creative safety supply catalog

1-866-777-1360

1-330-777-8818

[email protected]

www.creativesafetysupply.com

CONTACT US


We are the leadersin visual safety.For additional information about our products and services, please visit us online,or call us toll-free at 1-866-777-1360.

free guides

DOWNLOAD GUIDES NOW : www.creativesafetysupply.com

+ more

INSTANTDOWNLOAD

We offer many helpful guides covering a wide variety of common applications and facets of safety and lean programs. They are available for free download on our website as instant download PDF’s.

TABLE OF CONTENTS

Floor Marking

Label Printers

5S & Lean

Custom Signage

Safety

06 Industrial Floor Signs08 SafetyTac Industrial Floor Tapes15 Industrial Tape Application Tools16 Printable Industrial Floor Tape17 Smart Stripe Floor Tape18 Reflective Floor Tapes20 Glow in the Dark Tapes21 Traction (Anti-Slip) Tapes22 Vinyl Tapes24 Industrial Alignment Markers26 Overlaminate Tape Protection

28 LabelTac Printers31 LabelTac Printer Supplies40 LabelTac Printer Accessories42 Brady Printers44 Pre-Made Labels

58 Red Tags61 Tool Outline Vinyl61 5S Audit Scorecard62 Grids & Pegboards64 Custom Foam Organizers67 Lean DVD’s68 Lean Books69 Lean & Safety Posters70 5S & Lean Packages72 Lean Healthcare

74 Industrial Wall Signs76 Industrial Banners78 Custom Facility Branding79 Custom Fleet Graphics

82 Eyewash Stations83 Fall Protection84 Industrial Spill Kits85 Sorbent Mats86 Ergonomic Mats87 Safety Training Videos88 Lockout/Tagout90 Arc Flash Analysis Software91 Arc Flash Protective Gear92 Column & Post Protection93 Miscellaneous Safety

6 1-866-777-1360 1-330-777-8818 www.creativesafetysupply.com

Industrial Floor SignsPre-made / Customized / 100% CustomOur Floor Signs are printed in high resolution, full color, on an industrial grade vinyl and covered with an extra-durable, slip-resistant overlaminate protection. These signs are low-profile and designed to hold up in extreme industrial conditions and will withstand even heavy forklift traffic.

We offer a wide variety of useful pre-made Floor Signs, any of which can be customized with no additional change- or we can design a sign from scratch to your specifications for the same price as our pre-made signs.

CUSTOM SIGNSCustomize Signs For FREE

Ultra-High Resolution Print

Peel & Stick

Low Profile & Strong

We can use any text or graphics you like- or we can create a design for you at no extra cost.

Up to 1440 dpi printing ensures your text & images are as crisp as possible.

Signs come on a removable backing. Simply peel & stick to apply!

Our sign material is thinner than a credit card, but able to hold up to forklifts and other tough traffic.

Looking to modify one of our existing signs, or even create your own unique signs from scratch? Give us a call and we’d be glad to help.

We have a large selection of popular pre-made signs that are available in a number of sizes. See our commonly purchased signs on the next page, or view all our signs online at:

1-866-777-1360


PRE-MADE SIGNS

71-866-777-1360 1-330-777-8818 www.creativesafetysupply.com

POPULAR PRE-MADE FLOOR SIGNS

For a quote on an atypical size or shaped sign please contact one of our representatives at 1-866-777-1360.STANDARD SIZING & PRICING

TYPE A SIGNS

TYPE B SIGNS

Round/Square Signs

Rectangular Signs

VIEW OUR ENTIRE PRE-MADE SIGN SELECTION ONLINE : www.creativesafetysupply.com

12” - $15.00

16” - $25.00

18” - $34.00

20” - $40.00

24” - $57.00

28” - $75.00

32” - $90.00

12” x 9” - $15.00

24” x 18” - $45.00

30” x 21” - $59.00

36” x 27” - $99.00

58” x 32” - $169.00

5S RED TAGHolding Area

Standard STOPTYPE A

5MPH Speed LimitTYPE A

Eyewash StationTYPE A

FS-STOPBAS

FS-SPEED5M

FS-EYEWASH

Fire ExtinguisherTYPE A

Phones ProhibitedTYPE A

5S Red Tag Hold AreaTYPE B

FS-FIREDNB

FS-NOPHONE

FS-5SRDTAG

First Aid KitTYPE A

5S StepsTYPE A

Ped. Crossing - DashTYPE A

FS-FIRSTAID

FS-5SSTEPS

FS-TRPEDDS

This is a 6S AreaTYPE A

Elec. Pallet Jack Pkg.TYPE A

Keep Aisles ClearTYPE A

FS-6SAREA

FS-EPJPKYW

FS-CLRAISL

Trash CanTYPE A

Slippery When WetTYPE A

No Open FlamesTYPE A

FS-TRASHCN

FS-SLPWETC

FS-NOFLAME

Watch Out For ForkliftTYPE A

Tripping HazardTYPE B

PPE: Steel Toe Rq’dTYPE A

FS-FRKLIVE

FS-TRIPHZD

FS-PPESTLT


SafetyTac Floor TapeOur #1 Rated Industrial Floor Marking TapeThe days of using paint to mark aisles, pathways, and safety lanes are over! Industrial floor tapes are now widely regarded by both large and small companies alike to be the most effective, longest-lasting method for marking their warehouses and manufacturing floors.

Our customers put SafetyTac through the toughest tests on a daily basis: forklifts, trucks, heavy foot traffic, chemicals, greases, pallets - you name it - SafetyTac takes it all without blinking an eye, thanks to its tough material, adhesive, and dual-tapered edges.

Installing SafetyTac could not be easier- Simply peel back the liner and apply it to a clean dry surface. Once it’s down, just run over the tape with a tamper cart, forklift or other piece of heavy equipment to tamp it down, and you’re done! No more shutting down areas while you wait for paint to dry - or using valuable employee man-hours fooling around with messy paints in the first place.

SAFETYTAC VARIETIES

Our original, and best-selling industrial floor tape.

SafetyTac is durable and is ideal for use in virtually all applications, environments, and traffic levels.

Extremely strong, ultra-rigid composite material.

Its extra-dense construction allows SafetyTac ARMOR to be shatter resistant and useful where heavy forklift and industrial traffic cause problems for floor marking.

Engineered to resist wheel pivoting from forklifts and other industrial traffic.

More dense than original SafetyTac, EDGE is able to stay undamaged in areas where forklifts are making constant sharp turns.

