 4000 $360,000 - $410,000 V1:00-1:30 Sat 30 Burrell Cres MMJ 0409 612 000 $349,900 H2:00-2:30 Sat Unit 2/21 Kent Rd MMJ 0409 612 000 $249,900 U2:30-3:00 Sat 55 Compton St Ray White 0422 050 392 $299,000-$319,000 H9:30-10:00 Sat 6 Anthea Pl Professionals 0411 315 450 $339,000 H

East Corrimal 2518 12:00-12:45 Sat 9 Dobbie Ave Ray White 0403 305 315 $1,275,000 H1:00-1:30 Sat 2 Thalassa Ave Bevans 0402 083 446 Auction H

Fairy Meadow 2519 12:00-12:40 Sat 21/192-198 Princes Hwy Southern Estate 0416 089 884 $279,990 U12:00-12:30 Sat 70 Ellengowan Cres Ray White 4271 4000 Auction H9:30-10:00 Sat 114 Hopewood Cres O’Connor 0416 266 055 Auction H

Farmborough Heights 2526 11:00-11:30 Sat 2 Stanley Ave O’Connor 0416 266 055 $399,000 H12:00-12:30 Sat 75 Waples Rd Doug.Harcourts 4229 8255 O/A $319,000 H12:30-1:00 Sat 50 Loch Carron Ave Domain First Na 0412 717 444 $355,000 H2:15-2:45 Sat 22 Aminya Pl Ray White 4271 4000 $380,000 H

Figtree 2525 11:00-11:45 Sat 36 Springfield Ave Resi King 0429 423 810 $550,000 H11:00-11:45 Sat 48 Risley Rd MMJ North 0412 425 801 $335,000 - $355,000H

12:00-12:30 Sat 102 Bellevue Rd MMJ 0416283876 O/A $399,000 H

12:15-1:00 Sat 1/52 Springfield Ave AM Rutty 4229 6311 $268,000 D

12:30-1:15 Sat 13 Darragh Dr Park Trent 4229 1655 $455,000 V

1:00-1:30 Sat 26 George Fuller Dr One Agency 4226 5100 649000 H

1:00-1:30 Sat 14 Amaroo Ave Ray White 4271 4000 $450,000 - $490,000H

2:30-3:00 Sat 18 Herne St Peter Taranto 0417 124 313 $495,000 H

Fees, charges and lending criteria apply. Terms and conditions available on request. Different rates apply to other loan products and fixed rate periods. These rates are current as at 11 February 2013 and are available to new and existing customers who meet RAMS’ eligibility criteria. RAMS will apply the fixed rate that is available at the loan settlement date or the date the fixed rate period commences, unless the customer locks a fixed rate in on the loan using our rate lock feature. The rate lock fee is 0.15% of the fixed loan amount. Existing applicants who have locked in rates prior to 11 February 2013 will receive the rate at which they locked in. At the end of the fixed rate period, the interest rate will convert to the variable interest rate applicable on the day. For new customers on the Fixed Rate Home Loan, this will be the Standard Variable Rate. *This comparison rate is based on a $150,000 RAMS Fixed Rate Home Loan over a term of 25 years. WARNING: This comparison rate is true only for the examples given and may not include all fees and charges. Different terms, fees or other loan amounts might result in a different comparison rate. RAMS Home Loans Wollongong is owned and operated by Wollongong Financial Services Pty Ltd ABN 82 108 210 804. Credit provider: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714

Busy? No problem we’ll come to you. So call RAMS today! Call 13 RAMS or jump online.RAMS Home Loans Wollongong: Wollongong – 4229 5455 Dapto – 4261 3200RAMS.com.au

6.49% p.a.Comparison Rate*

4.99% p.a.RAMS Fixed Rate Home Loan – 1 year rate

RAMS can fix your rate!

Thursday 14 to Wednesday 20 February

Flinders 2529 11:00-11:30 Sat 59 Tuggerah Cct Right Choice +61402084026 $369,950 TWN11:30-12:30 Sat 7 Fischer Rd LJ Hooker 0404 497 521 $659,000 H1:00-1:30 Sat 33 Byron Cct LJ Hooker 0405 373 916 $579,999 H1:30-2:00 Sat 6 Mummuga Cl Right Choice +61402084026 $469,000 H

Gerringong 2534 2:00-2:45 Sat 177 Toolijooa Rd Ray White 0407 126 077 Auction H

Gwynneville 2500 11:00-11:30 Sat 2 Paulsgrove St Ray White 4271 4000 Auction H12:30-1:00 Sat 4/16a Berkeley Rd Ray White 0422 050 392 $279,000 U1:30-2:00 Sat 135 Gipps Rd Professionals 0411 315 450 $549,000 H1:45-2:15 Sat 35 Eastern St Peter Taranto 0417 124 313 $595,000 H11:00-11:30 Sun 2 Paulsgrove St Ray White 4271 4000 Auction H

Haywards Bay 2530 11:00-11:30 Sat 19 Riverside Cres PRDnationwide 0408 424 474 $595,000 H

Helensburgh 2508 10:00-10:30 Sat 28 Halls Rd Bevans 4294 3699 O/A $640,000 H

Horsley 2530 10:00-10:30 Sat 19 Bovard Ct Bevans 0402 083 446 O/A$449,000 H10:30-11:30 Sat 13 Ashwood Pl Scholtens 0418 689 609 $479,000 H10:45-11:15 Sat 28 Highland Park Dr Bevans 0413 148 509 O/A$339,000 H11:00-11:30 Sat 14 Riverpark Way PRDnationwide 0418 244 601 $435,000 - $465,000 H11:40-12:10 Sat 38 Ritchie Cres PRDnationwide 4261 0333 $390,000 - $410,000 H12:00-12:30 Sat 6 Greenbrook Pl MMJ 0438 613 822 $335,000 H12:00-12:30 Sat 176 Bong Bong Rd MMJ 0400 002 255 $519,900 H1:00-1:30 Sat 19 Kerang Ct MMJ 0400 002 255 $469,900 H1:00-1:30 Sat 1/3 Barham Pl Ray White 4271 4000 $310,000 - $360,000 V1:00-1:30 Sat 10 Bovard Ct MMJ 0418 333 149 $355,000 H1:00-1:45 Sat 48 Huxley Dr MMJ 0418 333 149 $449,950 H1:20-1:40 Sat 62 Robins Creek Dr Doug.Harcourts 0414 490 595 $359,000 H1:20-1:40 Sat 12 Glengarry Way Doug.Harcourts 0414 490 595 $550,000 H5:00-5:30 Thu 38 Ritchie Cres PRDnationwide 4261 0333 $390,000 - $410,000 H

Kanahooka 2530 11:45-12:15 Sat 245 Kanahooka Rd Bevans 0412 424 226 O/A$349,000 H12:00-12:30 Sat 55 Edgeworth Ave MMJ 0400 002 255 $469,900 H1:00-1:30 Sat 25 Thirroul Rd Doug.Harcourts 4229 8255 O/A $349,000 H1:00-1:30 Sat 40 Edgeworth Ave Peter Taranto 0403 618 988 $395,000 H1:15-1:45 Sat 167 Kanahooka Rd LJ Hooker 0402 844 636 $325,000 - $340,000 H2:00-2:30 Sat 162 Edgeworth Ave MMJ 0400 002 255 $459,900 H3:00-3:30 Sat 13 William Beach Rd MMJ 0409 612 000 $359,900 H

Keiraville 2500 11:00-11:30 Sat 5/49A Robsons Rd L J Hooker 0408 422 864 $285,000 U12:00-12:30 Sat 12 Bell St Bevans 4226 6222 Auction H1:00-1:30 Sat 2 Georgina Ave Peter Taranto 0429 809 856 $569,000 H1:00-1:30 Sun 2 Georgina Ave Peter Taranto 0429 809 856 $569,000 H

Kiama 2533 11:00-11:30 Sat 1 Spring Creek Dr Bevans 0409 969 202 O/A$820,000 H11:00-11:30 Sat 11 Antrim St Ray White 4271 4000 Auction H11:00-11:30 Sat 111 Bland St Ray White 0409 461 756 Auction H11:45-12:15 Sat 166 Manning St Ray White 0407 126 077 Auction H12:00-12:30 Sat 4/115 Manning St Ray White 0414 898 237 O/A$620,000 TWN12:00-12:30 Sat 8/71 Shoalhaven St Ray White 0409 461 756 $360,000 U12:00-12:45 Sat 4 Adina Ave Ray White 0402 047 414 Auction H1:00-1:30 Sat 67 Marsden St Ray White 0414 898 237 $575,000 H2:00-2:30 Sat 27b Bland St Ray White 0414 898 237 $459,000 TWN2:00-2:30 Sat 56 Gipps St Ray White 0412 763 077 From $879,000 H2:45-3:15 Sat 84 Minnamurra St Ray White 0412 763 077 $669,000 H3:00-3:30 Sat 11 Antrim St Ray White 4271 4000 Auction H9:30-10:00 Sat 199 Long Brush Rd Ray White 0409 461 756 Auction H11:00-11:30 Sun 23 Marks St Ray White 0407 126 077 $449,000 H1:00-1:30 Sun 11 Antrim St Ray White 4271 4000 Auction H

Kiama Downs 2533 10:00-10:30 Sat 13 Flinders Ave Ray White 0409 461 756 $525,000 H11:00-11:30 Sat 38 Newing Cct Ray White 0409 461 756 $629,000 H11:00-11:30 Sat 38 Eureka Ave Doug.Harcourts 0412 271 091 $1,150,000 H11:30-12:15 Sat 6 Bass St State-Wide 0412 670 004 O/A 520000 H11:45-12:15 Sat 71 McBrien Dr Ray White 0412 763 077 $449,000 H12:00-12:30 Sat 34 Alexander Ave Doug.Harcourts 0412 271 091 $530,000 H1:00-1:30 Sat 12 Meehan Dr Ray White 0402 047 414 $485,000 H

Kiama Heights 2533 11:00-11:30 Sat 90 Attunga Ave Ray White 0409 461 756 $689,000 H12:00-12:30 Sat 102 Attunga Ave Ray White 0409 461 756 $499,000 H1:00-1:30 Sat 50 South Kiama Dr Ray White 0409 461 756 $535,000 H1:00-1:30 Sun 50 South Kiama Dr Ray White 0409 461 756 $535,000 H

Koonawarra 2530 10:00-10:30 Sat 8 Balarang Pl PRDnationwide 0418 244 601 $300,000 - $320,000 H10:00-10:30 Sat 31 Eleebana Cres LJ Hooker 0405 373 916 Red $339,000 H10:00-10:20 Sat 9B Gilba Rd Doug.Harcourts 0422 244 098 $339,000 H10:00-10:30 Sat 11 Bundella Pl LJ Hooker 0402 844 636 $320,000 H10:45-11:15 Sat 9 Kurrawa Cres PRDnationwide 4261 0333 $315,000 - $330,000 H

Lake Heights 2502 10:15-10:45 Sat 262 Northcliffe Dr Park Trent 4229 1655 O/A$399,000 H2:00-2:30 Sat 37 Northcliffe Dr ARRE 0499 989 998 $425,000 H12:00-12:30 Fri 71 Lake Heights Rd Professionals 0411 315 450 $299,000 H2.00-2.30 Sat 278 Northcliffe Dr LJ Hooker 0411 713 523 H

Lake Illawarra 2528 10:00-10:30 Sat 1/52 Peterborough Ave Right Choice +61402084026 $269,000 TWN12:00-12:30 Sat 99 Reddall Pde Ray White 4271 4000 $349,000 H1:45-2:15 Sat 15 Kotari Pde MMJ 0408 944 434 O/A$269,900 H

Mangerton 2500 10:00-10:30 Sat 8/16 Woodlawn Ave One Agency 4226 5100 $275,000 U11:30-12:30 Sat 13/1 Mangerton Rd Huxley 0409 299 407 $265,000 U11:30-12:00 Sat 3 Phillips Cres Professionals 0411 315 450 $469,000 H11:45-12:15 Sat 12 Walter St Ray White 0431 821 949 Auction H12:30-1:00 Sat 10a McArthur Pde Professionals 0411 315 450 Contact Agent H1:30-2:00 Sat 79 St John’s Ave L J Hooker 0408 422 864 $499,900 H2:00-2:30 Sat 42 McAndrew Cres Peter Taranto 0429 809 856 $629,000 H2:00-2:30 Sun 42 McAndrew Cres Peter Taranto 0429 809 856 $629,000 H

Minnamurra 2533 12:00-12:30 Sat 16 Austin Ave Ray White 0409 461 756 $599,000 H

12:30-1:00 Sat 28 Charles Ave Ray White 0407 126 077 $799,000 H

1:15-1:45 Sat 11 The Vlge Ray White 0412 763 077 $595,000 H

Mount Keira 2500 10:00-10:30 Sat 129 Koloona Ave Bevans 4226 6222 O/A$549,000 H11:00-11:30 Sat 6 Parkman Pl Peter Taranto 0429 809 856 $720,000 H1:30-2:00 Sat 2 Balook St O’Connor 0414 946 000 $580,000 H11:00-11:30 Sun 6 Parkman Pl Peter Taranto 0429 809 856 $720,000 H

Mount Kembla 2526 10:00-10:30 Sat 10 Bradley Ave O’Connor 0416 266 055 $390,000 H

Mount Ousley 2519 11:45-12:15 Sat 24 Jobson Ave Bevans 0402 083 446 O/A$399,000 H12:15-1:00 Sat 19 Greenslopes Ave Doug.Harcourts 0412 188 171 $479,000 H

Mount Pleasant 2519 11:00-11:30 Sat 49 Ramah Ave Ray White 4271 4000 Auction H2:00-2:30 Sat 49 Ramah Ave Ray White 4271 4000 Auction H2:00-3:00 Sat 20 Bushland Ave One Agency 4226 5100 899000 H2:00-3:00 Sat 20 Bushland Ave One Agency 4226 5100 899000 H

Mount Saint Thomas 2500 11:00-11:30 Sat 101 The Ave One Agency 4226 5100 Auction H

11:00-11:30 Sat 53 Taronga Ave Peter Taranto 0411 754 884 $375,000 H

12:00-12:30 Sat 44 Ocean St Peter Taranto 0418 627 220 $395,000 H

2:30-3:00 Sat 107-109 The Ave L J Hooker 0408 422 864 Auction H

North Wollongong 2500 10:30-11:00 Sat 6/14A Bourke St Cooper & Cooper 0414 912 288 $295,000 U