SafetyTac GLOW is a glow in the dark variety of SafetyTac Floor Tape.

It is ideal for areas that can be dimly lit or for marking paths of emergency exits in case of power outage.

LEAN is a thinner, but still tough version of SafetyTac.

Approximately 50% thinner than original SafetyTac, LEAN is cost-effective and able to withstand most forklift and industrial traffic with ease.


2" x 100’ 3" x 100’ 4" x 100’ 6" x 100’

Yellow ST201 ST301 ST401 ST601

White ST202 ST302 ST402 ST602

Black ST203 ST303 ST403 ST603

Red ST204 ST304 ST404 ST604

Green ST205 ST305 ST405 ST605

Orange ST206 ST306 ST406 ST606

Blue ST207 ST307 ST407 ST607

Gray ST208 ST308 ST408 ST608

Purple ST209 ST309 ST409 ST609

Brown ST210 ST310 ST410 ST610

Clear ST211 ST311 ST411 ST611

PRICE $95.00 $125.00 $135.00 $185.00

Never paint your floors again. With SafetyTac Industrial Floor Marking Tape, you get bright, durable floor lines for aisles, walkways, safety zones & more that outlast painted lines and cheap vinyl tapes. SafetyTac features a tough PVC material with dual tapered edges that resists foot, forklift, and truck traffic, and is incredibly easy to keep clean.

Like SafetyTac, but features a hazard striped color pattern. These tapes are perfect for marking areas which require special attention.

hazard

2" x 100’ 3" x 100’ 4" x 100’

Black/Yellow STH270 STH370 STH470

White/Red STH271 STH371 STH471

White/Black STH272 STH372 STH472

White/Green STH273 STH373 STH473

PRICE $149.00 $169.00 $189.00

“

“

“

“

...Not only has SafetyTac kept us from having to paint our floors every 4-5 months like we had been doing for years- it was easier to put down, easier to clean, and just looks better on top of it all.

We have lots of traffic in our plant from employees as well as from our carts and forklifts. Our vinyl tape lines would be totaled in a couple months, whereas our SafetyTac tape has lasted more than 2 years and still going strong.

- Ricardo R., Maintenance & EHS

- Charles T., SVP of Engineering Operations

1-866-777-1360 1-330-777-8818 www.creativesafetysupply.com10

Work safer.Work smarter.

Mark aisles, pathways, safety zones, work areas and object locations with SafetyTac.

SafetyTac Industrial Floor Tape is the leading method of floor marking for any application- resistant to forklifts and other industrial traffic, SafetyTac is low profile and outlasts painted lines and cheap vinyl tapes.

Avoid costly workplace accidents, improve efficiency, and increase productivity.



2" x 40’ 4" x 40’

Yellow SA201 SA401

Red SA204 SA404

Green SA205 SA405

Blue SA207 SA407

PRICE $89.99 $149.99

New to the SafetyTac lineup, SafetyTac ARMOR was engineered to be the strongest, most resilient floor tape on the market. Featuring the same dual-tapered design as SafetyTac, ARMOR takes it to the next level with its dense, rigid, shatter-resistant material that makes it a perfect choice for facilities with extreme conditions, such as heavy equipment traffic and large industrial manufacturing plants.

Next-Level Floor Marking.SafetyTac ARMOR is the solution for facilities where other floor tapes just won’t hold up. SafetyTac ARMOR has the same strong adhesive and low profile design, but is made out of an ultra-dense material which is shatter-resistant and holds up to nearly all abuses, including extremely heavy objects falling on it, or forklifts spinning their tires on it.


SafetyTac EDGE was designed to combat a specific issue faced by many large facilities with forklifts- Tape and paint damage from forklifts spinning their tires directly on top of the lines. SafetyTac EDGE is made from a dense material which holds up under the stress of these tire-pivots, which can cause extremely high heat and pressure.

2" x 100’ 3" x 100’ 4" x 100’

Yellow SE201 SE301 SE401

White SE202 SE302 SE402

Black SE203 SE303 SE403

Red SE204 SE304 SE404

Green SE205 SE305 SE405

Orange SE206 SE306 SE406

Blue SE207 SE307 SE407

PRICE $105.00 $125.00 $145.00

Get the EDGE.SafetyTac EDGE resists forklift, cart and truck wheel pivoting better than paint or other tapes on the market. While all SafetyTac tapes are forklift-resistant, EDGE adds an extra level of protection in areas where these vehicles are constantly pivoting their wheels, which can cause damage over time.


2" x 100’ 3" x 100’ 4" x 100’

Yellow SL201 SL301 SL401

White SL202 SL302 SL402

Black SL203 SL303 SL403

Red SL204 SL304 SL404

Green SL205 SL305 SL405

Orange SL206 SL306 SL406

Blue SL207 SL307 SL407

Gray SL208 SL308 SL408

Purple SL209 SL309 SL409

Brown SL210 SL310 SL410

PRICE $65.00 $85.00 $105.00

Based on the same dual-tapered profile as our popular original SafetyTac Tape, SafetyTac LEAN offers a strong PVC tape about 50% as thick, but still resistant to industrial traffic, such as that from forklifts and hand trucks. Additionally it offers a lower price point than our other SafetyTac tapes, making it ideal for the very budget-conscious, and those looking to mark enormous facilities.

Keep a Low Profile.Thinner than a credit card, SafetyTac LEAN is the thinnest Industrial PVC Floor Tape on the market.

Don’t let its lean profile fool you though, this tape is extremely tough and holds up to all sorts of industrial abuse.

2" x 100’ 3" x 100’ 4" x 100’

Black/Yellow SLH270 SLH370 SLH470

White/Red SLH271 SLH371 SLH471

White/Black SLH272 SLH372 SLH472

PRICE $65.00 $85.00 $105.00

hazard

Made with a process that allows for an even lower profile than standard SafetyTac Lean. Hazard striped to highlight areas requiring extra caution.


SafetyTac GLOW is a glow-in-the-dark variety of SafetyTac which is white when in lighted conditions, but glows bright green when the lights go out. It is ideal for marking safety exit routes and areas which can be dim at times that also are subjected to forklift and heavy foot traffic. It glows visibly for several hours, and charges with natural or artificial light in under an hour.

Stay Safe- Even in the Dark.Getting out of a plant or facility in emergency conditions can be a scary reality. Often times evacuations are coupled with power cutoffs or outages, which can remove lights unexpectedly and leave employees in the dark. Avoid potential issues by lining emergency evacuation routes with SafetyTac GLOW and ensure everyone makes it out safely.

2" x 100’ 4" x 100’

GLOW “White” ST230 ST430

PRICE $145.00 $185.00

with every orderfrom us!

FREE


Our Industrial Tape Applicator assists with the application of all brands of Industrial PVC tape, including our popular line of SafetyTac tapes. It is particularly useful when applying 40+ rolls of tape.

Applicator is not needed/required for tape install, but can be helpful with very long runs, or large jobs.

Industrial tapes perform best when they are tamped down with at least 150lbs of pressure after they are applied. Some companies run a forklift, tow motor, or other industrial vehicle along the line- others choose to use tamper carts.

300lb.

PART # PRICE

SafetyTac Applicator C1INDAPPL $999.00

PART # PRICE

Tamper Cart TAMPERCART $499.00

A. SafetyTac Applicator

B. Industrial Tape Tamper Cart

A

B

For Tamper Cart rental details, please call us at 1-866-777-1360.

For SafetyTac Applicator rental details, please call us at 1-866-777-1360.

Rent a SafetyTacApplicator$50 per dayCall 1-866-777-1360for more information.


Keep your ESD areas labeled with this tough industrial floor tape, designed to hold up to industrial traffic and last in even the toughest environments. 11 varieties of message and symbols combinations are available. *** Minimum 3 rolls per order ***

To order Custom Inline Print Tape, please call us at 1-866-777-1360.

SafetyTac Industrial Floor Tape is available with custom in-line graphics, messages or logos. Customize your workplace with SafetyTac that is relevant to your environment. 100% smear-resistant. *** Minimum 3 rolls per order ***

Useful for creating floor tape with custom messages to warn against potential hazards, creating floor marking lines with your company logo embedded, or a host of other applications.

PART # PRICE

2" x 50’ ESD2-X $79.99

3" x 50’ ESD3-X $99.99

4" x 50’ ESD4-X $119.99

PART # PRICE

2" x 50’ STINLINE2 $85.00

3" x 50’ STINLINE3 $109.00

4" x 50’ STINLINE4 $130.00

A. Industrial ESD Floor Tape

B. Custom Inline Print SafetyTac Floor Tape

ESD TAPE STYLE OPTIONS

A

B

Made with

Like us on Facebook!fb.com/CreativeSafetySupply

Follow us on Twitter!@CreativeSafety

Into social media?Follow us for news, updates, specialoffers, and giveaways >


Smart Stripe Tape is a cost-effective, durable solution for your floor marking needs and will withstand heavy pedestrian traffic and normal warehouse equipment like forklifts and pallet jacks. This versatile tape isn’t effective on just floors- Use it anywhere you need to mark lines, whether it be walls, doors, or workbenches.

Smart Stripe Hazard Tape is a ‘hazard-striped’ version of our Smart Stripe Tape. It is commonly used for marking areas that require extra attention, especially areas that present the potential for injury.

A. Smart Stripe Tape

B. Smart Stripe Hazard Tape

A

B

.25" x 130’ .5" x 130’ 1" x 130’ 2" x 130’ 3" x 130’ 4" x 130’ 6" x 130’

Yellow SS02501 SS0501 SS101 SS201 SS301 SS401 SS601

White SS02502 SS0502 SS102 SS202 SS302 SS402 SS602

Black SS02503 SS0503 SS103 SS203 SS303 SS403 SS603

Red SS02504 SS0504 SS104 SS204 SS304 SS404 SS604

Green SS02505 SS0505 SS105 SS205 SS305 SS405 SS605

Orange SS02506 SS0506 SS106 SS206 SS306 SS406 SS606

Blue SS02507 SS0507 SS107 SS207 SS307 SS407 SS607

Gray SS02508 SS0508 SS108 SS208 SS308 SS408 SS608

Purple SS02509 SS0509 SS109 SS209 SS309 SS409 SS609

Brown SS02510 SS0510 SS110 SS210 SS310 SS410 SS610

PRICE $6.95 $8.95 $19.95 $29.95 $39.95 $49.95 $69.95

PART # PRICE

Black/Yellow 2" x 100' SSH270 $49.95

Red/White 2" x 100' SSH271 $49.95

White/Black 2" x 100' SSH272 $49.95

White/Green 2" x 100' SSH273 $49.95

White/Blue 2" x 100' SSH274 $49.95

Black/Orange 2" x 100' SSH276 $49.95


This durable 6mil vinyl floor tape is comparable to 3M 471 and 5700 style tapes and is perfect for marking areas with reduced lighting or visibility.

Reflective Floor Tape is rated for 7-Year Life, even outdoors. This tape has an aggressive adhesive that will adhere to almost any surface. and features a removable release liner making application easy. Not only for marking floors, this tape is fantastic for marking Dock Posts and other surfaces that require visibility in low light scenarios.

Similar in composition to our Reflective Floor Tape, but features a hazard-striped color pattern.

Hazard striped tape is typically used for sectioning off areas that require extra attention, such as areas that present health or safety risks as with areas around energized equipment, areas that present fall hazards, or areas that could be arc flash hazards.

A. Reflective Floor Tape

B. Reflective Hazard Floor Tape

A

1” x 30’ 1” x 150’ 2" x 30’ 2" x 150’ 3" x 30’ 3" x 150’ 4" x 30’ 4" x 150’

Yellow RF101S RF101L RF201S RF201L RF301S RF301L RF401S RF401L

White RF102S RF102L RF202S RF202L RF302S RF302L RF402S RF402L

Red RF104S RF104L RF204S RF204L RF304S RF304L RF404S RF404L

Green RF105S RF105L RF205S RF205L RF305S RF305L RF405S RF405L

Orange RF106S RF106L RF206S RF206L RF306S RF306L RF406S RF406L

Blue RF107S RF107L RF207S RF207L RF307S RF307L RF407S RF407L

PRICE $16.99 $39.99 $19.99 $79.99 $29.99 $119.99 $39.99 $156.99

2" x 30’ 2" x 150’ 3" x 30’ 3" x 150’ 4" x 30’ 4" x 150’

Black/Yellow RFH270S RFH270L RFH370S RFH370L RFH470S RFH470L

Red/White RFH271S RFH271L RFH371S RFH371L RFH471S RFH471L

White/Black RFH272S RFH272L RFH372S RFH372L RFH472S RFH472L

White/Orange RFH275S RFH275L RFH375S RFH375L RFH475S RFH475L

Black/Orange RFH276S RFH276L RFH376S RFH376L RFH476S RFH476L

PRICE $24.99 $119.99 $39.99 $179.99 $49.99 $236.99

B


Excellent choice for marking anything that requires a high level of nighttime visibility. High-intensity reflective design reflects over 4x more light than standard reflective tapes. Meets or exceeds ASTM D-4956-99 Type III.