10:30-11:15 Sat 54/7-9 Corrimal St AM Rutty 0408 424 155 $219,000 U

11:00-11:45 Sat 9/1-3 View St McPhail 0412 422 294 $1,250,000 U

Oak Flats 2529 12:00-12:30 Sat 117 The Boulevarde MMJ 0412 426 495 $732,000 H

Wollongong 2500 10:00-10:30 Sat 1/18 Rowland Ave MMJ 0400 002 255 $389,900 U

10:00-10:30 Sat 2/18 Rowland Ave MMJ 0400 002 255 $429,900 U

10:00-10:30 Sat 35/26-28 Market St Peter Taranto 4228 1622 $399,000 U

10:00-10:30 Sat 9/19 Atchison St L J Hooker 0408 422 864 $315,000 U

10:00-4:00 Sat 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U

10:00-10:30 Sat 10/12 Bank St Peter Taranto 0429 809 856 $495,000 U

11:00-11:30 Sat 2/143-149 Corrimal St Peter Taranto 0403 618 988 $489,000 U

11:00-11:30 Sat Unit 9/2 Church St MMJ 0418 423 782 $339,000 U11:00-11:45 Sat 1/15 View St AM Rutty 4229 6311 $329,900 H11:00-11:30 Sat 14/78-82 Campbell St MMJ 0408 944 434 O/A$479,900 U11:00-11:40 Sat 3/8 Gilmore St Southern Estate 0424 372 722 $443,000 TWN11:00-11:30 Sat 24/46-48 Keira St Bevans 4226 6222 O/A$295,000 U11:30-12:00 Sat 181 Church St Ray White 0422 050 392 Auction H12:00-12:30 Sat 43/59-67 Corrimal St Peter Taranto 0417 124 313 $675,000 U12:00-12:30 Sat 18/59-67 Corrimal St O’Connor 0416 266 055 $750,000 U12:00-12:20 Sat 7/18-20 Robinson St MMJ 0408 944 434 O/A$239,000 U12:00-12:45 Sat 5/6 Parkside Ave AM Rutty 0408 424 155 $250,000 U12:30-1:00 Sat 4/30 Urunga Pde McPhail 0412 422 294 $269,000 U12:30-1:00 Sat 31/59-67 Corrimal St O’Connor 0414 946 000 $669,000 U12:45-1:15 Sat 9/30 Smith St Ray White 0431 821 949 Auction U1:00-1:30 Sat 52/59-67 Corrimal St Ray White 4271 4000 $879,000 U1:00-1:45 Sat 7/53 Corrimal St AM Rutty 0408 424 155 $275,000 U1:00-1:30 Sat 6 Marr St O’Connor 0414 449 631 Auction H1:00-1:30 Sat 7/2-12 Young St O’Connor 0416 266 055 $425,000 U1:00-1:30 Sat 6/13 Sperry St Ray White 4271 4000 $180,000 - $210,000U1:15-2:00 Sat 15/10 Market Pl O’Connor 0416 266 055 Auction U1:30-2:00 Sat 418 Crown St Ray White 0422 050 392 Auction O1:30-2:00 Sat 10/290 Crown St Clayton R/E 0421 304 248 $329,000 U1:30-2:00 Sat 6/24 Market St Domain First Na 0403 521 007 Exp Of Interest U2:30-3:30 Sat 25 Atchison St Peter Taranto 4228 1622 From $350,000 U10:00-5:00 Fri 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U11:00-11:30 Fri 7/68A Smith St Cooper & Cooper 0414 912 288 $279,000 U10:00-5:00 Thu 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U11:00-11:30 Thu 2/68A Smith St Cooper & Cooper 0414 912 288 $349,000 U10:00-8:00 Wed 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Tue 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Mon 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-4:00 Sun 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U

Wollongong North 2500 10:00-11:30 Sat 14-16 Virginia St Peter Taranto 4228 1622 O/A $335,000 U

11:00-11:30 Sat 37/59-67 Corrimal St Peter Taranto 0411 754 884 $520,000 U

11:30-1:30 Sat 16-20 Keira St Peter Taranto 4228 1622 From $645,000 U

11:45-12:15 Sat 11/11-15 Church St Peter Taranto 0411 754 884 $739,000 U

12:30-1:00 Sat 7/3-5 Corrimal St Peter Taranto 0411 754 884 $1,590,000 U

1:00-1:30 Sat 1/30 Cliff Rd O’Connor 0416 266 055 Auction U

1:00-1:30 Sat 5/54-58 Cliff Rd Peter Taranto 0417 124 313 $1,395,000 U

1:30-2:30 Sat 5/32-34 Church St Peter Taranto 4228 1622 From $565,000 U

1:30-2:30 Sat 2-6 Noel St Peter Taranto 4228 1622 O/A $335,000 U

2:00-3:00 Sat 72-74 Cliff Rd Peter Taranto 4228 1622 Price Upon AppU

3:00-3:30 Sat 20/7 Edward St Peter Taranto 0429 809 856 $979,000 U

10:00-10:30 Sun 3/55-57 Church St Peter Taranto 0403 618 988 $519,000 U

3:00-3:30 Sun 20/7 Edward St Peter Taranto 0429 809 856 $979,000 U

Wollongong West 2500 11:45-12:15 Sat 16 Sheppard St O’Connor 0414 946 000 Auction H

12:30-1:00 Sat Unit 20/4 Fisher St MMJ 0408 944 434 $349,000 V

1:00-1:30 Sat Unit 28/4 Fisher St MMJ 0416283876 $339,000 V

Thursday 14 to Wednesday 20 February

Stage 2 of a 4 stage plan now selling!94 Island Point Road, St Georges Basin NSW 02 4443 6789 www.rosevalevillage.com

Stage 2 starting from $215,000HOMES AVAILABLE NOW!

Independent Lifestylefor the over 50sRosevale Home Village

BRAND NEW 2 & 3 BEDROOM HOMESAll bedrooms with built in mirrored robes, modern kitchens, lounge room, bathroom, laundry, vertical

blinds, carpets, vinyl, varandah, carport, garden shed, water tanks, fencing & much more.All you have to do is move your furniture in & connect your telephone.

Stage 3 starting from $215,000

HOMES AVAILABLE NOW!

Stage 2 of a 4 stage near completion.94 Island Point Rd, St Georges Basin NSW, Ph: 02 4443 6789“A residents right to occupy premises under the residential tenancy agreement is a leasehold right only and not a freehold or other right of unlimited or perpetural nature and may in certain circumstances be terminated”.

PETS

WELCO

ME

Port Kembla 2505 10.00-10.30 Sat 6 Keira St LJ Hooker 0411 713 523 O/A $325,000 H

10:00-10:45 Sat 54 Bland St Park Trent 0415 112 702 $339,000 H

10:30-11:30 Sat 30 Perth Rd One Agency 0415 424 257 AUCTION H

11:20-11:40 Sat 1/55 Tobruk Ave MMJ 0408 411 723 O/A$220,000 U

12:00-12:30 Sat 7 Gallipoli St Bevans 0412 424 226 O/A$799,000 H

12:00-12:30 Sat 70 Darcy Rd MMJ 0408 411 723 Auction BLK

12.00-12.30 Sat 22 Third Ave LJ Hooker 0411 713 523 Auction H

2:00-2:30 Sat 10 Fifth Ave Doug.Harcourts 0421 283 530 $499,000 - $519,000H

2:30-3:00 Sat 4/11 Surfside Dr Right Choice +61402084026 $325,000 U

9:30-10:00 Sat 20/3 Allan St Park Trent 4229 1655 $189,000 V

Primbee 2502 11:00-11:45 Sat 176 Lakeview Pde Park Trent 0415 112 702 O/A$430,000 H

Shell Cove 2529 10:00-10:30 Sat 10 Makaha Way Ray White 4271 4000 Auction H

11:00-11:30 Sat 5 Edgecombe Ct Bevans 0412 424 226 O/A$689,000 H

11:00-11:30 Sat 12 Bribie Ave Bevans 0412 424 226 O/A$629,000 H

11:00-11:30 Sat 10 Gabo Cres MMJ 0412 426 495 $509,000 H

12:00-12:30 Sat 5a Solander Ave Right Choice +61402084026 $459,000 H

1:00-1:30 Sat 13 Monkhouse Pde Right Choice +61402084026 $479,000 H

2:00-2:30 Sat 10 Makaha Way Ray White 4271 4000 Auction H

12:00-12:30 Sun 10 Makaha Way Ray White 4271 4000 Auction H

Shellharbour 2529 12:15-12:45 Sat 1 Sherwood Pl Raine & Horne 0419 991 500 O/A$400,000 H

Stanwell Park 2508 11:00-11:30 Sat 13 Sheridan Cres Bevans 4294 3699 $759,000 H

Tarrawanna 2518 11:45-12:15 Sat 42 Brooker St LJ Hooker 0468 944 961 O/A $720,000 H12:00-12:30 Sat 18 Brissendon Cl O’Connor 0416 266 055 $760,000 H

Thirroul 2515 10:30-11:00 Sat 393-395 Lawrence Hargrave Dr

Bevans 0401 675 077 AUCTION H

11:00-11:30 Sat 411 Lawrence Hargrave Dr

Bevans 4226 6222 Auction H

11:30-12:15 Sat 50a Pass Ave Ray White 0433 175 681 $675,000 H

1:00-1:30 Sat 5 The Waves NA Ray White 0433 175 681 Auction H

1:00-1:30 Sat 9 Hewitts Ave Wiseberry 0414 539 699 $680,000-$700,000 H

1:00-1:30 Sat 32 Armagh Pde Bevans 4226 6222 Auction H

2.00-2.30 Sat 7/18-22 Harbord St LJ Hooker 0411 713 523 Auction V

Towradgi 2518 10:00-10:30 Sat 104 Towradgi Rd ARRE 0499 989 998 O/A$450,000 H10:30-11:15 Sat 17/42 Carters Lane Huxley 0408 423 051 $379,000 TWN3:00-3:30 Sat 10 Hillside Ave MMJ 0408 944 434 $549,000 H

Tullimbar 2527 11:00-11:30 Sat 34 Broughton Ave Doug.Harcourts 0405 454 624 Auction H

Unanderra 2526 10:00-10:30 Sat 7 Stratford Rd Doug.Harcourts 0408 422 644 $359,000 H

Warilla 2528 10:00-10:30 Sat 24/1 Sparta Ave Peter Taranto 0417 124 313 $309,000 V

12:50-1:10 Sat 3 Terry St MMJ 0408 411 723 O/A$320,000 H

1:00-2:00 Sat 90 Osborne Pde LJ Hooker 0402 121 870 $625,000 H

Warrawong 2502 10:00-10:30 Sat 4 Little Pl Ray White 4271 4000 $349,000 H

West Wollongong 2500 10:00-10:30 Sat 3/24 Fisher St Ray White 0433 175 681 $549,000 T11:00-11:45 Sat 1/2 Parsons St Clayton R/E 0421 304 248 $499,000 V11:30-12:00 Sat 51 Dempster St Cooper & Cooper 0414 912 288 $429,000 H12:30-1:00 Sat 16/4 Fisher St Cooper & Cooper 0414 912 288 $335,000 V

Windang 2528 10:40-11:00 Sat 78 Ocean St MMJ 0408 411 723 O/A$380,000 H

Published by WEBSTAR PRINTING1/83 Derby Street, Silverwater NSW 2128

Advertising enquiries to 1300 137 161The Publisher does not accept any responsibilitiyfor the information provided in this magazine.2A/175 James Ruse Drive Rosehill NSW 2142

Thursday 14 to Wednesday 20 February

Purchasing or Refinancing?Not all lenders are the same and it can be very confusing.

Let my 25 years lending experience help you find the right home loan

4296 8888

Wombarra 2515 11:00-11:45 Sat 489A Lawrence Hargrave Dr

Ray White 0403 305 315 $699,000 H

2:00-2:30 Sat 114 Morrison Ave Wiseberry 0414 539 699 $630,000 H

2:30-3:00 Sat 14 Clutha Pl Wiseberry 0414 539 699 O/A$700,000 H

2:45-3:15 Sat 4 Sweeney Pl Professionals 0411 315 450 $840,000 H

Woonona 2517 10:00-10:30 Sat 4/16 Popes Rd David Grubb 0412 261 077 $339,000 TWN

10:00-10:30 Sat 6/377 Princes Hwy Doug.Harcourts 0423 008 248 $289,000 U

10:30-11:00 Sat 2/95 Campbell St Ray White 0422 050 392 $469,000 TWN

10:30-11:00 Sat 2 Kulgoa Rd O’Connor 0414 946 000 Auction H

11:00-11:30 Sat 15 Doris Ave Bevans 0409 969 032 AUCTION H

11:00-11:30 Sat 22/14-18 Alice St Doug.Harcourts 0412 188 171 $469,000 TWN

12:00-12:30 Sat 8/26 Popes Rd Doug.Harcourts 0411 385 833 $450,000 TWN

12:00-12:30 Sat 38 Hopetoun St Bevans 0409 969 032 AUCTION H

12:00-12:30 Sat 1/9 George Tate Cl Ray White 4271 4000 $650,000 - $690,000 TWN

12:00-12:45 Sat 38 Red Ash Dr Bevans 0410 426 320 O/A$539,000 H

12:00-12:30 Sat 15 Kialoa Rd One Agency 4226 5100 Auction H

12:15-1:00 Sat 51 Gahans Ave MMJ North 0412 425 801 O/A$599,000 H

1:00-1:45 Sat 20 Kareela Rd Ray White 0411 969 656 Exp of Interest H

2:00-2:30 Sat Unit 3/25 Popes Rd MMJ North 0412 421 214 $369,900 V

5:00-6:00 Thu 38 Red Ash Dr Bevans 0410 426 320 O/A $539,000 H

1:00-1:30 Sun 8 Beach Dr Bevans 0433 433 168 Auction H

Yallah 2530 11:00-12:00 Sat 11 Larkins Lane LJ Hooker 0402 844 636 Exp Of Interest H

Yellow Rock 252712:00-12:30 Sat 513 Yellow Rock Rd Doug.Harcourts 0405 454 624 Auction H

Hints for Preparing Your Home For Sale AUCTION UPDATEA brief outline of upcoming auctions

RESIDENTIALBevans Thirroul38 Hopetoun Street, Woonona - 16/2/2013 - 12.30pm (on site)6 Asquith Street, Austinmer - 23/2/2013 - 12.30pm (on site)15 Doris Avenue, Woonona - 2/3/2013 - 10.30am (on site)393-395 Lawrence Hargrave Drive, Thirroul - 2/3/2013 - 11am (on site)Bevans Wollongong32 Armagh Parade, Thirroul - 23/2/2013 - 1.30pm (on site)411 Lawrence Hargrave Drive, Thirroul - 2/3/2013 - 11.30am (on site)41 Hospital Rd, Bulli- 9/3/2013 - 11.30am (on site)12 Bell Street, Keiraville- 9/3/2013 - 12.30pm (on site)Dougmal Harcourts Albion Park513 Yellow Rock Road, Yellow Rock - 2/3/2013 - 12.30pm (on site)Dougmal Harcourts Kiama18 Elanora Road, Kiama Heights - 23/2/2013 - 11am (on site)Dougmal Harcourts Northern Suburbs32 Thurston Crescent, Corrimal - 23/2/2013 - 12pm (on site)55 Underwood Street, Corrimal - 2/3/20123 - 11.45am (on site)Elders Wollongong5 Cannell Crescent, Towradgi - 23/2/2013 - 10am (on site)323 Northcliffe Drive, Berkeley - 23/2/2013 - 11am (on site)301 Princes Highway, Albion Park Rail - 12pm (on site)First National O’Connor2 Kulgoa Road, Woonona - 16/2/2013 - (On site)15/10 Market Street, Wollongong - 23/2/2013 - 10am (on site)6 Marr Street, Wollongong - 23/2/2012 - 11am (on site)16 Sheppard Street, West Wollongong - 2/3/2013 - 12pm (on site)LJ Hooker Warrawong22 Third Avenue, Port Kembla - 2/3/2013 - 12.30pm (on site)7/18-22 Harbord Street, Austinmer - 2/3/2013 - 3pm (on site)LJ Hooker Wollongong107-109 Mt. St. Thomas - 2/3/2013 - 11am (on site)MMJ South70 Darcy Road, Port Kembla - 23/2/2013 - 12.30pm (on site)MMJ WollongongUnits 4, 5, 10, 11, 8 McKinnon Street, Nowra - 6/3/2013 - 6pm (Shoalhaven Ent. Centre)One Agency Thirroul6 Cornock Avenue, Thirroul - 2/3/2013 - 2.30pm (on site)Raine & Horne Austinmer74 Mountain Road, Austinmer - 23/2/2013 - 10am (on site)Ray White Unanderra3 Francis Street, Bulli - 16/2/2013 - 3pm (on site)70 Ellengowan Crescent, Fairy Meadow - 23/2/2013 - 3.45pm (on site)49 Ramah Avenue, Mount Pleasant - 3/3/2013 - 12 pm (on site)2 Paulsgrove Street, Gwynneville - 3/3/2013 - 12pm (on site)10 Makaha Way, Shell Cove - 3/3/2013 - 2pm (on site)11 Antrim Street, Kiama - 3/3/2013 - 3pm (on site)Ray White North Beach Wollongong12 Walter Street, Mangerton - 27/2/2013 - 6pm (Novotel North Beach)9/30 Smith Street, Wollongong - 27/2/2013 - 6pm (Novotel North Beach)418 Crown Street, West Wollongong - 27/2/2013 - 6pm (Novotel North Beach)Ray White Thirroul5 The Waves, Thirroul - 16/2/2013 - 2pm (on site)2 Kennedy Road, Austinmer - 9/3/2013 - 11.30am (on site)Ray White Unanderra3 Francis Street, Bulli - 16/2/2013 - 3pm (on site)70 Ellengowan Crescent, Fairy Meadow -23/2/213 - 3.45pm (on site)

Gianni Moretti, Personal Mortgage AdviserPhone 0404 033 664 • www.smartline.com.au/gmoretti

Award winning mortgage advice from Australia’s top mortgage broking group. It makes sense to get your own personal mortgage adviser. Your home loan can make the difference between a good and a great property investment. Make sure it’s working for you. Talk to Gianni at Smartline today.