High-intensity reflective design reflects over 4x more light than

color stands out in any lighting condition. Meets or exceeds ASTM D-4956-99 Type III.

Designed for use on trucks and trailers to provide a clear warning to oncoming motorists to help reduce accidents. Far exceeds NHTSA standards for marking vehicles. Tough, weather and solvent resistant- resists cracking around rivets.

A. “Really Brite” Reflective Tape B. “Neon Brite” Reflective Tape

C. Conspicuity DOT-C2 Tape

2” x 30’ 2” x 150’

Yellow RBRF201S RBRF201L

White RBRF202S RBRF202L

Red RBRF204S RBRF204L

Green RBRF205S RBRF205L

Orange RBRF206S RBRF206L

Blue RBRF207S RBRF207L

Black/Yellow RBRFH270S RBRFH270L

White/Red RBRFH271S RBRFH271L

PRICE $49.00 $198.00

A B

C

PART # PRICE

Hi-Vis Yellow 2" x 30' NBRF219S $109.00

Hi-Vis Yellow 2" x 150' NBRF219L $400.00

PART # PRICE

7” Red / 11” White 2" x 30' DOT711S $29.00

7” Red / 11” White 2" x 150' DOT711L $124.00

6” Red / 6” White 2” x 150’ DOT66L $124.00

All White 2” x 150’ DOTWHTL $124.00

PREMIUM REFLECTIVE

SURFACEAll tapes featured on this page have a special high-intensity honeycomb reflective finish similar to that of street signs. This finish provides the highest reflectivity available.


Get out safelywhen the lights go out.

A

keeping dim stairwells or other low-light areas safe for all employees. Lasts 6+ hours and charges in under 30 mins.

A. Glow-In-The-Dark Marking Tape

.5” x 30’ .75” x 30’ 1" x 30’ 1.5" x 30’ 2" x 30’ 3" x 30’ 4" x 30’ 6" x 30’

Glow “White” GLOW05S GLOW075S GLOW1S GLOW15S GLOW2S GLOW3S GLOW4S GLOW6S

PRICE $14.99 $21.99 $27.99 $43.99 $52.99 $73.99 $99.99 $159.99

.5” x 150’ .75” x 150’ 1" x 150’ 1.5" x 150’ 2" x 150’ 3" x 150’ 4" x 150’ 6" x 150’

Glow “White” GLOW05L GLOW075L GLOW1L GLOW15L GLOW2L GLOW3L GLOW4L GLOW6L

PRICE $59.99 $74.99 $119.99 $159.99 $199.99 $299.99 $399.99 $599.99

Combines the anti-slip properties of Traction Tape with the glow properties of Photoluminescent Tape. Lasts 8+ hours and charges in under 30 mins.

Made from the same strong material as our SafetyTac GLOW tape, these arrows glow brightly when your lights go out; whether it be in an emergency, or just in an area that requires extra visual cues when dim.

B. Glow-In-The-Dark Traction Tape C. SafetyTac GLOW Arrows

PART # PRICE

2” x 60’ TRAC230 $49.99

3” x 60’ TRAC330 $63.99

4” x 60’ TRAC430 $99.99

PART # PRICE

25 Pack STA30 $75.00

B C

Made with


Industrial Colored Traction Tapes are an effective way to offer visual warning of a slip and fall hazard while offering aggressive premium anti-slip factors. The tape adheres to most clean and dry surfaces.

A. Industrial Colored Traction Tape

A

2" x 60’ 4" x 60’ 6" x 60’ 12" x 60’

Yellow TRAC201 TRAC401 TRAC601 TRAC1201

White TRAC202 TRAC402 TRAC602 TRAC1202

Black TRAC203 TRAC403 TRAC603 TRAC1203

Red TRAC204 TRAC404 TRAC604 TRAC1204

Hunter Green TRAC205 TRAC405 TRAC605 TRAC1205

Orange TRAC206 TRAC406 TRAC606 TRAC1206

Blue TRAC207 TRAC407 TRAC607 TRAC1207

Gray TRAC208 TRAC408 TRAC608 TRAC1208

Brown TRAC210 TRAC410 TRAC610 TRAC1210

Clear TRAC211 TRAC411 TRAC611 TRAC1211

Hi-Vis Yellow TRAC219 TRAC419 TRAC619 TRAC1219

Black/Yellow TRACH270 TRACH470 TRACH670 TRACH1270

Red/White TRACH271 TRACH471 TRACH671 TRACH1271

PRICE $19.99 $39.99 $69.99 $189.99

Specially coated surface retains premium anti-slip factors, but allows floor to be mopped without grit catching mop fibers.

The foil carrier allows for excellent conformability and will hold its shape to most uneven or textured surfaces with an aggressive adhesive.

B

C

B. Mop-Friendly Traction Tape

C. Conformable Traction Tape

PART # PRICE

Black 2" x 60' MFTRAC203 $29.99

Gray 2" x 60' MFTRAC208 $29.99

White 2” x 60’ MFTRAC202 $29.99

PART # PRICE

Black 2" x 60' CFTRAC203 $54.00

Yellow 2" x 60' CFTRAC201 $54.00

Bk/Ylw 2” x 60’ CFTRACH270 $54.00

PART # PRICE

Black 3" x 60' MFTRAC303 $39.99

Gray 3" x 60' MFTRAC308 $39.99

White 3” x 60’ MFTRAC302 $39.99

PART # PRICE

Black 4" x 60' CFTRAC403 $99.00

Yellow 4" x 60' CFTRAC401 $99.00

Bk/Ylw 4” x 60’ CFTRACH470 $99.00

PART # PRICE

Black 4" x 60' MFTRAC403 $51.99

Gray 4" x 60' MFTRAC408 $51.99

White 4” x 60’ MFTRAC402 $51.99

PART # PRICE

Black 6" x 60' MFTRAC603 $155.00

Yellow 6" x 60' MFTRAC601 $155.00

Bk/Ylw 6” x 60’ CFTRACH670 $155.00


Comparable to 3M 471 vinyl tape. Promote organization and safety by identifying areas with this versatile vinyl floor marking tape. But don’t just stop at floors- this tape is perfect for marking racks, walls, equipment, lanes, and workstations- as well as 5S and general color coding.

A. 5S Multipurpose Vinyl Tape

B. Hazard-Striped Vinyl Tape

C. Checkered Vinyl Tape

.25" x 108” .5" x 108” 1" x 108” 2" x 108” 3" x 108” 4" x 108” 6" x 108”

Yellow V02501 V0501 V101 V201 V301 V401 V601

White V02502 V0502 V102 V202 V302 V402 V602

Black V02503 V0503 V103 V203 V303 V403 V603

Red V02504 V0504 V104 V204 V304 V404 V604

Green V02505 V0505 V105 V205 V305 V405 V605

Orange V02506 V0506 V106 V206 V306 V406 V606

Blue V02507 V0507 V107 V207 V307 V407 V607

Gray V02508 V0508 V108 V208 V308 V408 V608

Purple V02509 V0509 V109 V209 V309 V409 V609

Brown V02510 V0510 V110 V210 V310 V410 V610

PRICE $3.99 $7.99 $9.99 $12.99 $15.99 $18.99 $23.99

A

B

C

2" x 108’ 3" x 108’ 4" x 108’ 6" x 108’

Black/Yellow VCHK270 VCHK370 VCHK470 VCHK670

Red/White VCHK271 VCHK371 VCHK471 VCHK671

White/Black VCHK272 VCHK372 VCHK472 VCHK672

White/Green VCHK273 VCHK373 VCHK473 VCHK673

Yellow/Magenta VCHK277 VCHK377 VCHK477 VCHK677

PRICE $23.99 $32.99 $39.99 $49.99

2" x 108’ 3" x 108’ 4" x 108’ 6" x 108’

Black/Yellow VH270 VH370 VH470 VH670

Red/White VH271 VH371 VH471 VH671

White/Black VH272 VH372 VH472 VH672

White/Green VH273 VH373 VH473 VH673

PRICE $14.99 $17.99 $21.99 $27.99


our word...These are just a few companies who use and trust our industry-leading Lean & Visual Safety products and brands including LabelTac Printers, SafetyTac & Smart Stripe Tape.

All logos and trademarks are sole property of their respective companies or corporations. Use of these logos does not imply ownership or sponsorship.


Made from the same high quality material as our SafetyTac line of floor marking tape, these alignment markers are excellent for pallet location and other warehouse marking, as well as general 5S or equipment marking. Durable PVC material and superior adhesive make our SafetyTac Alignment Markers highly resistant to forklifts, pallet jacks, and other industrial floor hazards.

SafetyTac Alignment Markers

A

A

B

B

C

C

D

D

E

E

F

F

G

G

H

H

I

I

J

J

Rounded Corners

25/pack6” x 6” x 2”

Rounded Corners

25/pack6” x 6” x 2”

Rounded T’s

25/pack6” x 6” x 2”

Squared T’s

25/pack6” x 6” x 2”

Squared X’s

25/pack6” x 6” x 2”

Footprints

25/pack3.5 x 10”

Arrows

25/pack3.5” x 11”

Large Dots

25/pack3.5” dia.

Small Dots

25/pack2” dia.

Mini Corners

25/pack2” x 2” x .75”

Made with

Yellow STC01 STCQ01 STT01 STTQ01 STXQ01 STF01 STA01 ST3DOT01 ST2DOT01 STMC01

White STC02 STCQ02 STT02 STTQ02 STXQ02 STF02 STA02 ST3DOT02 ST2DOT02 STMC02

Black STC03 STCQ03 STT03 STTQ03 STXQ03 STF03 STA03 ST3DOT03 ST2DOT03 STMC03

Red STC04 STCQ04 STT04 STTQ04 STXQ04 STF04 STA04 ST3DOT04 ST2DOT04 STMC04

Green STC05 STCQ05 STT05 STTQ05 STXQ05 STF05 STA05 ST3DOT05 ST2DOT05 STMC05

Orange STC06 STCQ06 STT06 STTQ06 STXQ06 STF06 STA06 ST3DOT06 ST2DOT06 STMC06

Blue STC07 STCQ07 STT07 STTQ07 STXQ07 STF07 STA07 ST3DOT07 ST2DOT07 STMC07

Gray STC08 STCQ08 STT08 STTQ08 STXQ08 STF08 STA08 ST3DOT08 ST2DOT08 STMC08

Purple STC09 STCQ09 STT09 STTQ09 STXQ09 STF09 STA09 ST3DOT09 ST2DOT09 STMC09

Brown STC10 STCQ10 STT10 STTQ10 STXQ10 STF10 STA10 ST3DOT10 ST2DOT10 STMC10

PRICE $50.00 $50.00 $50.00 $50.00 $50.00 $50.00 $50.00 $50.00 $50.00 $50.00


Smart Stripe Tape Alignment Markers are a great option for marking warehouse and manufacturing facility floors. Made from our popular Smart Stripe material, these markers are ultra-low profile, so equipment rolls over them like they aren’t even there. Chemical, weather, water, and UV resistant.

Smart Stripe Alignment Markers

Made with

A B C D E F

Yellow White Black Red Green Orange Blue Gray Purple BrownSSC201 SSC202 SSC203 SSC204 SSC205 SSC206 SSC207 SSC208 SSC209 SSC210

SSC401 SSC402 SSC403 SSC404 SSC405 SSC406 SSC407 SSC408 SSC409 SSC410




SST201 SST202 SST203 SST204 SST205 SST206 SST207 SST208 SST209 SST210





SSF01 SSF02 SSF03 SSF04 SSF05 SSF06 SSF07 SSF08 SSF09 SSF10

SSA201 SSA202 SSA203 SSA204 SSA205 SSA206 SSA207 SSA208 SSA209 SSA210






SS1DOT01 SS1DOT02 SS1DOT03 SS1DOT04 SS1DOT05 SS1DOT06 SS1DOT07 SS1DOT08 SS1DOT09 SS1DOT10












$25.00 $25.00 $25.00 $25.00 $25.00 $25.00 $25.00 $25.00 $25.00 $25.00

G H I

Rounded Corners

Rounded Corners Rounded T’s Squared T’s Squared X’s Footprints Arrows Dots Rounded

Arrowheads

D

E

F

G

H

I

A

B

C


Made from a tough polyurethane film, Overlaminate Tape Protection is the best way

pallet jacks, and tow motors.