• Compare loans from over 25 top lenders.• Help to choose the right loan tailored to your needs.• We’ll come to you at a time that suits you.

Australian Credit Licence Number 385325

Award winning mortgage advice

NEWSMaximising first impressions.

Exterior and Curb Appeal• Experts say most buyers make their decision at first sight.

General Exterior• Prospective buyers will react well to signs your home has been meticulously maintained. • Landscaping - mow, edge and water lawn, trim hedges, weed and fertilise flowerbeds, and prune trees. • Keep the driveway clean and free of parked cars, and keep the garage door closed. • Repair or replace loose or damaged roof tiles if applicable. • Minimise cracks or crumbling on walkways, walls, or steps, and keep them clean and free of obstruction like

toys. • Make sure that from the street, your property appears clean and clear. • Inspect appearance of interior window coverings from the outside. • Repair any peeling paint on windows or other areas. • Take steps to eliminate insect or rodent pest. • Pick up after your pets and neighbourhood animals.

Doorway• While you are unlocking the property and turning off alarms, buyers have idle time to notice details. • Apply a fresh coat of paint to the front door. • Consider adding pots of flowering plants in the entryway if weather permits. • Remove cobwebs and clean the doorway area windows, porch lights, or decorative glass.

Interior Appeal• Once inside, Experts say most buyers are reaffirming their first impressions from the outside.

Clean, Clear, Light and Bright• Give every room in the house a thorough cleaning and remove all clutter. Hiring a cleaning service may

pay for itself by adding to a buyer’s perceived value of your home. • For a sleeker, more spacious look, consider placing furniture from crowded rooms in storage. • Clear kitchen counters or benches of everything other than perhaps a few pretty items. Ask yourself - In a

model home, would a professional decorator put your choice of items out on the counter? • Remember, wardrobes and hall cupboards will be opened! Keep wardrobes, cupboards, and storage

areas neat and tidy. Since you’re anticipating a move anyway, consider holding a garage sale or boxing and storing unused belongings.

• If necessary, repaint or clean or replace dingy, soiled or strongly coloured walls, and window and floor coverings with a light, neutral shade. Bright rooms look bigger, and neutral colours help buyers envision their own furnishing and decor.

• Repair dripping taps, burned out light globes, or cracked windowpanes. • Repair cracks, holes or damage to plaster, wallpaper, and tiles.

Warm and Homey• Subtle Scents of potpourri in bedrooms or baths and fresh baked cookies or coffee in the kitchen can make

your home more inviting. • Keep an attractive set of towels in each bathroom to be brought out only for showings.

The Doghouse isn’t Such a Bad Place

We know some owners like to spoil their pets, but one owner across the pond has really raised the roof with his doghouse.

The doghouse with all the trimmings has been named Pet Pad of the Year 2012 by UK insurance group MORE TH>N, and rightly so. Standing 6.5ft high, it was hand-crafted by the lucky dog’s owner, complete with fully insulated walls and floors, carpet, glossed skirting boards, interior and exterior lights on a timer switch, a slate roof and fully functioning guttering.

To complete the pooch’s perfect palace, there’s a patio pathway, porch light, ceramic statues and hanging baskets around the exterior.

Ray White Thirroul

Austinmer 2 Kennedy Road Enviable Beach Side Living

Prime beach side living just 250 metres from Austinmer’s main beach.The 3 bedroom cottage over one level offers a desired N/E aspect with widespread ocean and coastal views from the ocean side wrap around balcony. Set on a private and established 607m2 garden allotment, single L/U garage and storage, convenient to train station, schools and cafes.

3 A 1 B 1 C

Saturday 9th March at 11.30am, onsite

View Saturday 16th February 11.30am - 12.30pm

Tony Dribbus 0433 175 681tony.dribbus@raywhite.comraywhite.com | 4268 5577

Auction

• Sweeping coastal and ocean views• Light filled living areas• Private entertaining courtyard• 250 meter stroll to Austinmer beach• 1 hour 15 minutes to City CBD• Council rates $2,475.00pa

Mount Ousley 93 Cabbage Tree Lane Perfect Family Home 3 A 2 B 2 C 1 E

Ray White Thirroul

Tastefully renovated brick home with high ceilings, polished floors, lime wash kitchen including stainless steel appliances, second living area, modernised bathroom and separate shower/toilet. Fully fenced yard with inground pool and entertaining cabana.

Sale $529,000

View By Appointment

Tony Dribbus 0433 175 681raywhitethirroul.com.au | 4268 5577

Thirroul 50a Pass Avenue Tastefully Renovated Character Home 4 A 2 B 2 C

Ray White Thirroul

Privately nestled with level convenience to Thirroul’s town centre, schools,train station and fine cafes. Tastefully renovated character home over 2 levels with spacious interiors and modern finishes. 4 bedroom or 3 bedroom + study, 2 bathrooms, timber floors, living areas flow onto a private entertaining sun deck.

Sale $675,000

View Saturday 16th February 11.30am - 12.15pm

Tony Dribbus 0433 175 681

tony.dribbus@raywhite.com raywhitethirroul.com.au | 4268 5577

Thirroul 57 Armagh Parade New to Market 3 A 1 B 1 C

Ray White Thirroul

A peaceful location with widespread ocean views, neat as a pin 3 bedroom residence with rumpus room or 4th bedroom, polished timber floors throughout. Adjoining bush reserve, double garage.

Sale $595,000

View Saturday 16th February 10.30am - 11.15am

Tony Dribbus 0433 175 681

tony.dribbus@raywhite.com raywhitethirroul.com.au | 4268 5577

West Wollongong 3/24 Fisher Street "Paddington Terraces" 3 A 2 B 2 C

Ray White Thirroul

An exceptional modern and sleek terraced styled townhouse in a boutique complex convenient to all the city’s amenities. Flawless presentation throughout, accommodation includes 3 bedrooms, 2 bathrooms and granite kitchen. Front and rear alfresco courtyards fully landscaped.

Sale $549,000

View Saturday 16th February 10.00am - 10.30am

Tony Dribbus 0433 175 681

tony.dribbus@raywhite.com raywhitethirroul.com.au | 4268 5577

Ray White Woonona

Woonona 20 Kareela Road

Do not miss this!

Any astute buyer looking to purchase at Woonona Beach loves to hear these words; "north side of Kareela Road" Offering a suberb large family home, reserve land at rear along with views to the Royal National Park, surf, sand, cycleway, cafe’s, ocean pool, parks, schools & transport at your disposal!

4 A 3 B 2 C

Sale"Expressions of Interest"

View @ 1-1.45pmSaturday 16 Feb

Troy Johnson 0411 969 656troy.johnson@raywhite.com

4284 8888Ray White Woonona

Mount Pleasant 36 Rose Parade

Private Prestige Estate

"ROSE MANOR" is a provincial style residence of imposing proportions set on 14,500m2, with magnificent escarpment views. Formal entry foyer, grand formal lounge & formal dining room. Magnificent rumpus room + bar, wine cellar, workshop, pool + spa, sep. guest acom, tennis court + gazebo, olive grove & est. gardens.

5 A 3 B 1 E 1 F

Sale$1.35M

View by appointment

Troy Johnson 0411 969 656troy.johnson@raywhite.com

4284 8888

Wombarra 489A Lawrence Hargrave Drive Beach Side Living - Reduced! 3 A 2 B 2 C

Ray White Woonona

Split level contemporary home features timber floors, raked ceilings, timber kitchen & open plan living leading to deck with views to ocean. A detached 60 m2 (approx) outbuilding affords a double garage, large workshop/utility area and its own shower and toilet. Affordable lifestyle!

Sale $699,000

View @ 11-11.45amSaturday 16 Feb

Rick Taylor 0403 305 315

rick.taylor@raywhite.com | 42848888

Ray White Woonona

East Corrimal 9 Dobbie Crescent

HOLIDAY 24 Seven!

Prime position only metres from the golden sand & surf! Architect designed master home with separate villa residence for in-laws, teenagers or an added income! Equipped with resort style swimming pool, contemporary design & bonus hair studio for the work from home mum. Your dream home & lifestyle awaits!

5 A 4 B 1 C 1 E

Sale$1.275M

View @ 12-12.45pmSaturday 16 Feb

Rick Taylor 0403 305 315 rick.taylor@raywhite.com

4284 8888

Bulli 8/21-23 Hospital Road Executive Apartment 3 A 1 B 2 C

Ray White Woonona

Beautifully presented residence, undercover rear access from huge double LUG, gourmet kitchen with S/S appliances, tiled & carpeted throughout, BIW’s, retractable terrace doors. Ideally located in a private elevated location, within close proximity to all amenities

Sale $425,000

View by appointment

Troy Johnson 0411 969 656

troy.johnson@raywhite.com | 4284 8888

Ray White Unanderra

Mount Pleasant 49 Ramah Avenue

Landmark Address

Unexpectedly spacious & perfect for relaxed family living. Enjoy the stunning design of this classic beauty.* New kitchen with caesar stone benchtops* Excellent outdoor entertaining area* Office/rumpus opening onto low maintenance yard

4 A 3 B 2 C 1 E

AuctionSun 3rd Mar On site @12pm

View Sat 11:00am - 11:30am & 2:00pm - 2:30pm

Michael Moate michael.moate@raywhite.comraywhiteunanderra.com.au/9083404271 4000

Ray White Unanderra

Kiama 11 Antrim Street

Experience Resort Style Living

Exquisitely presented throughout & to the highest of standards. This property makes you feel like your on holidays all year!* Top of the range integrated kitchen with Miele appliances* Casual outdoor deck with glorious views north along Bombo Beach

3 A 3 B 3 C 1 E

AuctionSun 3rd March On site @ 3pm

View Sat 11:00 - 11:30 & 3:00 - 3:30 & Sun 1:00 - 1:30

Michael Moate michael.moate@raywhite.comraywhiteunanderra.com.au/9084904271 4000

Ray White Unanderra

Fairy Meadow 70 Ellengowan Crescent

Something Really Special

Charming family home on a 967sq metre parcel. Offering high ornate ceilings & located in a desirable location.* Generous living & dining areas * Neat kitchen & built in robes in all bedrooms* Sunroom with views across the park

4 A 1 B 2 C

AuctionSat 23rd Feb On site @ 3:45pm

View Sat 12:00pm - 12:30pm

Michael Moate michael.moate@raywhite.comraywhiteunanderra.com.au/9034894271 4000

Ray White Unanderra

Shell Cove 10 Makaha Way

Almost Paradise!

Luxuriously spacious & impeccably finished, this as new home was designed to provide the best in contemporary indoor & outdoor living.* Expansive entertaining areas overlooking in ground pool & water features* Superb chefs kitchen with state of the art appliances

4 A 2 B 3 C 1 E

AuctionSun 3rd Mar On site @ 2pm

View Sat 10:00 - 10:30 & 2:00 - 2:30 & Sun 12:00 - 12:30

Michael Moate michael.moate@raywhite.comraywhiteunanderra.com.au/9085074271 4000

Ray White Unanderra

Dapto 1/65-67 Mount Brown Road

Simply Stunning!

Stylish living in a wonderful large villa, perfect for buyers looking to downsize or a first home.* Stunning kitchen featuring 40mm stone benchtops, stainless steel appliances * Contemporary, open plan & flowing design offers an area for all occasions* Close to Mount Brown Public School

3 A 2 B 2 C

Sale$360,000 - $410,000

View Sat 10:00am - 10:30am & 1:00pm - 1:30pm

David Greenwood david.greenwood@raywhite.comraywhiteunanderra.com.au/9066294271 4000

Ray White Unanderra

Albion Park Rail 7 Shearwater Boulevard

Macquarie Shores Estate

Ideally positioned on a generous 723sqm parcel of land, this charming single level home offers ample proportions to comfortably accommodate a growing family.* Located in Macquarie Shores Estate* Expansive & level rear lawn & garden* Huge outdoor covered entertaining & BBQ area

3 A 1 B 1 C

Sale$360,000 - $410,000

View Sat 12:00pm - 12:30pm

Lindsay Begley lindsay.begley@raywhite.comraywhiteunanderra.com.au4271 4000

Ray White Unanderra

Cordeaux Heights 73 Derribong Drive

Petite Retreat

Perfect for those looking for a private life this single level home is quietly positioned on a generous 1258sqm parcel.* Combined living/dining with views* Close schools & public transport* Leafy entertaining deck

3 A 1 B

Sale$430,000 - $465,000

View Sat 11:00am - 11:30am

Jennifer Conroy jennifer.conroy@raywhite.comraywhiteunanderra.com.au/9007694271 4000

Bulli 3 Francis Street Idyllic Lifestyle Awaits 5 A 2 B 2 C

Ray White Unanderra

A modern lifestyle quietly positioned close to spectacular Bulli beach. Flexible in it’s layout & elegantly presented.* Low maintenance & fully fenced yard* Polished timber floors & ample storage* Parks, schools & bike track moments away

Auction Sat 16th Feb On site @ 3pm

View Sat 2:30pm - 3:00pm

Michael Moate raywhiteunanderra.com.au/899671 | 4271 4000

Auctio

n

This

Wee

kend

Figtree 14 Amaroo Avenue A Touch of Class! 4 A 2 B 2 C

Ray White Unanderra

Positioned in a convenient & peaceful location.*Large rumpus room, which can be converted to self contained living* Generous undercover entertaining area which doubles as more parking* Close to schools, transport & shopping

Sale $450,000 - $490,000

View Sat 1:00pm - 1:30pm

Michael Moate michael.moate@raywhite.comraywhiteunanderra.com.au/909772 | 4271 4000

Ray White Wollongong

Unanderra 247 Berkeley Road

• Warehouse 544m2 (approx) + first floor offices

88m2 (approx)

• Courtyard 520 m2 (approx)

• Zoned IN3

• 9 Parking Spaces

• High Clearance roller door

• 3 air conditioned offices + storage room

Sale

$795,000 + GST

View By Appointment

Ben Baaner 0423 218 285

Tony Hunt 0419 994 369raywhitewollongong.com4229 8600

Just

List

ed

Dapto 81 Mount Brown Road Situated in a private cul de sac street. Featuresspacious modern kitchen, four bedrooms, modernbathroom plus ensuite, garaging for three cars &outdoor entertaining. Currently Tenanted at $450per week on an expired lease.

Sale $399,000View Saturday 10:00 - 10:30Ben Baaner 0423 218 285raywhitewollongong.com | 4229 8600

Ray White Wollongong

Dapto 34 Emerson Road Good value and lots of space for the money!Features include 4 bedroom’s with BIW’S, 2 bathrooms + ensuite, separate living area & rumpus room, double garage & sparkling in-ground pool! Potential for in-law accom or teenage retreat.

Sale $399,000View Saturday 11:00 - 11:30Ben Baaner 0423 218 285raywhitewollongong.com | 4229 8600

Ray White Wollongong

Lake Illawarra 5 Pur Pur Avenue Ideal spot within 300 metres of Lake Illawarraand Warilla Beach. Features a two streetfrontage on a 310m2 block. Walking todistance to beach, shops & Parks.

Auction Saturday 2nd March 4:00pmOn SiteView Wed 5:30 - 6:00 & Sat 3:30 - 4:00Ben Baaner 0423 218 285raywhitewollongong.com | 4229 8600

Ray White Wollongong

Auctio

n

Dapto 61 Marshall Street Tradesmen or Large Families6 bdrms, various living spaces, 7 plus garaging

Auction Sat 2nd March 11.30amOnsiteView Open Sat 11am - 11.30am & Wed 5.30 - 6pmAlex Edler 0458 721 196raywhitewollongong.com | 4229 8600

Ray White Wollongong

48 14 February 2013

Albion Park 3 Scenic Crescent Little Ripper 3 A 1 B 1 C

Ray White Unanderra

Peaceful location, recently renovated residence with bright modern decor & a fantastic outlook to the rear.* Entertaining pergola & well established gardens* Polished floorboards and split system air conditioning* Internal laundry with direct outdoor access* Rented at $390 per week

Sale $345,000

View Sat 12:00pm - 12:30pm

John Kay john.kay@raywhite.comraywhiteunanderra.com.au | 4271 4000

Lake Illawarra 99 Reddall Parade One for the Money 2 A 1 B

Ray White Unanderra

Set on a large parcel spanning close to 720 sqm, offers a fantastic lifestyle.* Plenty of untapped potential* Exciting scope to extend or build (STCA)* Hop skip & jump to Lake Illawarra’s foreshore, close to schooling, bike tracks & parks

Sale $349,000

View Sat 12:00pm - 12:30pm

Jennifer Conroy jennifer.conroy@raywhite.comraywhiteunanderra.com.au/906982 | 4271 4000

Cordeaux Heights 41 Coachwood Drive * Prime corner block, single level 3 BR home* Stylishly presented & featuring light filled interiors.* Stylish kitchen opens to timber deck* Double lock-up garage with internal access* Walk to schools, shops & express bus

Sale $390,000 - $420,000View Sat 1:00pm - 1:30pmLindsay Begley lindsay.begley@raywhite.comraywhiteunanderra.com.au/891563 | 4271 4000

Ray White Unanderra

Cordeaux Heights 31 Kooranga Crescent * Spacious contemporary single level 4 BR home * Offering an abundance of natural light* Picturesque private rear yard & entertaining area* Plenty of off street parking for boats, cars & caravans

Sale $489,000View Sat 10:00am - 10:30amJennifer Conroy jennifer.conroy@raywhite.comraywhiteunanderra.com.au/881281 | 4271 4000

Ray White Unanderra

Gwynneville 2 Paulsgrove Street * 692sqm block with a 21m frontage * Walking distance to Wollongong UNI* Wollongong Botanical Gardens situated at rear

Auction Sun 3rd Mar On site @ 12pmView Sat & Sun 11:00am - 11:30amDavid Greenwood david.greenwood@raywhite.comraywhiteunanderra.com.au | 4271 4000

Ray White Unanderra

Horsley 1/3 Barham Place * Single level & free standing 3 BR villa * Quiet cul-de-sac location with lock up garage* Modern decor & ample natural light & air con* Spacious bedrooms with built-ins* Covered outdoor area with water feature

Sale $310,000 - $360,000View Sat 1:00pm - 1:30pmJennifer Conroy jennifer.conroy@raywhite.comraywhiteunanderra.com.au/893423 | 4271 4000

Ray White Unanderra

West Wollongong 418 Crown St HIGH EXPOSURE DEVELOPMENT SITE 4 A 2 B 8 C

Ray White North Beach Wollongong

- Over 1100m2 block with wide frontage. - D.A approved for 6 x 2 bedroom apartments- Drainage easement approved- Possible mixed use site or medical practice (STCA)- A unique opportunity with loads of potential

Auction 27th February at 6.00pmVenue: Novotel North Beach Wollongong

View Saturday 1.30-2.00pm

Fady Saad 0422 050 392

raywhite.com | 4226 9000

Wollongong 181 Church St MUST BE SOLD!!Within metres to W’gong Mall, beaches, & cafes is this versatile single level residence. Potential to work from home or run your own business (STCA). Features 3 bedrooms, 2 spacious living areas & a low maintenance yard. A great villa alternative!

Auction On-site 9th MarchView Saturday 11.30-12.00pmFady Saad 0422 050 392

Ray White North Beach Wollongong

"An address to impress"

Mangerton 12 Walter Solid 3 bedrm dble brick rendered home in prime location. Features:- Quality kitchen & bathrm, lounge, dining, rumpus, cov’d deck & garage. Handy to prvt, state & pre schools. Must see!

Auction Wednesday 27th Feb. 6pm RegistrationNovotel North Beach WollongongView Saturday 11.45am-12.15pmRodney Stone 0431 821 949raywhite.com | 4226 9000

Ray White North Beach Wollongong

Auctio

n

14 February 2013 49

3-4 1 2

353 Crown Street Wollongong 4228 7878 Lou Niceski 0414 287 093, Danny Peterson 0421 764 496

elderswollongong.com

•••••

•••••

•••••

••••

•••••

•••••

•••

••

••

••

••••••

••••

••••

•••

••••••

••••••

•••

14 February 2013 51

No need to book a holiday this year or even the next, as this fabulous three bedroom home has the feel and characteristics of an ultra-modern 5 star villa. Enjoy waking up to the sun warming the escarpment and the birds singing. Pop on your dressing gown and enjoy catching up on the world events sipping a hot cuppa, whilst being energised by the morning sun shining through the louver windows of your very private sunroom. You will have plenty of leisure time as this well thought out home has zero maintenance and I mean zero! I believe this home will be extremely popular so make sure you are the first to see it.

John O’Reilly 0401 675 077[e] john.oreilly@bevans.com.au bevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

FOR SALE: $590,000 - $620,000WHERE: 17 Mahogany Way, WoononaINSPECT: This Saturday 12.15pm 12.45pm

bed 3 | bath 2 | car 2

Fabulous Edgewood

For the first time Stanwell Park’s Watergum Grove is now being offered for sale. One of the most successful bed and breakfast in the park, a business and lifestyle change is just the thing for the overworked corporate couple. Maybe you have a large family you need to accommodate, or a place for the inlaws, either way this home has so much opportunity. Just lock the internal door and you have two fully self-contained residences. This expansive property is located in such an enviable position. Backing onto parkland and a short stroll to the beach, fall asleep to the soothing sounds of the ocean as it lulls you to sleep.

Wendy Lepre 0431 322 192 [e] wendy.lepre@bevans.com.aubevanshelensburgh16 walker street4294 3699 helensburgh@bevans.com.au

bevans

FOR SALE: Offers over $900,000WHERE: 24a Station Street, Stanwell ParkINSPECT: By Appointment

bed 5 | bath 2 | car 4 | land size 585m2

Watergum Grove - Two Homes in One

52 14 February 2013

Fantastically located in the heart of Woonona this charming take on cottage living was actually the very first house built in the street! Retaining a character reminiscent of the era the condition is still excellent, and the environment is low maintenance, reasonably level and north facing. A popular, quiet, level street! An appealing frontage with a verandah behind the established hedge! A wonderful coastal lifestyle beckons with the beach, park, village shops and transport just a short stroll away. A classic presented facade welcomes you upon arrival, open the door there’s lovely wide timber boards. A traditional layout offers three bedrooms and a sunroom. A generous open living area with warm neutral colours features a fire place and gas heating. Flowing from the living space is a large open functional kitchen. The back yard is an appropriate size to entertain family and friends, and is the perfect place to soak up the rays while watching the young ones play.

Justin Sydenham 0417 330 229Kane Downie on 0409 969 032 bevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

AUCTION: Saturday 16th February at 12.30pm on siteWHERE: 38 Hopetoun Street, WoononaINSPECT: This Saturday 12pm - 12.30pm

bed 3 | bath 1 | car 1 | land size 701m2

Northern Exposure

Now you can relax. Lovely, finished and ready to enjoy, this beautiful family home will entice you and make you stay a while…… Located in a quiet, sunny street where the house-proud locals enjoy their quiet neighbourhood, this home really has been finished with nothing left to do. From the moment you pull up out the front you can appreciate the attention to detail in a home that many will love. Polished timber floors lead you through the home and there is soft carpet underfoot in the bedrooms. The kitchen oozes appeal. The white timber doors, a breakfast bar and sleek appliances with plenty of preparation space makes for a happy chef! Walking from room to room the large windows give a wonderful feeling of space, reaching out and bringing the sunshine in. The rear living zone leads you through triple stacking glass doors and onto a new deck. Down-lights and feature lights inside and out bring the home to life of an evening and ducted reverse cycle air conditioning balances your comfort.

Kane Downie 0409 969 032 [e] kane.downie@bevans.com.aubevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

AUCTION: Saturday 2nd March at 10.30am on siteWHERE: 15 Doris Avenue, WoononaINSPECT: This Saturday 11am - 11.30am

bed 3 | bath 2 | car 1 | land size 569m2

Cool Summer Breeze

14 February 2013 53

An awesome, unique and affordable development opportunity right in the very heart of Thirroul, where commercial and residential demand is high and new alternatives are non existent! The DA approval allows for demolition of the existing warehouse and construction of a mixed use development which includes a commercial ground floor café, first floor office space, and two residential apartments. A contemporary design, the 106m2 restaurant allows for full kitchen facilities, bathrooms, parking and opens up out to Railway Parade opposite the train station. We’ve already had some interest in the 174m2 of open office space on the first floor. Oversized glass doors open up to two external deck areas. There is exposure in this busy location for signage. Only two exclusive well designed apartments and their decks sit above it all on the second floor, with access via a lift. The demand for these single level apartments will be high. An ideal time to invest in the Northern Suburbs where all the planning & waiting for council has been done! Agents Interest.

Justin Sydenham 0417 330 229 [e] justin.sydenham@bevans.com.au bevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

FOR SALE: $650,000 - $700,000WHERE: 6 Railway Parade, ThirroulINSPECT: By Appointment

development for sale | land size 582m2

A Little Bit of Bondi in Thirroul

Situated at the rear and in one of the nicest complexes in the northern suburbs this three bedroom villa has everything you could wish for and more. Plenty of light from all angles brings this well presented home to life. Enjoy an afternoon beverage on the massive undercover back deck or enjoy the laughter of the grandkids playing on the magnificent lawn. This quality villa has so much to offer. - Step inside and the warm, homely feel is immediate, with a roomy living area inviting you, and an absolute gorgeous outlook. Three generous bedrooms all with ceiling fans and built ins with plenty of storage. A fresh main bathroom located between all the bedrooms are accompanied by a second toilet elsewhere in the home. The kitchen has more than enough room to downsize into, with stainless appliances and gas cooking to assist with the family feasts. Retirees with lifestyle in mind will also be drawn to elements of this property. An affordable price range makes this property a smart investment.

John O’Reilly 0401 675 077 [e] john.oreilly@bevans.com.aubevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

FOR SALE: $530,000 - $560,000WHERE: 15/3 Mountbatten Street, CorrimalINSPECT: This Saturday 1pm - 1.30pm

bed 3 | bath 1 | car 2

Let There Be Light

artists impression

artists impression

54 14 February 2013

25m

25m

41m

LAW

RE

NC

E H

AR

GR

AVE

DR

48m

1144m2(approx)

bevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

Thirroul Auction Saturday 2nd March at 11am on site393 & 395 Lawrence Hargrave Drive, Open Saturday 10.30am - 11am

• Zoned R3 and ready for development, and enjoy an income of $400.00 per week• Opportunities like this do not come along often, nor are there many areas zoned R3 ready • There is a high demand for units in Thirroul, you build and they will sell• Close to train, shops, restaurants and shoppingContact: John O’Reilly 0401 675 077 or Justin Sydenham 0417 330 229

bed 3 | bath 1 | car 1 | land size 1144m2

bevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

Austinmer Offers above $799,000 11 Kirton Road, Open Saturday 11.15am - 11.45am

• This elevated home has a flexible layout providing up to five bedrooms & two huge living areas• A stunning stone and timber kitchen, with stainless appliances and walk in pantry, looks out over the mass of garden • Bush walk in the escarpment, surf the perfect wave, shop and eat in the village, sip the local coffee, or enjoy a wine in the garden and watch the kids playContact: John O’Reilly 0401 675 077 or Justin Sydenham 0417 330 229

bed 5 | bath 2 | car 2 | land size 663m2

Polished blue gum floors feature throughout this home. The original “Spinner” fire will warm your winters as you sit and stare into the flames from any point in the lounge. Cool summer breezes gently pass through keeping a relaxed feel. All living is on one level and the home is elevated into the trees. Underneath is an artist studio of 70 square metres with glass walls looking into rainforest, and the flooring has been paved using recycled bricks. The double front doors open onto a deck among the trees, walking through this beautiful space; you are met with a serene feeling. The open nature of the living area flanked by windows, lets light in gently and evenly.

Kane Downie 0409 969 032[e] kane.downie@bevans.com.au bevansthirroul10/345 lawrence hargrave drive4267 3444 thirroul@bevans.com.au

bevans

AUCTION: Saturday 23rd February at 12.30pm on siteWHERE: 6 Asquith Street, AustinmerINSPECT: This Saturday 1pm - 1.30pm

bed 3 | bath 2 | car 2 | land size 575m2

One Owner Pettit and Sevitt in Austinmer

14 February 2013 55

Andrew Hedley 0410 551 554Justin Sydenham 0417 330 229 bevanswollongong94 market street4226 6222 wollongong@bevans.com.au

bevans

AUCTION: Saturday 2nd March at 11.30am on siteWHERE: 411 Lawrence Hargrave Drive, ThirroulINSPECT: This Saturday 11am - 11.30am

bed 3 | bath 1 | car 2

Wow, He Has Done it Again!

The setting could not be more serene, rainforest gardens, ocean views, birds busy. A classic 70s home connecting to its natural surrounds through large picture windows, sun filled sky lights and breeze filled balconies. Tucked away privately from other homes, descend the boardwalk and discover nature’s sanctuary. Step inside and embrace a retro 70s pad, cool slate floors, floor to ceiling windows take you back to a bygone era where the pace of life was far more chilled. The vista could not be more enchanting, beautiful trees are interspersed by ocean glimpses, replaced by the glimmer of city lights in the evening. Unusually light for such a bush setting, an abundance of sky lights draws in the sunshine. Cleverly designed, the house is defined by two distinct living areas and balconies, providing a place for you to escape and unwind while your guests settle in. Whether you are looking in Thirroul or Austinmer, this is a rare find.

Andrew Hedley 0410 551 554Daniel Field 0404 003 882bevanswollongong94 market street4226 6222 wollongong@bevans.com.au

bevans

AUCTION: Saturday 23rd February at 1.30pm on siteWHERE: 32 Armagh Parade, ThirroulINSPECT: This Saturday 1pm - 1.30pm

bed 4 | bath 2 | car 1

A Window to a World of Nature

Just moments from the crisp blue waters of Thirroul Beach, funky cafes, the famed coastal walkway & bike track sits this immaculately renovated cottage, which will have you saying wow from the moment you step inside. Do you remember the fuss over 9 George Street Thirroul? Well the same owner has created this new masterpiece. The highest level of detail and quality finishes has been invested in delivering perfection and is sure to intrigue and entice once again. In keeping with the charm of the home the ornate fireplaces are original and the renovation is a modern twist on a bygone era. Step inside and feel immediately captivated by the charm of the home. The kitchen will surpass all your expectations with an extra-large oven and gas cooktop just made for entertaining. Step outside onto your large entertaining deck, as you prepare for a BBQ evening with new found friends. Big brother, 9 George St set viewing records, make sure you are the lucky buyer to snaffle this beautiful example of contemporary/classic Thirroul living.

56 14 February 2013

Dragan Balaban 0488 443 910 James Ianni 0411 587 003 bevanswollongong94 market street4226 6222 wollongong@bevans.com.au

bevans

FOR SALE: Offers above $309,000WHERE: 50 Maple Street, Albion Park RailINSPECT: Thurs. 4.45 - 5.30pm & Sat. 1.30pm - 2pm

bed 3 | bath 1 | car 4

Convenient Living

Wake up to the sounds of the laughing kookaburras, crimson rosellas and rustling treetops. Take a stroll to your kitchen, put the pot on boil and enjoy sipping on your fresh, warm batch of tea as you take in the abundance of natural light, soothing escarpment and ocean views all from the comforts of your own living room. Three great bedrooms, two of which take in the amazing northerly aspect and views on offer; bedroom three also enjoys the lookout over the backyard and luscious greenery of the reserve behind. The original, spacious kitchen will have you preparing all your culinary delights for friends and family while they sit back and have a drink, gossip and gaze over the picturesque views on offer. Why not put your touch and feel into this property and grow it with your family? Make the most of the potential on offer and broaden your horizons whilst maximising your space and parking accommodation. Add a touch, enjoy the views and tranquillity this should not be missed.