A. Overlaminate Tape Protection

A

PART # PRICE

1" x 108’ OVR1 $20.00

2" x 108’ OVR2 $24.00

3" x 108’ OVR3 $28.00

4" x 108’ OVR4 $32.00

PART # PRICE

6" x 108’ OVR6 $42.00

Case (12) - 4” OVRCS4 $348.00

Case (8) - 6” OVRCS6 $312.00

Protect your vinylfloor tape lines with durable overlaminatetape protection.Only $28 per roll for 3”x108’


5S5S

A WORLD OF POSSIBILITIES.

LabelTac Printers are designed to easily create vivid & informative custom labels and signs for your facility- whether they be for Safety, Lean, 5S, Arc Flash, Pipe Marking or virtually any other project or application.

Simply connect your LabelTac to any PC and you’ll be printing professional indoor & outdoor signage in minutes. We’ve included hundreds of useful templates and symbols to help you get started as quickly as possible.

learn more @


LabelTac Industrial PrintersProfessional In-House Labeling Systems for any ApplicationCreating comprehensive Visual Safety and Organization programs in the workplace is one of the best ways to improve overall efficiency, reduce accidents, and get your facility looking better than ever.

With LabelTac Printers, creating your own custom Safety, Lean and other types of industrial labels has never been easier. LabelTac printers connect to any PC in your facility, allowing you to create labels in Microsoft Word, OpenOffice Suite, Adobe Photoshop & more.

LABELTAC MODELS

Easy to use, versatile, and cost effective- create labels and signage for any use with the LabelTac 4. LabelTac 9 for maximum visibility.

Upgraded components and a 3x ribbon capacity make the LabelTac 4 PRO ideal for heavy users.

LABELTAC 4 LABELTAC 4 PRO LABELTAC 9

Ř�'85$%/(�/$%(/6��6,*16

Ř�)25�,1'225�287'225

Ř�($6<��35,17�)520�$1<�3&

Ř�&267�())(&7,9(


The LabelTac 4 is our most popular industrial thermal transfer printer. Simply connect it to any PC and create completely custom labels and signs to fit any need and application. Includes an industry-leading 4 year warranty.

The LabelTac 4 PRO thermal transfer printer is designed for users who routinely print thousands of labels daily. It includes an upgraded motor and cutter, and can hold rolls of ribbon up to 984 feet long. Same great 4 year warranty.

They say bigger is better- and they’re right. Get your signs noticed with our LabelTac 9 printer. Made from a die-cast

right from any PC.

PART # PRICELabelTac 4 Printer LT4 $799.00

PART # PRICELabelTac 4 PRO Printer LT4P $999.00

PART # PRICELabelTac 9 Printer LT9 $3999.00

�$//�/$%(/7$&�PRINTERS INCLUDE:

Easy to use, cost-effective printer for all multipurpose indoor/outdoor labeling

or thousands of labels daily

Accommodates up to 9 inch material for bold, large signs and labels in minutes


Rent a LabelTac PrinterJust $50/weekWe offer an easy rental program that allows you to rent one of our LabelTac 4 or LabelTac 4 PRO printers

simply return it when you’re done. Best of all, if you’d like to keep it, any and all money spent on the rental can be applied towards the purchase of the printer.

Contact us at 1-866-777-1360 for more details.

How to use LabelTac Printers

The print ribbon thermally bonds to the label stock material resulting in print on the label. The color of the print ribbon will be the color of the text and symbols on the label, and the color of the label supply will be the backing color of the label itself.

Connect LabelTac to your PC and install the supplies needed for your print job.

and modify it to fit your needs, or easily create a label or sign from scratch.

Print! It’s that easy to create your own durable, completely custom signage for any application with LabelTac printers.

Printing with LabelTac printersrequires two components...

PRINT RIBBON + LABEL SUPPLY

Step 1 Step 3Step 2


LabelTac Printers make use of a special Thermal Transfer print ribbon to create labels and signs that don’t smear, smudge, or fade over time. When used in conjunction with our LabelTac supplies, these ribbons offer superior protection against industrial hazards as well as the elements.

A. LabelTac 4 Print Ribbon

C. LabelTac 9 Print Ribbon

B. LabelTac 4 PRO Print Ribbon

A

C

B

PART # COMPATIBILITY PRICE

Black 4.33" x 299' L4R03 $49.99

White 4.33” x 299’ L4R02 $49.99

Red 4.33” x 299’ L4R04 $49.99

Blue 4.33” x 299’ L4R07 $49.99

Yellow 4.33” x 299’ L4R01 $49.99

Magenta 4.33” x 299’ L4R20 $49.99


Black 8.66" x 984' L9R03 $249.99

White 8.66” x 984’ L9R02 $249.99

Red 8.66” x 984’ L9R04 $249.99

Blue 8.66” x 984’ L9R07 $249.99


Black 4.33" x 984' LPR03 $149.99

White 4.33” x 984’ LPR02 $149.99

Red 4.33” x 984’ LPR04 $149.99

Blue 4.33” x 984’ LPR07 $149.99

Yellow 4.33” x 984’ LPR01 $149.99

Magenta 4.33” x 984’ LPR20 $149.99

Orange 4.33” x 984’ LPR06 $149.99


LabelTac Print Ribbons

Supply Compatibility:


Our LabelTac Label Supply is engineered from extremely high-grade vinyl and is designed to last 5+ Years in outdoor applications, and even longer for indoor use. The adhesive is very strong, but won’t leave a residue when removed.

A. Premium Vinyl Label Supply for LabelTac 4 / 4 PRO

A


LabelTac Supply

LabelTac is...

Supply Compatibility:

.5” x 150’ 1” x 150’ 2” x 150’ 3” x 150’ 4” x 150’

Yellow LT0501 LT101 LT201 LT301 LT401

White LT0502 LT102 LT202 LT302 LT402

Black LT0503 LT103 LT203 LT303 LT403

Red LT0504 LT104 LT204 LT304 LT404

Green LT0505 LT105 LT205 LT305 LT405

Orange LT0506 LT106 LT206 LT306 LT406

Blue LT0507 LT107 LT207 LT307 LT407

Battleship Gray LT0508 LT108 LT208 LT308 LT408

Purple LT0509 LT109 LT209 LT309 LT409

Brown LT0510 LT110 LT210 LT310 LT410

Clear LT0511 LT111 LT211 LT311 LT411

Pink LT0512 LT112 LT212 LT312 LT412

Gold LT0513 LT113 LT213 LT313 LT413

Silver LT0514 LT114 LT214 LT314 LT414

Light Blue LT0515 LT115 LT215 LT315 LT415

Hi-Vis Pink LT0517 LT117 LT217 LT317 LT417

Hi-Vis Yellow LT0519 LT119 LT219 LT319 LT419

PRICE $89.99 $109.99 $139.99 $169.99 $189.99

COMPATIBILITY

With 17 OSHA-standard colors of tough

specialty supplies, LabelTac printers are able to print custom signs and labels for virtually all applications.