James Ianni 0411 587 003Dragan Balaban 0488 443 910 bevanswollongong94 market street4226 6222 wollongong@bevans.com.au

bevans

AUCTION: Saturday 9th March at 11.30am on siteWHERE: 41 Hospital Road, BulliINSPECT: This Saturday 10.45am -11.30am

bed 3 | bath 1 | price guide $400,000+

Best of Both Worlds

Turn the key and move straight in. Situated on a large level block, this solid three bedroom home has nothing for you to do except to call the family and friends to help you move. This great home has all the potential to grow with the family or to help grow your portfolio. Only minutes away to the newly revamped Stockland Shellharbour and moments to local shops, primary schools, transport and great sporting facilities helps add ease to the convenience of single level living. Three great bedrooms with buit-in robes, renovated bathroom and laundry the property also features cypress pine floorboards in the living area perfect for all your entertaining while the kitchen, dining and hallway come with clean tile floor coverings. Spacious yards perfect for the boat and van, huge garage area with additional workshop and double carport. Such great opportunities are few and far between and a rarity like this is definitely not to be missed.

14 February 2013 57

bevanswollongong94 market street 4226 6222 wollongong@bevans.com.au

bevans

Keiraville Auction Saturday 12th March at 12.30pm on site12 Bell Street, Open Saturday 12pm - 12.30pm

• Positioned in a quiet cul-de-sac, within walking distance to the village• The new kitchen boasts polyurethane cupboards, stainless steel built in oven, microwave & dishwasher, garbage disposal unit and stylish stone bench tops• A wonderful paved outdoor entertainment area, boasts undercover pergola, gas outlet for your BBQ and a relaxing 6 person spa bath to ease away the working week• Plenty of land at rear of home to accommodate a second dwelling (STCA)Contact: Tracey Pascoe 0499 499 990 & Lisa Brooke 0423 901 094

bed 3 | bath 1 | car 2

bevanswollongong94 market street 4226 6222 wollongong@bevans.com.au

bevans

Wollongong Offers above $295,00024/46-48 Keira Street, Open Saturday 11am - 11.30am

• Conveniently located within walking distance of city CBD, beach, restaurants and transport• An exceptionally well maintained property, with an abundance of natural light and escarpment views which can be enjoyed from your large balcony• Undercover car space with protection from the elements to your front door• Bathroom offers separate bath and shower. Internal laundry• A generous size separate kitchen with ample bench and cupboardsContact: Lisa Brooke 0423 901 094 & Tracey Pascoe 0499 499 990

bed 2 | bath 1 | car 1

bevanswollongong94 market street 4226 6222 wollongong@bevans.com.au

bevans

Bellambi Offers Above $435,00028 Lorking Street, Open Saturday 12pm - 12.30pm

• Just moments away from gorgeous beaches, nestled on a flat 803m2 block • In close proximity to schools, shops and transport going about your daily business would be done with such ease • Entertain your guests on the perfect north facing back deck and near new six person spa • Cooking up your culinary delights will be made easy in the spacious kitchen• Such a rare opportunity like this should not be missed out onContact: James Ianni 0411 587 003 & Dragan Balaban 0488 443 910

bed 4 | bath 1 | car 1

bevanswollongong94 market street 4226 6222 wollongong@bevans.com.au

bevans

Mount Keira Offers around $549,000129 Koloona Avenue, Open Saturday 10am - 10.30am

• In a commanding position above the street, the home enjoys lovely district and hillside views• Modern renovated kitchen is complete with a Ilvie gas stove, Miele dishwasher, soft close drawers and a funky glass splashback• Spacious and versatile the home could be 6 bedrooms or a mix of living spaces• Wonderful area for schools and a spacious park across the road• Quiet and peaceful, yet only minutes from the beach, bush and cityContact: Andrew Hedley 0410 551 554 [e] andrew.hedley@bevans.com.au

bed 6 | bath 3 | car 2

58 14 February 2013

bevanscorrimalbevans

1/183 princes highway[t] 42 442 442[e] corrimal@bevans.com.auwww.bevans.com.au

bevansrealestate2/407 princes highway, woonona4284 7666woonona@bevans.com.au

bevans

Woonona Offers above $539,00038 Red Ash Drive, Open Thurs. 5pm - 6pm & Sat. 12pm - 12.45pm

• Easy care liveability and positioned on a tranquil street in a highly sought after location• Immaculate, cared for gardens instantly welcome you to this lovely home• Stylish kitchen with ceasar stone bench top, gas cook top, wall oven/grill and integrated dishwasher• This is definitely an ideal beginning for a young family or those looking to down size• Providing easy accessibility to local schools, shops and a short distance to fantastic beachesContact: Jaine Connery 0410 426 320 [e] jaine.connery@bevans.com.au

bed 3 | bath 1 | car 2

bevanscorrimal1/183 princes highway42 442 442corrimal@bevans.com.au

bevans

East Corrimal Auction Saturday 2nd March at 3:30pm on site2 Thalassa Avenue, Open Saturday 1pm - 1.30pm

• Allow yourself to be captivated by the amazing lifestyle this character filled home presents • Enjoy the expansive space this home offers with its comfortable indoor and outdoor living• Plenty of natural light fills this home emanating and incredible feeling throughout • With a fully self-contained flat this property is an ideal opportunity to live and invest all in one• Situated on a popular street in a prime location just moments to transport, schools, shops and the beachContact: Martin Merritt 0412 424 226 [e] martin.merritt@bevans.com.au

bed 6 | bath 3 | car 1

Port Kembla Offers above $399,00029 Forster Street, Inspect by Appointment

• Embrace a feel good, low maintenance lifestyle in this stylish and comfortable family home• Fresh, natural tones, plenty of light and high ceilings are all very welcoming contributes• Offering three oversize bedrooms, two living areas and plenty of storage space throughout • Tasteful kitchen with stainless steel appliances, water purifier and a built in wine bottle rack• In an excellent location, just minutes to Westfield Warrawong and the amazing Port Kembla beach

Contact: Sam Vescio 0402 083 446 [e] sam.vescio@bevans.com.au

bed 3 | bath 2 | bath 2

Mount Ousley Offers above $399,00024 Jobson Avenue, Open Saturday 11.45am – 12.15pm

• The neat and well maintained yard immediately attracts you to this appealing home• Three bedrooms all with built-in-wardrobes, main also opens onto front porch• A beautiful array of natural light radiates a pleasant feeling throughout the property• Located in a peaceful cul-de-sac within walking distance to schools and shops• Commuters will enjoy the convenient access to Mount Ousley Road

Contact: Sam Vescio 0402 083 446 [e] sam.vescio@bevans.com.au

bed 3 | bath 2 | car 1

Corrimal Offers above $239,0006/47 Park Road, Open Saturday 12.30pm - 1pm

• Providing a relaxed and undemanding lifestyle in a highly convenient location• Appealing value this home is an exceptional start for first home buyers or for an astute investor• Living area is a cosy, light filled room which immediately welcomes you upon entering• Neat kitchen features laminate bench tops and wooden cupboards• Offering two good sized bedrooms, main with built-in-wardrobe

Contact: Sam Vescio 0402 083 446 [e] sam.vescio@bevans.com.au

bed 2 | bath 1

Dapto Offers above $339,00011 Larama Avenue, Inspect by Appointment

• Exception modern family home in one of the most sought after streets in Dapto• Three generous size bedrooms all with built-in-wardrobes, main opening to spa• Two great living areas, one featuring a fire place and reverse cycle air conditioner• Enjoy relaxing in your very own conservatory leading to your very own indoor spa• Highlighting the beauty of this property are its well established gardens

Contact: Jaine Connery 0410 426 320 [e] jaine.connery@bevans.com.au

bed 3 | bath 1 | car 1

14 February 2013 59

bevansshellharbour123 shellharbour road4296 5111 shellharbour@bevans.com.au

bevans

Blackbutt from $399,0001-24/1001 Albatross Drive, Open Saturday 10am – 10.30am

• A stunning selection of three bedroom villas and townhouses available• Expansive living spaces throughout with a focus on outdoor entertainment• Free stamp duty for first home buyers plus the $15,000 new home grant scheme• Other government grants available with the $5,000 new home grant• Plans and information packs are available on request• Conveniently located just minutes away from all the offerings of Shellharbour CBDContact: Martin Merritt 4296 5111 [e] martin.merritt@bevans.com.au

bed 3 | bath 2 | car 2

bevans

Shell Cove Offers above $689,0005 Edgecombe Court, Open Saturday 11am – 11.30am

• Fabulously positioned in a quiet cul-de-sac within minutes drive to pristine beaches• Immaculately kept with expansive interiors and spotted gum timber flooring • Large gourmet kitchen with state-of-the-art, smeg stainless steel appliances• Expansive master suite offers walk-in robe and large ensuite with dual basin• Perfectly proportioned with each bedroom including mirrored built-in robes • Entertain in the undercover balcony area flowing off the kitchen and dining roomContact: Alastair Reid 0434 767 553 [e] alastair.reid@bevans.com.au

bed 5 | bath 2.5 | car 2

bevansshellharbour123 shellharbour road4296 5111 shellharbour@bevans.com.au

location shot

artist impression

Located in a tranquil family friendly pocket this striking residence possesses a practical layout with a homely feel. The home is immaculately presented throughout and offers a relaxed, low maintenance lifestyle ideal for modern family living. Comprising of four sizeable bedrooms master with his and her walk in robe and ensuite, generous formal and informal living spaces, study or possible 5th bedroom and quality kitchen with walk in pantry. A wonderful entertainer having a large covered outdoor entertaining area with an added bonus of a 10m x 4m sparkling in-ground pool perfect for those summer months. With a flawless combination of style, space and location this appealing home offers quality finishes and room for the whole family.

Mark Spinelli 0401 385 662 [e] mark.spinelli@bevans.com.aubevansshellharbour123 shellharbour road4296 5111shellharbour@bevans.com.au

bevans

FOR SALE: Offers above $629,000WHERE: 5 Brewster Way, FlindersINSPECT: By Appointment

bed 4 | bath 2 | car 2

Immaculate and Spacious Home

60 14 February 2013

bevansshellharbour123 shellharbour road4296 5111 shellharbour@bevans.com.au

bevans

Port Kembla Offers above $799,0007 Gallipoli Street, Open Saturday 12pm – 12.30pm

• Situated walking distance from Fisho’s beach enjoying uninterrupted ocean views• Gourmet kitchen featuring 40mm Caesar stone bench tops and quality appliances• Enclosed alfresco area with bi-fold doors opening onto the low maintenance garden• The upstairs lounge room has a large balcony with spectacular ocean views• Main bathroom has a sleek design with large spa bath and mosaic tiling feature• Accommodating floor plan with plenty of space for the whole family Contact: Martin Merritt 4296 5111 [e] martin.merritt@bevans.com.au

bed 4 | bath 3 | car 2

bevansshellharbour123 shellharbour road4296 5111 shellharbour@bevans.com.au

bevans

Kiama Offers above $820,0001 Spring Creek Drive, Open Saturday 11am – 11.30am

• A blissfully private getaway nestled upon acreage with views of the escarpment • An idyllic blend of country living with the convenience of being just moments from Kiama CBD• Expansive and flexible floor plan capturing loads of natural light perfect for the extended family• Large Tasmanian Blackwood kitchen, huge walk in pantry, breakfast bar and dishwasher• Private undercover alfresco area makes this property the ideal family entertainer• Remote controlled 3 car garage with workshop area at rear plus internal accessContact: Gino Spinelli 0409 969 202 [e] gino.spinelli@bevans.com.au

bed 5 | bath 3 | car 3

bevans

Shell Cove Offers above $649,00012 Bribie Avenue, Open Saturday 11am – 11.30am

• Contemporary family home offers freshly painted interiors and low maintenance exteriors • The gourmet kitchen offers breakfast bar style seating with an island bench and quality fittings• Four bedrooms with built-in robes and the master room offering ensuite and walk-in robe• Remote double garage with drive through access for a small boat or third car• Family living and dining spaces open to the outdoors by large sliding glass doors • Premium location just minutes away from pristine beaches and Killalea State ParkContact: Martin Merritt 0412 424 226 [e] martin.merritt@bevans.com.au

bed 4 | bath 2 | car 2

bevansshellharbour123 shellharbour road4296 5111 shellharbour@bevans.com.au

bevans

Barrack Heights Offers above $339,000Plenty of Potential

• This home presents a fantastic opportunity for first home buyers or astute investors• Attractive frontage and well cared for gardens are immediately welcoming factors• Kitchen offers plenty of cupboard space and has an ideal outlook over the back yard • Modest living room is an ideal area to relax and overlooks the manicured front yard • Located just moments to the incredible Shellharbour City Centre, schools and beachesContact: Martin Merritt 0410 426 320 [e] martin.merritt@bevans.com.au

bed 3 | bath 1 | car 1

bevansshellharbour123 shellharbour road4296 5111 shellharbour@bevans.com.au

14 February 2013 61

bevansdaptobevans

25 princes highway[t] 4261 5222[e] dapto@bevans.com.auwww.bevans.com.au

bevansdapto25 princes highway4261 5222dapto@bevans.com.au

bevans

Dapto Offers above $349,000245 Kanahooka Road, Open Saturday 11.45am – 12.15pm

• Large 708m2 block of land• Garage has a separate room at the rear for storing all your tools • Floating floors through the hall, kitchen and dining areas • Potential rental return of $360pw to $380pw• Generous size living areaContact: Simon Halcrow 0402 371 001 [e] simon.halcrow@bevans.com.au

bed 3 | bath 1 | car 1

bevansdapto25 princes highway4261 5222dapto@bevans.com.au

bevans

Dapto Offers above $289,0002/77a Marshall Street, Open Saturday 11am – 11.30am

• Situated at the rear of a quiet complex of two • Lovely covered entertaining area looking out to the rear yard• Nice size lounge room with ceiling fan• Separate dining room with reverse cycle air conditioning• Two bedrooms, main with walk in robe, 2nd bedroom with built in robeContact: Simon Halcrow 0402 371 001 [e] simon.halcrow@bevans.com.au

bed 2 | bath 1 | car 1

Horsley Offers above $449,00019 Bovard Court, Open Saturday 10am – 10.30am

• Enter this home and be blown away by the endless space and features• Boasting 5 great size bedrooms all with built in robes set over a spacious and perfect layout.• Brand new kitchen fitted with gas cooktop and fresh appliances • Three large living areas will make entertaining friends and family a breeze • Gorgeous north facing outdoor area with 8 metre solar heated in-ground pool

Contact: Sam Vescio 0402 083 446 [e] sam.vescio@bevans.com.au

bed 5 | bath 2 | car 2

Horsley Offers above $339,00028 Highland Park Drive, Open Saturday 10.45am – 11.15am

• This delightful single level home provides all the ingredients for comfortable family living• Exceptional opportunity for first home buyers or investors• The home is tucked away in a quiet enclave promoting a relaxed and low maintenance lifestyle• Impressive and spacious living area with air conditioning, flows through to dining • Large covered outdoor entertaining area, ideally located in a family friendly neighbourhood

Contact: Rebecca Coe 0413 148 509 [e] rebecca.coe@bevans.com.au

bed 3 | bath 1 | car 1

Corrimal $33,000 pa (exc GST)3&4/94-98 Railway Street

• Excellent street frontage on Railway Street • Directly across the road from Corrimal shopping centre• Approx 120m2 in size • Two parking spaces• Well presented space, which is suitable for a variety of usesContact: Amy Reid 4261 5222 [e] amy.reid@bevans.com.au

commercial for lease

location shot location shot

30 Perth Road, Port Kembla

Fantastic Family Home

4 | 2 | 2 • Huge timber kitchen, open plan design• All double bedrooms, 3 with BIW’s• Security shutters on every window• Double garage with internal access • Garden storage shed and fernery• Close to Port Kembla beach and pool

Auction Sat 9 Mar 2013, 2.30pm On Site

Viewing Sat 10.30 - 11.30am

Contact Sally Absalom 0415 424 257

Office ONEAGENCY Sally Absalom 3/19-21 Princes Highway Fairy Meadow 02 4285 7400Web oneagency.com.au

SALLY ABSALOM

PROVIDINGA LEVEL OFSERVICESECOND TONONE

ONEVISIONONETEAMONENAME

FISHER T EAM

CONTACTSALLY ABSALOM0415 424 257ORCAROL TWIGG0421 118 498

SALLY ABSALOMPRINCIPAL

CAROL TWIGGSALES ASSOCIATE

62 14 February 2013

15 Immarna Avenue, West Wollongong

Substantial family home with a superb aspect

• Spaciouslightfilledinteriors• Polishedtimberfloorsthroughout• 2xlargeentertainingdeckareas• Sunnyaspectwithescarpmentviews• Childfriendlyyardwithcubbyhouse• ClosetoCBD,schoolsandamenities

ViewingSat10.00-10.30amContact ChristianZeidler0411072073Office ONEAGENCYZeidlerHayman 107AKeiraStreet Wollongong42265100Web oneagency.com.au

6 | 2 | 1 |

6 Cornock Avenue, Thirroul

Designed for family living with ocean views4 | 3 | 1

For sale by auction

A recent renovation has magically transformed this quality 80’s architect designed home into the perfect, easy to live in family home. With an entertainer’s dream kitchen that flows from living to dining and to outdoor decks.

Featuring ocean views that stretch as far as the eye can see, this home is set in a convenient, elevated position close to cafes, schools, shops and transport.

Price $750,000

Auction Sat 2 Mar 2013, 2.30pm On Site

Viewing Sat 1.15 - 1.45pm

Contact Vanessa Denison-Pender 0488 443 174

Office ONEAGENCY Denison-Pender & Moore 349 Lawrence Hargrave Drive Thirroul 02 4267 3344Web oneagency.com.au

DENISON-PENDER & MOORE

One Agency Denison-Pender & Moore is a boutique real estate agency specialising in the sale of residential property from Stanwell Park to Woonona.

With more than 15 years combined experience and a reputation as industry high achievers, we are known for our marketing and negotiation skills.

Expert and passionate, we are determined to achieve the very best results possible through strong market knowledge and implementing a range of marketing techniques.

Unlike most agencies, we are not a franchise. This means premium service, greater attention to detail and importantly, flexibility to meet our client’s needs on marketing and fees.

If you’re thinking about selling your most valuable asset in 2013 please let us know.

Amanda Moore 0414 450 830 e: amandamoore@oneagency.com.au Vanessa Denison-Pender 0488 443 174 e: vanessadp@oneagency.com.au www.oneagency.com.au

349 Lawrence Hargrave Drive Thirroul 4267 3344

14 February 2013 43

Beautifully presented is this 5b/r brick veneer home, perched on the high side of the street with glorious city lights and ocean views. This home offers spacious living spilling outside onto a huge covered entertainment area, great for a family get together or summer BBQ.This property has a modern kitchen and appliances, two separate bathrooms plus a rumpus with views to the ocean. If it´s a home office or loads of storage space that your after, this home is second to none, there are various uses for downstairs an inspection will impress. The double garage is on the larger side and the gardens are well manicured.

Inspect: By AppointmentRob Franceschini 0434 970 439

Warrawong 6 Second Avenue $520,000King Of The Castle

OPEN

HOUSE

We are offering this 3b/r home with sep dining & l/u/g. This old fashioned beauty is in desperate need of some TLC, this home is sited on a 700m2 near level block which lends itself for a perfect duplex site STCA.

Inspect: By AppointmentRob Franceschini 0434 970 439

Oak Flats 24 Timbs road $319,000Renovate, Detonate, Redevelop

NEW

LISTIN

G

This solid three bedroom home plus study, has two living areas, modern kitchen, 3 bathrooms, window shutters, reverse a/c, alarm, with downstairs featuring extra storage plus bathroom and single lock up garage with internal access. This property sits on a huge parcel of land over 1000m2 which is a rare commodity to find. This home is within a few minutes drive to the lake foreshore, clubs and entertainment and Warrawong´s CBD.

Inspect: By AppointmentRob Franceschini 0434 970 439

Lake Heights 28 Trevor Avenue $349000Attention First Home Buyers

Perfectly designed and presented family home in quiet location. Spacious formal lounge and dining areas along with gorgeous family living area and dining. Well appointed kitchen, four bedrooms with robes in all with ensuite to main. Double drive through garage, pergola, garden shed, alarm system, air conditioning and much more. This home offers plenty and is proudly kept thus being very impressive.

Absolutel

y

Perfec

t

4 Todd Link

Unbelievable Opportunity867m2 of Lake Front PropertyTwo Bedroom Cottage - Leased 16 yearsBuild your Dream Home on the LakeOpportunities like this are VERY RARE

FANTASTIC

13 Newton Cres

Are you looking for something special? Maybe two street access with a large 917m2 block offering outstanding Lake and Mountain Views? The home is huge that has been fully renovated with spacious open living, gourmet kitchen, beautiful bathroom, four bedrooms, sun room, double garage and closed in double carport? Add in outdoor entertaining and loads of potential, YES then HERE IS YOUR PROPERTY.

Unbound

Potentia

l

107 Lakeview Parade

Home or Investment - PERFECT! Beautifully presented family home featuring maintenance free cladding, split level design, high raked ceilings, spacious living, gorgeous bathroom, well appointed kitchen, three bedrooms, covered rear pergola entertainment area, rumpus room or man cave, tandem carport and swimming pool. Central location to everything certainly makes this a MUST HAVE property.

Don’t You

Miss O

ut

66 Landy Drive

Set in beautiful Lake Illawarra this master built apartment has a sunny northerly aspect with sensational views. Walk to the lake, beach, shops, schools and transport this incredible apartment has it all. Spacious living areas, gourmet kitchen, 3 bedrooms with robes with the main featuring a large ensuite, 2 balconies, security parking underneath with storage area, air conditioning and security intercom.

Excitin

g

Unit

4/78 Addison Ave

* Opposite Warilla Beach* 531m2 block - 15.24 X 35.05* Build your DREAM HOME* Enjoy Holiday atmosphere all year round* Golden Opportunity to live at the BEACH

REDUCED

54 Little Lake Cres

64 14 February 2013

2 1 12 1

3 1 22 1 1

NEW LISTING

4261 0333www.prddapto.com.au Sell Smarter

This immaculately presented home is a credit to its current owners and offers 4 huge bedrooms with BIW’s plus ensuite and WIR to main. Walk into the formal lounge and be impressed by the vaulted ceilings which offer a sense of exclusivity and style. From here it’s a short stroll down the light filled hall to the more informal areas of the house where you can sit relax and enjoy all this fine home has to offer. Outside gardens and a large covered entertaining area spill out to complete a truly stunning home.

Horsley, 14 Riverpark Way 4 BED 2 BATH 2 CAR

VIEW Sat 16 Feb 11-11:30am PRICE $435,000 - $465,000

CONTACT Jeremy Tillman 0418 244 601 jeremy@prddapto.com.au

So much better than new

You will be pleasantly surprised with what this home has to offer. Situated on a massive 892m2 block with ponds and water features you and your family will feel like you are somewhere else. This home has been extended to now enjoy 3 bedrooms, study (or possible 4th bedroom), 2 living rooms, big well-appointed kitchen, modernised bathroom and you can relax and dine outside in one of 2 entertainment areas. Workshop. carport, air-conditioning, freshly painted, new carpet…. there is not a thing that needs to be done when you move in. INVESTORS if you are looking at adding to your portfolio, properties like this are in high demand and would lease for $360 - $375 per week.

Koonawarra, 9 Kurrawa Crescent3 BED 1 BATH 1 CAR

VIEW Sat 16 Feb 10:45-11:15am

PRICE $315,000 - $330,000

CONTACT Tracey McDonald 0404 033 533 tracey@prddapto.com.au

Surprise Package

This trendy home, set on an elevated lot affords great views of the surrounding area and is fit for summer entertaining. Fire up the BBQ under the covered entertainment area and after lunch come on inside and enjoy the fully renovated home. A private dinner party more your thing? Then check out the amazing open plan, modern kitchen and dining area, it really is the heart of this home. With a large backyard and low maintenance gardens this home has been built for enjoying life at home in your great Australian sand castle. If you don’t want to miss this one then call to arrange a private inspection before Saturday’s open house.

Dapto, 64 Laver Road 3 BED 1 BATH 1 CAR

VIEW Sat 16 Feb 12-12:30pm

PRICE $365,000

CONTACT Jeremy Tillman 0418 244 601 jeremy@prddapto.com.au

Entertainers Delight

This magnificent family home has it all including 3 good sized bedrooms with built in robes, recently renovated bathroom with separate toilet & a large air-conditioned lounge area. This property also boasts a formal dining area, neat kitchen and huge 2nd living area complete with open fire place and access to the large private out door entertaining area. Outside the well presented yard is low maintenance. Also featuring a garage with remote doors and internal access, this home has a peaceful feeling that will enhance your life style.

Kanahooka, 4 Howell Avenue3 BED 1 BATH 2 CAREnjoy the lifestyle

VIEW By Appointment PRICE $340,000-$360,000

CONTACT Jeremy Tillman 0418 244 601 jeremy@prddapto.com.au

NEW LISTING

4261 0333www.prddapto.com.au Sell Smarter

Here is a great opportunity to get your foot on the property ladder with a stunning home in a quiet street. All you need and want is here for the taking. Renovated to a high standard your focus will be on how to spend your time entertaining your family and friends in the private backyard. Inspections are a must and will not disappoint. Come home and enjoy all this fine property has to offer.

Koonawarra, 8 Balarang Place3 BED 1 BATH 1 CAR

VIEW Sat 16 Feb 10-10:30am

PRICE $300,000 - $320,000

CONTACT Jeremy Tillman 0418 244 601 jeremy@prddapto.com.au

Best in show

Looking to enter the market but tired of seeing run down & neglected properties? Then take a look at this home. A unique style with high ceilings in the living room this home has a lot of character. Great 2nd living area so the kids can have their own space, fire place & air-conditioning for comfort all year round & dine off the back deck in summer. This home also backs onto a reserve so the kids have an extended playground to play in. Great street, next to a great school. Are you after an investment property? Well you are in luck! We already have an A grade tenant in this home paying $340pw. So if it is your first home or an investment property that you are after, then this is the home for you.

Dapto, 88 Parkside Drive3 BED 1 BATH 1 CAR

VIEW Sat 16 Feb 10-10.30am

PRICE $310,000 - $340,000

CONTACT Tracey McDonald 0404 033 533 tracey@prddapto.com.au

Hidden Beauty

Do you want something new? Then check this out! Situated in beautiful and leafy Penrose Estate this home is set back off the street, with no rear neighbours and offers all the luxuries of buying new without the price tag. Recently renovated the buyers of this home will get brand new carpet, freshly painted walls and roof tiles, new blinds, new bathroom, modern kitchen, brand new deck over looking a private and level backyard and a new garage. Have you seen many fully renovated properties for sale recently under $350k........ No?...... then I suggest you arrange to inspect this property now, as a property fully renovated like this home won’t take long to sell.

Dapto, 27 Melalueca Ave3 BED 1 BATH 1 CARImpressively Renovated

NEW LISTING

NEW LISTING

NEW LISTING

Looking for the wow factor? We have it! This home has recently undergone renovations & a massive face lift making this the perfect home to entertain family & friends. Cook up a storm for guests in the spectacular kitchen and entertain them either inside in the huge air-conditioned family room or outside under the massive 13 x 4 metre entertainment area. Your guests will be blown away by the stylish bathroom with his and her sink and create your own private retreat out the back with a good sized level yard for you to do what you like. With a remote control double garage this home truly does represent great buying. Located in a beautiful wide street close to the local shops, you would be crazy not to insepct

Horsley, 38 Ritchie Cres3 BED 1 BATH 2 CAR

VIEW Sat 16 Feb 11:40-12:10pm Thur 14 Feb 5- 5:30pm PRICE $390,000 - $410,000

CONTACT Tracey McDonald 0404 033 533 tracey@prddapto.com.au

Stunning Entertainer

VIEW Sat 16 Feb 12:30-1.15pm Tues 19 Feb 5.20 - 5.40pm

PRICE $320,000 - $350,000

CONTACT Tracey McDonald 0404 033 533 tracey@prddapto.com.au

76 Kanahooka Road Kanahooka

CALL 4261 3333 www.brooksterrace.com.au

Lakeside Living with a Slice of History Boutique estate of just 81 elevated lots Sizes ranging from 450m2 - 831m2

Uninterrupted views to Lake Illawarra Perfectly positioned for fishing, kayaking,

sailing, golf, cycling, walking and tennis Walk to the nearby childcare centre,

primary schools and high schools House & Land Packages available

* On selected lots. Conditions apply. ‡ Exclusive offer to purchasers at Brooks Terrace Land Development Kanahooka. Normal IMB lending criteria, terms and conditions apply. Limited time only. IMB Ltd. ABN 92 087 651 974. AFSL/ACL 237 391

Preferred Finance PartnerExclusive‡ finance package available

Call 133 462 for more informationPhone: 02 4261 3333 Mobile: 0408 424 474

Contact Greg Pollard

For the next 10 lucky buyers*First home buyers

get extra $15k

14 February 2013 63

4261 0333www.prddapto.com.au Sell Smarter

Brownsville, 2/13 Prince Edward DriveA great opportunity is here for the taking, get your foot on the property ladder & enjoy all that this unit has to offer. Featuring 2 good sized bedrooms, a new kitchen plus a good sized living area. Inspect today.

Why over extend yourself

2 BED 1 BATH 1 CAR

VIEW By AppointmentPRICE $175,000 - $195,000CONTACT Jeremy Tillman 0418 424 474 jeremy@prddapto.com.au

Horsley, 7 Yeldah DriveOne look is all you will need to realise this is a great home, well designed & located in a quiet area of this highly sought suburb. Featuring 3 bedrooms, 2 living areas, very well appointed kitchen & bathroom and double garage with internal access.

Great Home - Perfect Location

VIEW By AppointmentPRICE $387,000CONTACT Greg Pollard 0408 424 474 greg@prddapto.com.au

3 BED 1 BATH 2 CAR

Dapto, 12 Unara Road A location that is hard to find is right here for the taking, Stroll on level ground to all that Dapto Mall has to offer or mosey to the Train Station and take a short trip. This home is well appointed and has been renovated throughout.

CBD Convenience

VIEW By Appointment PRICE $335,000 - $365,000CONTACT Jeremy Tillman 0418 424 474 jeremy@prddapto.com.au

VIEW By Appointment PRICE $300,000 - $330,000

CONTACT Jeremy Tillman 0418 244 601 jeremy@prddapto.com.au

Horsley, 33 Sierra Drive3 BED 1 BATH 2 CAR

This very neat three bedroom family home, main with built-in wardrobe is located in a convenient Horsley location. Simple yet open makes for a great home just ready and waiting for your personal touch. With no rear neighbours the sense of space is stunning and won’t disappoint. Inspect today

Enter the market today VIEW Sat 16th Feb 11 - 11:30am PRICE $595,000

CONTACT Greg Pollard 0408 424 474 hreg@prddapto.com.au

Haywards Bay, 19 Riverside Drive5 BED 1.5 BATH 2 CAR

Rare opportunity to purchase this stunning former Clarendon Show Home that has been designed, built & completed to a very high standard. Featuring unique floor plan spilt over 3 levels including large formal & casual entertaining areas, alfresco dining, seperate downstairs rumpus, 4 bedrooms, master with ensuite, private study and large double garage with internal access. With only the best of fittings throughout including ducted air conditioning plus fully lanscaped yards & gardens really complete this superier home

Superier in every way

3 BED 1 BATH 1 CAR

Cordeaux Heights, 14a Murrogun CrescentDon’t settle for a tiny 400m2 block when you could purchase a block almost 3 times the size, for less than a 400m2 block. This 1189m2 block with a huge frontage has an amazing outlook over Cordeaux Heights & beyond.

1/4 Acre Block

VIEW By Appointment PRICE $165,000CONTACT Tracey McDonald 0404 033 533 tracey@prddapto.com.au

LAND LAND LAND

recent valuation!Selling for less then the most

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

Stunning single level/open plan residence on over 2 acres of usable land with views over pastureland. Only 5 yrs young, located in a rural/residential Estate yet only mins to all facilities. The homestead itself is over 40 squares of luxurious living. 4 spacious bedrooms, the master having WIR, large ensuite with Caesarstone bench tops, double shower with top of the range fixtures & fittings. From the light filled entry foyer through to either the study/office or formal lounge room. Flowing out to the kitchen with Caesarstone bench tops, glass splash backs along with the breakfast bar. With top of the range stainless steel appliances including dishwasher & spacious pantry. Both kitchen & formal dining areas over look farmland.