Facilities using LabelTac printers typically save between 40-75% versus buying pre-made labels, having labels made by a sign shop, or using other older or more expensive industrial labelers.

LabelTac printers connect to any PC- this way you are able to design labels on a large monitor, using familiar and easy-to-use software such as Microsoft Word or OpenOffice.

Versatile. Cost-effective. Simple.


LABELTAC 4 LABELTAC 4 PRO LABELTAC 9Supply Compatibility:

A. Premium Vinyl Label Supply for LabelTac 9

A

4” x 150’ 6” x 150’ 7” x 150’ 8” x 150’ 9” x 150’

Yellow LT401A LT601 LT701 LT801 LT901

White LT402A LT602 LT702 LT802 LT902

Black LT403A LT603 LT703 LT803 LT903

Red LT404A LT604 LT704 LT804 LT904

Green LT405A LT605 LT705 LT805 LT905

Orange LT406A LT606 LT706 LT806 LT906

Blue LT407A LT607 LT707 LT807 LT907

Battleship Gray LT408A LT608 LT708 LT808 LT908

Purple LT409A LT609 LT709 LT809 LT909

Brown LT410A LT610 LT710 LT810 LT910

Clear LT411A LT611 LT711 LT811 LT911

Pink LT412A LT612 LT712 LT812 LT912

Gold LT413A LT613 LT713 LT813 LT913

Silver LT414A LT614 LT714 LT814 LT914

Light Blue LT415A LT615 LT715 LT815 LT915

Hi-Vis Pink LT417A LT617 LT717 LT817 LT917

Hi-Vis Yellow LT419A LT619 LT719 LT819 LT919

PRICE $189.99 $209.99 $239.99 $269.99 $299.99

COMPATIBILITY

.



A. Pre-Printed Header Die-Cut Labels

B. Blank Continuous Header Supply

A

B

These Die-Cut Labels have a pre-printed header communicating different popular industrial warnings: Danger, Caution, Warning, Notice, or left blank. Caution, Warning, & Danger are used for relaying different levels of potential personal injury, while Notice typically relates to non-injury related scenarios or messages.

Continuous Header material is designed with a pre-printed header stripe across the top of the roll- allowing custom messages to then be printed in the header area.


3” x 5” “Warning” Header 200 Labels / roll LT35WARN $149.99

4” x 6” “Danger” Header 200 Labels / roll LT46DANG $159.99

4” x 6” “Caution” Header 200 Labels / roll LT46CAUT $159.99


4” x 6” “Notice” Header 200 Labels / roll LT46NOTC $159.99

4” x 6” Blank Orange Header 200 Labels / roll LT46OR $159.99









COMPATIBILITY STRIPE SIZE PART # PRICE

Yellow Stripe 9” x 75’ 2” LT9E01CNT $209.99

Red Stripe 9” x 75’ 2” LT9E04CNT $209.99

Orange Stripe 9” x 75’ 2” LT9E06CNT $209.99

Blue Stripe 9” x 75’ 2” LT9E07CNT $209.99

COMPATIBILITY 1” STRIPE 2” STRIPE 3” STRIPE 4” STRIPE

Yellow Stripe 4” x 75’ LTA01CNT LTB01CNT LTC01CNT LTD01CNT

Red Stripe 4” x 75’ LTA04CNT LTB04CNT LTC04CNT LTD04CNT

Orange Stripe 4” x 75’ LTA06CNT LTB06CNT LTC06CNT LTD06CNT

Blue Stripe 4” x 75’ LTA07CNT LTB07CNT LTC07CNT LTD07CNT

PRICE $149.99 $149.99 $149.99 $149.99

CUSTOM SIZES

AVAILABLE*



A. NFPA/RTK Die-Cut Labels

B. GHS Die-Cut Labels

B. RTK Color Bar Die-Cut Labels

LabelTac NFPA labels are designed with a preprinted multi-color diamond for visual communication of chemical safety information. Simply print the required information onto

labels are available in a 1, 2, 3 & 4 diamond configuration.

RTK Color Bar Labels are designed to boldly display the Health, Flammability, and

‘color bar’ format.


2” x 2” 250 Labels / roll LT22NFPA $129.99




1 Diamond 200 Labels / roll LT46GHS1 $159.99





3.5” x 4” 200 Labels / roll LT34BAR $149.99

A

B

C



B. Brushed Gold + Silver Supply

C. Cold Storage Supply

BThis material has a brushed metallic finish and is able to be used indoors or outdoors. Ideal for use for name plates for office doors, plaques and trophy plates, and looks great as product labels or adhered to equipment.

Industrial freezers and cold storage facilities require special treatment for labeling, since most adhesives malfunction in the low temperatures found in these kind of environments.

A. Reflective SupplyOur printable Reflective Vinyl Tape has strong reflective properties and is rated for up to 7 years life outdoors in the elements. Useful for areas such as stairwells, crawlspaces, emergency exits, and other areas where visibility can be a problem.A

.5” x 120’ 1” x 120’ 2” x 120’ 3” x 120’ 4” x 120’

Reflective Yellow LT0501RF LT101RF LT201RF LT301RF LT401RF

Reflective White LT0502RF LT102RF LT202RF LT302RF LT402RF

Reflective Red LT0504RF LT104RF LT204RF LT304RF LT404RF

PRICE $114.99 $134.99 $154.99 $174.99 $194.99

1” x 75’ 2” x 75’ 3” x 75’ 4” x 75’

Brushed Aluminum LT125 LT225 LT325 LT325

Brushed Gold LT124 LT224 LT324 LT324

PRICE $79.99 $99.99 $119.99 $139.99

1” x 100’ 2” x 100’ 3” x 100’ 4” x 100’

White LT102CS LT202CS LT302CS LT402CS

PRICE $134.99 $154.99 $174.99 $194.99

1” x 100’ 2” x 100’ 3” x 100’ 4” x 100’

Yellow - LT201CS - LT401CS

PRICE - $219.99 - $279.99

COMPATIBILITY

COMPATIBILITY

COMPATIBILITY

C



B. Glow in the Dark Supply

C. Printable Wire Wraps

Our Glow In The Dark label supply is perfect for signs and labels that need to be visible

with limited visibility. Remains visible in a dark area for 6+ hours.