LJ Hooker Dapto4261 344464 Princes Highway

For Sale Expressions Of Interest

View Saturday 11:00am-12:00pm

Contact Sharon Horner 0402 844 636

4 bedrooms plus study, 2 bathrooms, 3 living areas, triple garage & American barn!

Informal lounge room is adjacent the kitchen/dining areas. Double sliding doors & large windows capture the lake views. An awesome theatre room situated off the main living areas. The bedrooms located through the wide hallway with opulent main bathroom & laundry. Internal access to the triple garage, the land having double side access. The main residence has town water + a 5,000 ltr rain water tank, barn having a 10,000 ltr rain water tank. The property also offers an American barn, 15 x 11m currently set up for the discerning equestrian with 3 stables having concrete floor, electricity & water, shower & WC. With 2 roller doors front & rear. The land is divided into 4 paddocks with water to all. Along with flood lit 20 x 60 Dressage arena, it’s a horse lovers dream come true.

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $325,000-$340,000View Saturday 1:15pm-1:45pmContact Sharon Horner 0402 844 636

THREE BEDROOM RESIDENCE WITH FULL DA FOR 2ND DWELLING..- 3 bedroom existing residence with large balcony off lounge room.- Timber deck out the back along with grassy courtyard. - Under the house has 2 car spaces.- Front and rear lane access.- Live in the existing house whilst you build your dream home, then rent out the other.- Full plans available on request.

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $320,000View Saturday 10:00am-10:30amContact Sharon Horner 0402 844 636

Light filled & spacious 3 bedroom residence with separate granny flat. 620m2 level block in quiet cul de sac. Spacious lounge room with timber floors, new vertical blinds, fan, air conditioning & gas heating. Very neat separate kitchen. Renovated bathroom, 2 of 3 bedrooms have BIW’s. 1 bedroom detached granny flat with lounge room, separate timber kitchen, separate bathroom & fold back sliding glass doors from the main lounge that opens out onto the entertaining area.

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $950,000-$980,000View Saturday 12:30pm-1:00pmContact Sharon Horner 0402 844 636

- Stunning four bedroom plus studyresidence on level 5532m2 allotment- Two spacious living areas plus formaland informal dining area- Huge full length sunny verandah- Gourmet kitchen- Professional stable complex- Inground pool with pergola- Side and rear access- Potential to sub-divide- So much more...

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $350,000-$370,000View Saturday 1:00pm-1:30pmContact Daniel Lambert 0468 944 961

Immaculately presented, this functional home will be the envy of family and friends. Including tranquil gardens and undercover entertaining area out the back leading to the huge modern four car garage, perfect for the car collection and plenty of room for a workshop. Separate under house storage, ideal for the handyman. Very tidy internally with three bedrooms all good size and very tasteful. Large bathroom and recently updated including spa bath. Follow the staircase to a retreat, study or 4th bedroom, a peaceful space you will enjoy.

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $579,999View Saturday 1:00pm-1:30pmContact Patrick Ciocca 0405 373 916

Positioned on the high side of the road is this stunning four bedroom residence. Offering side access and a great size yard for the family and kids to enjoy. Internally you will find four bedrooms with built-in wardrobes and the main bedroom with ensuite and walk-in wardrobe. Also offering three living areas, fantastic size separate kitchen and dining room and large double garage. Enjoy your weekends only minutes to shops and Shellharbour Village.

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale Offers Over $720,000View Saturday 11:45am-12:15pmContact Patrick Ciocca 0405 373 916

This solid brick home is set back from the road on a large block and offers:- Five good size bedrooms- Two bathrooms, one recently renovated to an exceptional standard.- Two kitchens, one recently renovated with all the modern appliances.- Two large living areas- Double garage- Popular location with excellent views.

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $465,000View By AppointmentContact Patrick Ciocca 0405 373 916

On the high side of the road is this renovated block of flats.Both flats upstairs are mirror reverse with a private entry foyer to the combined kitchen,dining & lounge area, which have renovated kitchens. The b/rooms are a very good size & offer WIR’s & renovated bathrooms. The 2 top flats have a shared laundry & storage room with a private fenced yard & ent deck. The flat downstairs offers an internal laundry,sep kitchen & combined lounge & dining.There is allocated off street parking for all flats. Rental return of $540 p/w.

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $380,000-$400,000View Saturday 12:00pm-12:30pmContact Daniel Lambert 0468 944 961

Architecturally designed with an open split level, this impressive home is an entertainers haven. Three bedrooms and an exquisite bathroom with double shower on the upper level and kitchen, living and dining on the lower level. Follow through to a resort style entertaining deck with spa overlooking the private and landscaped pool. Internal access to the lockup garage with open ceiling for storage. Also including under house storage, be impressed and call to inspect.

1

Light & airy residence on 638m2 block. With brand new bathroom, modernised kitchen, high ceilings, polished floors & large windows. All 3 bedrooms are spacious & have BIW’s. There is a carport & a large shed. Currently leased for $360 p/wk.

LJ Hooker Dapto 4261 344464 Princes Highway

Investor or First Home Buyer

For Sale $309,000View Saturday 10:45am-11:15am Contact Patrick Ciocca 0405 373 916

1

This brand new home is on its way to completion. With 4 bedrooms with BIW’s, main with WIR & ensuite, open family, dining & kitchen areas, a covered ent area, a games/theatre room, 4 car garage, 4th toilet & under house storage.

LJ Hooker Dapto 4261 344464 Princes Highway

Under Construction

For Sale Offers Above $580,000View By Appointment Contact Patrick Ciocca 0405 373 916

1

Privately situated vacant land ready to build on. 740m2 & DA approved for a modern home. Enjoy the privacy of this battleaxe block with sweeping northern views in an established neighbourhood surrounded by prestigious homes.

LJ Hooker Dapto 4261 344464 Princes Highway

DA Approved Dream Home

For Sale Offers Above $165,000View By Appointment Contact Daniel Lambert 0468 944 961

1

Light & bright unit in a quiet, quality complex. Offering a separate kitchen, lounge room with a/c & fan & a sunny balcony off the lounge room. Both bedrooms have BIW’s & fans. Also offering a car space & currently leased at $250 p/wk.

LJ Hooker Dapto 4261 344464 Princes Highway

It Ticks All The Boxes

For Sale $179,000View By Appointment Contact Sharon Horner 0402 844 636

1

This beautifully appointed home has had loads of work done. With an open plan dining, 2nd family area & galley style kitchen. 3 of the 4 bedrooms boast BIW’s. Externally, a good size yard, covered ent area & a sparkling in-ground salt water pool.

LJ Hooker Dapto 4261 344464 Princes Highway

Renovated Family Home

For Sale Reduced to $339,000View Saturday 10:00am-10:30am Contact Patrick Ciocca 0405 373 916

1

With breathtaking views, 40 solar panels, water tank, an Independent bio-cycle sewerage system, the homestead has full federation/bull nose verandah, 4 bedrooms plus study, 2 bathrooms & two living areas & a double garage.

LJ Hooker Dapto 4261 344464 Princes Highway

Get Back To Nature - Eco Friendly 13 Acres

For Sale $850,000View By Appointment Contact Patrick Ciocca 0405 373 916

1

Located in a new land subdivision and offering arguably the best views Dapto has to offer. This tidy 720.8m2 building block with no easements or restrictions on the land will offer the flexibility to build the home you want.

LJ Hooker Dapto 4261 344464 Princes Highway

Great Buy!

For Sale $142,000View By Appointment Contact Patrick Ciocca 0405 373 916

1

Premier building parcel ready to build your dream home with an expansive and beautiful backdrop. A large 762m2 near level lot highly sought after and to be surrounded by prestigious homes.

LJ Hooker Dapto 4261 344464 Princes Highway

Premier Building Block

For Sale $349,000View By Appointment Contact Daniel Lambert 0468 944 961

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

LJ Hooker Albion Park Rail4256 3344195 Princes Highway

This home is simply amazing, the size alone is sure to impress anyone. The home is of a split level design with multiple living areas, Fully ducted A-C, 5 bedrooms are double in size (master is huge), Modern bathrooms, Ultra modern kitchen with walk in pantry and great vision to the back yard. On the lower level there is a down stairs rumpus and storage (Currently used as home day care) with laundry and toilet facilities, Large double garage which has access to the large 6 x 4 metre workshop all with internal access.

For Sale$659,000

ViewSat 16th Feb 11.30am - 12.30pm

ContactCraig Hyde 0404 497 521

32

1

LJ Hooker Albion Park Rail4256 3344195 Princes Highway

Enjoy the relaxed beach lifestyle with this property located only a hop, skip & a jump from Warilla beach. Immaculately presented & offering an abundance of space. Featuring Main bed with w.i.r & ensuite, multiple living areas, practical kitchen located in the heart of the home making entertaining a breeze & garage with drive through access. The 4th bedroom is located in a self contained retreat with kitchenette, bathroom and living area. This would be perfect for any teenager or elderly parents. The options are endless.

For Sale$629,000

ViewSat 16th Feb 1pm - 2pm

ContactCraig Hyde 0404 497 521

32

1

1

2LJ Hooker Albion Park Rail 4256 3344195 Princes Highway

For Sale $499,000View Sat 16th Feb 10.15am - 11amContact Craig Hyde 0404 497 521

All the hard work has been done for you so you can come home to this brand new Allworth built home and just enjoy life. The features are endless so much thought has gone into this home, Consisting of 3 living areas, stunning kitchen with stainless steel appliances Incl Dishwasher, Tiled alfresco and 4 bedrooms - Main with ensuite & W.I.R. Floors are complimented with Bamboo flooring & carpet, Alarm system installed, Remote access to the double garage with internal entry.

1

2LJ Hooker Albion Park Rail 4256 3344195 Princes Highway

For Sale $449,000 EachView By Appointment OnlyContact Craig Hyde 0404 497 521

A stunning selection of 2 Torrens Title duplex properties which are currently under construction. Each residence has been thoughtfully designed featuring 3 great sized bedrooms, main with ensuite and walk in robe, double garage, balcony at the rear and finished with quality inclusions.

Due for completion approx March 2013. Take advantage of the Government Grants on offer and concessions $$.

1

2LJ Hooker Albion Park Rail 4256 3344195 Princes Highway

For Sale $269,000View By Appointment OnlyContact Craig Hyde 0404 497 521

Presenting a superb investment opportunity. This home boasts a central position as it is just metres to shops and transport options. Situated on a level 600sqm block a home like this is hard to find. There is something here for all the family to enjoy including a cubby house that the kids will just love. This home features, 3 bedrooms (two with built in wardrobes) updated kitchen and bathroom, reverse cycle a-c unit and not to forget the oversized garden shed ready to store all your tools. Don’t miss out on this incredible opportunity.

1

LJ Hooker Albion Park Rail4256 3344195 Princes Highway

For Sale $220,000View By Appointment OnlyContact Craig Hyde 0404 497 521

Not very often does land like this come on the market with this much potential. Come and build your dream home or develop on this level block of land in Albion Park Rail. Offering a wide frontage of 19.55 Metres and a total land size of 777.8 Metre Square.

All these amenities at your door step....Public Schools, Train Station, Tennis Courts and Public reserve.

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

1

LJ Hooker Warrawong4274 0334Shop 3, 53-57 King Street

You will enjoy the glittering lights over Lake Illawarra and the sunsets closing onto the mountains. With four bedrooms your family will be comfortable with their own space, not to mention this cottage style home has two spacious living areas and if you still feel like getting away you can stroll down to the Lake for some water sports or a run along the foot path.

AuctionOn-site 1:30pm 16th March 2013*If not sold beforehand

ViewSaturday 1:00pm to 1:30pmljhooker.com.au/91GGMH

ContactDusko Vasileski 0411 713 523

This is your chance to grab an opportunity of a lifetime...

1

2LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

Auction 2nd March 2013, On-site 12:30pmView Saturday 12pm to 12:30pmContact Dusko Vasileski 0411 713 523

You read it right... The families have decided it’s time for the family home of over 50 years to go on the market,they hope it gives the next family a life time of memory as it has for them.

So now is the time for the new family to dust off the power tools and bring out the paint brushes and restore this family home to its former glory, or if you like you can start fresh and knock down and rebuild the choice is yours.

1

This beautifully hidden gem is a home that cannot be over seen. Upon entering this original cottage style home you will feel right at home, boasting gorgeous original ornate 10 foot high ceilings, cypress pine polished floorboards, newly installed kitchen and much more to list.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

For Sale Offers Above $325,000View Saturday 10:00am - 10:30am Contact Dusko Vasileski 0411 713 523

1

Fully renovated with 3 bedrooms, cosy lounge room with combustion fireplace, light filled timber kitchen and dining room and the ultimate workshop/man house with triple car garage, high ceilings, bathroom and separate living area.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

The House That Just Keeps Giving...

For Sale Offers Above $500,000View Saturday 2:30pm - 3:00pm Contact Dusko Vasileski 0411 713 523

1

2LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

Auction 2nd March 2013, On-site 3pmView 2:30pm to 3pmContact Dusko Vasileski 0411 713 523

This spacious and modern villa offers three bedrooms, all with built-in wardrobes, the main bedroom includes an ensuite and it also has a single remote control garage.

The villa is in a quite block and only 150m approx to the white sands of Thirroul Beach.

The villa is located just a short distance to railway, shops, parks and bowling club.

1

Situated right at the end of a quiet cul-de-sac street is where you will find this neat and tidy 3 bedroom home, which is an ideal start for the young family or that first investment property.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

For Sale $259,000View Saturday 11:00am - 11:30am Contact Dusko Vasileski 0411 713 523

1

You’ll love the way this home has been renovated with fabulous timber floors, wonderful colour schemes and a sensational open plan living. The chef in the house will just adore the spacious timber kitchen with Island.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

For Sale $295,000View By Appointment Contact Dusko Vasileski 0411 713 523

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

LJ Hooker Wollongong4229 105568 Market Street

• R2 Low Density Residential zoning, total combined land size approximately 1,257m2

• 107 The Avenue - 739.8m2 block with 24.3 metre frontage, possible duplex site subject to council approval

• 109 The Avenue - 518.1m2 block comprising a 3 bedroom house, garage and shed

• Ideal opportunity for dual family living side by side - not together!

AuctionOn Site Saturday 2nd March at 11am

ViewSaturday 16th February 2.30 - 3.00pm

ContactMarnie Oppenauer 0421 039 659

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $575,000View By AppointmentContact Marnie Oppenauer 0421 039 659

Glorious mountain views from this double brick home sited on 870sqm allotment in a cul-de-sac location. North facing backyard hosts pool, fully fenced with terraced lawn. Freshly painted home with new flooring and 2 brand new bathrooms! Custom designed kitchen, black granite benchtops. Raked cathedral ceilings in open plan living opening onto balcony via glass sliding doors. Downstairs to rumpus room plus internal laundry.

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $315,000View Saturday 9th February 10am - 10.30amContact Phil Oppenauer 0408 422 864

Room to move in this spacious first floor 2 bedroom apartment. Security intercom entry, separate entry hall and large open plan lounge opening to north facing balcony. Separate tiled dining area adjoining laminate kitchen. Built in mirrored robes in both bedrooms, additional balcony off main bedroom. Separate bath plus shower in bathroom. 2 toilets and internal laundry with dryer. Lock up garage in basement via security roller door. A real CBD location!

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $499,900View Saturday 16th February 1:30 - 2:00pmContact Marnie Oppenauer 0421 039 659

Brand new with the WOW factor! Contemporary master built Torrens Title residence on easy care 380m2 allotment. Quality construction & design with large open floorplan showcasing top of the range Rosewood floors, high ceilings & state of the art kitchen with ceasarstone benches and stainless steel appliances. North facing glass sliding doors onto the undercover alfresco terrace and lawn. $15,000 grant with stamp duty concessions for first home buyer, $5,000 grant for all other buyers!

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $585,000View By AppointmentContact Marnie Oppenauer 0421 039 659

2nd floor position, one block back from Cliff Road! Huge undercover terrace with views. Large dining area adjoins the white polyurethane kitchen with black granite benchtops, gas cooktop & dishwasher. Open plan air cond. living area, bigger than most! Master bedroom with ensuite & walk-in robe, additional bedrooms open onto own balcony with escarpment views. Video camera entry, lift access & double lock-up garage in basement. Currently leased at $530pw (expired).

1

Dual occupancy with potential to subdivide (Subject to Council Approval). Level 653m2 allotment- 2 free standing, 2 bedroom homes with shared double garage. One being leased as professional rooms, the other as residential. Leased at $32,300pa.

LJ Hooker Wollongong 4229 105568 Market Street

For Sale $512,000View By Appointment Contact Phil Oppenauer 0408 422 864

1

In a small well maintained block of only 6, set well back from the street; just 4 blocks from Uni. Hesitate & you´ll miss out on an excellent investment purchase or ideal first home. Remodelled kitchen & bathroom plus internal laundry. Mirrored built-in robes in both bedrooms.

LJ Hooker Wollongong 4229 105568 Market Street

For Sale $285,000View Saturday 16th February 11:00 - 11:30am Contact Phil Oppenauer 0408 422 864

1

Situated in new bushland cul de-sac amidst other new homes. Unusually shaped approx 805sqm building block with approx 404sqm building envelope. A 20 metre frontage (approx) will offer a site suitable for a variety of homes.

LJ Hooker Wollongong 4229 105568 Market Street

AFFORDABLE HOME SITE

For Sale $249,500View By Appointment Contact Phil Oppenauer 0408 422 864

1

A must see if you are on a tight budget... this 2 bedroom unit has new kitchen with polished timber floors, wall oven & dishwasher. Good sized lounge & fully renovated bathroom/int laundry. Front unit in a well maintained block.

LJ Hooker Wollongong 4229 105568 Market Street

Renovated 2 Bedroom Unit With Car Space!

For Sale $225,000View By Appointment Contact Phil Oppenauer 0408 422 864

wollongong

3500 007yourrealestatename.com.au64 Flinders Street, Wollongong 4226 6772www.teamsold.com.au

l

ll

l

Robert Dimovskim:e:

Open: Address: View Online: Wollongong Office:

ll

l

lll

OPEN HOUSE

234

Robb Grubbm:e:

Open: Address: View Online: Wollongong Office:

3

4

3

OPEN HOUSE

Robb Grubbm:e:

Open: Address: View Online: Wollongong Office:

2

3

1

OPEN HOUSE

Robert Dimovskim:e:

Open: Address: View Online: Wollongong Office:

1

3

1

OPEN HOUSE

Robb Grubbm:e:

Open: Address: View Online: Wollongong Office:

llll

lll

OPEN HOUSE

Robert Dimovskim:e:

224

Robb Grubbm:e:

Open: Address: View Online: Wollongong Office:

4

3

1

OPEN HOUSE

Robb Grubbm:e:

Open: Address: View Online: Wollongong Office:

2

3

2

OPEN HOUSE

Saturday 11.00 - 11.30am

Saturday 1.30 - 2.00pm

Joshua Kersten 0419 991 500

Kayla Watchorn 4229 9600

View

Agents

39 Valley Drive, FigtreeDeceivingly Unique

4 2

• Immaculate & well presented home that has more than meets the eye

• Architecturally design tri level home , modern gourmet kitchen adjoins the

open plan living area with cosy gas log fire & raked ceilings.

• Main bedroom with ensuite & walk in robe, all other bedrooms with BIWs

• A huge family room flowing out to a undercover entertainment area

• Complete with rear lane access, this has everything you’ve been looking for!

R&H Wollongong 4229 9600

Price $499,000 - $529,000

rhw.com.au

R&H Wollongong 4229 9600

View

Agents

rhw.com.au

rhw.com.au

1 Sherwood Place, ShellharbourWalk to the Beach from Here• 3 bedroom family home with ensuite & BIWs• Split level design with separate lounge • Enclose courtyard, ideal for entertaining• Double garage under + workshop • Only a short walk to shellharbour beach

3 2 4

Saturday 12.15 - 12.45pm

Joshua Kersten 0419 991 500Kayla Watchorn 4229 9600

Offers above $400,000

Bring the right people through your doorAt Raine&Horne finding the right match is our speciality!

Old Saddleback Rd, Kiama

Shauna Crescent, Mount Keira

Carters Lane, Fairy Meadow

Old Saddleback Rd, Kiama

Ocean Street, Windang

Atchison Street, Wollongong

Rann Street, Fairy Meadow

& all sold Jan 2013

Joshua0419 991 500

Kayla0424 503 316

Illowra Cres,Primbee

Bourke St,North Wollongong

If you’re thinking of sellingNow is the perfect time!

Mathew0419 768 412

Alex0416 006 225

R�H Austinmer 4268 1399

3/43 Mountain Road AustinmerWhat a Villa in Austi!´Rarer then hen´s teeth´, retirees & new families; walk to station, shops & beach; immaculately maintained; great features: air cond; courtyard; seaside weekender.

View Sat 2.30-3.00pmPrice $499,000Agent Lisa de Ruyter 0438 684 014

2 1 1

raineandhorne.com.au/austinmer

New O

pen Satu

rday

R�H Austinmer 4268 1399

74 Mountain Road AustinmerPanaramic Views � AcreagePerched at the end of Mountain Road in an elevated position, this 2.89acres boasts panoramic views of ocean & coast line. Huge potential, one off opportunity.

View Sat 10.00-10.30am, 3.00-3.30pmAuction 23rd February 10am On SiteAgent John McGuiness 0402 021 527

3 2 1

raineandhorne.com.au/austinmer

Auction O

pen

Saturd

ay

R�H Austinmer 4268 1399

10 Foothills Road AustinmerFamily Home in Quiet StreetOpen plan living/dining with bi-fold doors flowing to covered outdoor area with fireplace & overlooking inground pool. Modern kitchen. Distant ocean views.

View Sat 11.30am-12.00pmAgent John McGuiness 040 2021 527

4 3 1 1

raineandhorne.com.au/austinmer

New O

pen Satu

rday

DGBlawyers

Lorrelle Longbottom

Looking forward to assisting youwith all of your property needs

14 February 2013 75

1Immaculately presented with a flowing floor plan, more a villa then a town house. This split level design with minimal stairs offers an open plan lounge/dining, kitchen and internal laundry.

The garage has been converted to a rumpus with workshop at rear with a large courtyard. Positioned at the rear of block ensures privacy. He who hesitates will miss out.

Open 16th Feb 10:00 - 10:30am

4/16 Popes Road, Woonona $339,000 2 1 1

1Ideally positioned to schools,shops and transport. This solid 3 bedroom brick veneer and tile home has much to offer and includes:

Ducted air con, large lounge, separate dining area, rear rumpus, sunroom, 2nd shower, spacious laundry and covered outdoor area with rear storage sheds. Complete with double lock up garage with single remote access.

Immaculately Presented

251 Kanahooka Drive, Kanahooka $379,000 3 2 2

1Exceptional villa in quiet block of 4 offering wheelchair access. Bedrooms with built in robes, two large bathrooms with spa in main and spacious lounge.

Bright and sunny rear courtyard and garden complete with double carport. Strata - $519 p/q, Council - $290.40 p/q, Water - $181.51 p/q, Rent - $340p/w.

Plenty to Offer

2/10 Owen Park Road Belambi $349,000 3 2 2

Corporate fit-out and well located at the eastern end of Crown Street in a quality building. At your fingertips are good restaurants, cafes, public transport and central to the commercial precinct.• 501m² of A-Grade commercial office space with basement car parking available• Office fit out will remain at request including all IT and Communication infrastructure• Featuring boardrooms, open plan offices and full kitchen/breakout area• Lift and approved stair access from ground floor available• Wollongong CBD location near all major amenities • Close proximity to Wollongong Mall & entertainment precinct

Leasing Opportunity

WHERE: LEASE: Suite 201 / 53-61 Crown Street Wollongong $ 175,350 per annum + GST

AGENT: CONTACT:Colliers International - 4222 7222 Jarrod Hulse - 0414 253 763

WOLLONGONG

FEATUREPROPERTIES

42576444Albion park Shellharbour

42952000 rcre.com.au

21 Y E A R S O F E XC E L L E N C E

285 SOLD 2012

Thinking of Selling?We can help!

Make this the yearyou change your life

Have you been dreaming of building a spacious new home in a safe and friendly Stockland community? Now there’s even more reason to make this the year you change your life.

Buy a selected Stockland Home & Land package and you’ll receive $10,000* in Universal Visa gift cards to help furnish your dream home or to spend as you like.

This is made up of $5,000* from Stockland and a further $5,000* from selected partner builders. You can also choose to take the $10,000* as a discount off the value of your new Home & Land. But hurry, this attractive offer closes 25 February.

Make this the year you change your life with a great choice of Home & Land designed to suit you.

See more Home & Land packages at stockland.com.au/myyear/nsw

^ Prices correct as at 12 January 2013 and are subject to change without notice or obligation. Each Home and Land Package consists of land and a home which are sold separately. Stockland is only responsible for the sale of the land. Customers will need to enter into a separate contract with the relevant builder for construction of the home. Only selected Home and Land Packages are available as part of the promotion, and are only available until sold. Photographs and illustrations are for illustrative purposes only and exclusions may apply. *Each Buyer of selected Home and Land Packages forming part of the promotion may be entitled to receive Universal pre-paid gift cards from Stockland and the Builder totalling a value of $10,000. Entitlement to receive the Universal Gift Cards is subject to conditions and eligibility. Universal Gift Cards are issued by Heritage Bank Limited. ABN 32087652024. AFSL / ACL 240984. Visit www.stockland.com.au/change for full terms and conditions. †The First Home Owner Grant and any applicable transfer duty exemptions or concessions are Government initiatives and are not Stockland promotions. Eligibility and date restrictions apply. Please visit www.firsthome.gov.au for further information. STO0003/NSW/19/REW/FP

$15,000† First Home

Owner Grant

Sales and Information Centre Bayswood Avenue, Vincentia NSW 2540 (enter off Jervis Bay Rd)Phone: (02) 4443 2558 Open: Thursday – Sunday, 10am – 5pm

HAMILTON 2 BY MCDONALD JONES$349,750^

3 2 1 Lot 613367m2

Some features and landscaping excluded.

Sales and Information Centre 359 Bong Bong Road, Horsley 2530 Phone: Andrew or James on (02) 4260 8956 Open: 7 days, 10am – 5pm

PROTEA 1 BY NEW LIVING HOMES$335,055^

3 2 1 Lot 9121320m2

Some features and landscaping excluded.

Sales and Information Centre 359 Bong Bong Road, Horsley 2530 Phone: Andrew or James on (02) 4260 8956 Open: 7 days, 10am – 5pm

PARKROYAL BY MCDONALD JONES$448,250^

4 2 2 Lot 907495m2

Some features and landscaping excluded.

experience the possibilities®

IRT Links Seaside Open Monday – Friday, 9am – 5pmCall for more information, to make an appointment, or simply pop in.

At IRT Links Seaside everything is at your fingertips – all included in the price of your apartment.~Why would you live anywhere else?

T 1800 024 915 (Freecall) E customerservice@irt.org.au W www.irt.org.au youtube.com/IRTgroup facebook.com/IRTGroup twitter.com/IRTGroup

Where else can you find all this?

APARTMENT LIVING

Additional secure storage in basement ✓

Air conditioning ✓

Balcony / outdoor area ✓

BBQ ✓

Communal lounge area ✓Designer kitchens with Miele stainless steel appliances ✓

Emergency response button – bathrooms, bedrooms ✓

Fully maintained and landscaped tropical gardens ✓

Gas on balcony / outdoor area ✓

Golf buggy recharge and parking area ✓

Guest suite accommodation ✓Open-plan living designed to bring the outside in ✓

Over 55s only ✓

Outdoor BBQ communal area ✓Private conference / dining room for residents use ✓

Range of 2-bedroom, 3-bedroom and 3-bedroom penthouse apartments ✓

Security access to apartment towers ✓Security access to complex and nightly security patrols ✓

Secure car parking space ✓

LIFESTYLE SERVICES

Cards / Games room ✓Cinema ✓Friday night happy hour ✓Fully licensed Restaurant / Bar / Café ✓Gym ✓Internet kiosk ✓Library ✓Onsite beauty / day spa ✓Pool ✓Sauna ✓Tennis court ✓Veggie patch ✓

LOCATION LOCATION LOCATION

City living right on the city limits ✓Immediate access to Blue Mile cycle way ✓Immediate access to Wollongong Golf Club ✓Sweeping views over the ocean and along the Illawarra coast and escarpment ✓

ADDITIONALS

Access to Care Centre* ✓Access to In-Home Care* ✓Dedicated Community Manager – there for your every need ✓

NO Stamp Duty ✓

* Access to these services are based on availability and may incur additional fees and charges.~ Weekly recurrent fees are also charged as part of living at IRT Links Seaside.

IRT Links Seaside 1 Ross Street Wollongong

MY HOUSE MY HOME

STAIRS

For Advertising Enquiries, please call 1300 137 161

SKYLIGHT

REMOVALS

ANTENNAS

LOCKSMITH

BUILDING

T T

Complete Locksmithing Service

Wollongong 32 Flinders St – 4226 6644

All types of Locks sold & fitted Sales & Service agents for

CMI Safes & Assa Abloy Security Master Lic. 410183663

Quick As AGUNN ANTENNA

SERVICEProfessional & Reliable

• Free Quotes • Fully Guarantee• 24 Years Experience • Extra Points• Repairs• Insurance Work All Areas• New & Upgrade Antenna Systems• Seniors Discounts• House & Strata Units Insulation

Same Day Service

available

4257 8452 Shellharbour

4284 6587 Wollongong

To advertise your business here,

Call us on

1300 137 161

• Supply and fit timber stairs • balustrading and handrails using timber, metal, stainless steel & glass.

We can also “supply only” somematerials upon request and availability.

Visit our ShowroomOpen 1pm - 4pm Mon - Fri or by appointment

80 Towradgi Rd, Towradgi

www.southernstairs.com.au

Ph: 4283 1522 | Fax: 4283 1488

®

4285 9923www.suttleshades.com

Your Local Luxaflex Dealer since 1997

 

®

WINDOW COVERINGS

Reduce your Power Bill & pay less Carbon Tax!

Don’t be kept in the dark!

Phone your local distributor today for a free quote

THE ULTIMATE CONCRETETILE SKYLIGHT

PHONE 1800 475 954

CleartileSkylights

Matching the shape of your roofing

INTERIORSSell your property quicklyfor the best possible price!

Professionally styled homes spend less time on the market & gain a 6% higher sale price on average.

Property Styling | Furniture Hire | Interior Design

0409 673 720 | 0429 004 288www.interiorbiz.com.au

Call today for your solution to..

design & property stylingInteriorbiz

For clear expert advice or Free Quote call

4294-4716 | 0408 032 503• Local, Country and Interstate• Difficult access specialist water fronts• Barge access & right of ways• Pre packing, cartons• Assistance cleaning, car & pet transport• Storage & Insurance

Interest rate current as at 25th January 2013. Eligibility criteria, terms and conditions, fees and charges apply. WARNING: This comparison rate is only true for the example given and may not include all fees and charges. Different terms, fees, or other loan amounts might result in a different comparison rate. Illawarra Credit Union is a division of Community Alliance Credit Union Limited, Australian Credit Licence 245 576.

BLD

F485

Experience the difference. Great rates & fast, friendly service

Based on a loan amount of$150,000 over a term of 25 years

5.25%p.a.

fl ying start variable5.70%

p.a.comparison rate

Rate shown includes 1% discount, reverting to our Reward Rate which is 0.55% below the Standard Variable rate after 12 months for the remainder of the term. Available for new home loan business $250,000 or more

with 1% off our already low standard variable home loan rate for 12 months

Call us on 13 22 49

or visit your nearestIllawarra Credit Union branch

www.illawarracu.com.au

CUT HOME LOAN REPAYMENTS

YOUR

top related