LabelTac Printable Wire Wraps are designed to be used with your LabelTac Printer- The

underneath. Great for organizing messy wires.

A. High Temperature SupplyOur LabelTac High Temperature Vinyl Tape is designed to hold up even when surface

equipment.

COMPATIBILITY

COMPATIBILITY

COMPATIBILITY

1” x 100’ 2” x 100’ 3” x 100’ 4” x 100’

Yellow LT101HT LT201HT LT301HT LT401HT

White LT102HT LT202HT LT302HT LT402HT

Red LT104HT LT204HT LT304HT LT404HT

Green LT105HT LT205HT LT305HT LT405HT

Blue LT107HT LT207HT LT307HT LT407HT

PRICE $134.99 $154.99 $174.99 $194.99

1” x 70’ 2” x 70’

Yellow LT101WW LT201WW

White LT102WW LT202WW

Red LT104WW LT204WW

Orange LT106WW LT206WW

Blue LT107WW LT207WW

PRICE $89.99 $109.99

1” x 75’ 2” x 75’ 3” x 75’ 4” x 75’

Glow “White” LT130 LT230 LT330 LT430

PRICE $119.99 $139.99 $159.99 $179.99

A

B

C



B. Tear-Resistant Tag Stock

C. Repositionable Supply

Make your own Pipe and Valve tags with our LabelTac Tag Stock- Simply print your label, punch a hole, and hang with either wire or zip ties! Comes on a continuous roll, allowing you to make tags of any length.

This material can be removed and reapplied while retaining adhesive strength. Ideal for use indoors or outdoors, for labels and signs that may need to be removed or replaced.

A. Printable Shrink TubePrintable Shrink Tubes are the best solution to marking and organizing cables- Simply print your text or symbols on the shrink tube, slide it over the cable, and when the shrink

A

3/16” x 25’ 1/4” x 25’ 3/8” x 25’ 1/2” x 25’ 3/4” x 25’ 1” x 25’

Yellow LTB01SHK LTC01SHK LTE01SHK LTF01SHK LTH01SHK LTJ01SHK

White LTB02SHK LTC02SHK LTE02SHK LTF02SHK LTH02SHK LTJ02SHK

PRICE $79.99 $89.99 $99.99 $109.99 $119.99 $129.99

COMPATIBILITY

COMPATIBILITY

COMPATIBILITY

1” x 100’ 2” x 100’ 3” x 100’ 4” x 100’

Yellow LT101TAG LT201TAG LT301TAG LT401TAG

White LT102TAG LT202TAG LT302TAG LT402TAG

Red LT104TAG LT204TAG LT304TAG LT404TAG

Green LT105TAG LT205TAG LT305TAG LT405TAG

Orange LT106TAG LT206TAG LT306TAG LT406TAG

Light Blue LT107TAG LT207TAG LT307TAG LT407TAG

PRICE $109.99 $119.99 $129.99 $139.99

.5” x 100’ 1” x 100’ 2” x 100’ 3” x 100’ 4” x 100’

Yellow LT0501RP LT101RP LT201RP LT301RP LT401RP

White LT0502RP LT102RP LT202RP LT302RP LT402RP

PRICE $114.99 $134.99 $154.99 $174.99 $194.99

B

C



B. High-Tack Supply

agressive adhesive, making it easy to keep labels stuck to those difficult spots. This tape can still be removed without leaving messy residues.

A. Magnetic SupplyNeed a way to magnetically attach labels to racks, equipment, or other metal surfaces? Our LabelTac Magnetic Supply is the perfect way to create removable and re-adherable labels for use in your warehouse, manufacturing floor & more.

COMPATIBILITY

COMPATIBILITY

1” x 25’ 2” x 25’ 3” x 25’ 4” x 25’

Yellow LT101M LT201M LT301M LT401M

White LT102M LT202M LT302M LT402M

PRICE $69.99 $82.99 $99.99 $119.99

2” x 100’ 3” x 100’ 4” x 100’

Yellow LT201HK LT301HK LT401HK

White LT202HK LT302HK LT402HK

PRICE $154.99 $174.99 $194.99

A

B

OrderOnline24/7visit our websitewww.creativesafetysupply.com


LABELTAC 4 LABELTAC 4 PRO LABELTAC 9Compatibility:

A. Label Design Workstation (LDW)

C. LabelTac Hard Carrying Case

D. LabelTac Cleaning Swabs

B. LabelTac Battery PackHave IT restrictions that prevent you from using work computers for label creation and printing? Or need a small laptop for dedicated label printing? The LabelTac Label Design

for your LabelTac Printer. Pre-installed with Windows 7 and LabelTac drivers, you’ll be printing right away.

Protect your LabelTac Printer from impact or other damage with a heavy-duty case.

The LabelTac Hard Carrying Case is ideal for safely storing and transporting a LabelTac Printer and accessories.

These cleaning swabs are good for cleaning the thermal printheads on LabelTac Printers. We recommend cleaning your printhead every 4-5 rolls of material for optimum performance.

* 2 free swabs are included with every LT supply order

Need to print labels and signs on the job site or away from wall outlet power? The LabelTac Battery Pack allows for true on-the-go printing- simply pair with our Label Design Workstation or any other laptop and you can print ANYWHERE! The LabelTac Battery Pack recharges in under 2 hrs, and can print hundreds of labels on a single change.

A

C

B

LabelTac Accessories

PART # COMPAT. PRICE

Label Design Workstation LDW1 $299.99


Hard Carrying Case LT-HCASE $325.00


LabelTac Cleaning Swabs LTSWAB $3.95


LabeTac Battery LT-BP200 $399.99

D

411-866-777-1360 1-330-777-8818 www.creativesafetysupply.comLEARN MORE: 1-866-777-1360 OR www.creativesafetysupply.com

LABELTAC PACKAGES from CREATIVE SAFETY SUPPLY.Our LabelTac Packages are carefully put together with colors, sizes and quantities of supplies to fit the needs of many different common labeling applications. With our packages- not only do you get the rights tools for the job, but the price is discounted as well. Any of these packages can actually be further customized with different supply options to fit your needs.

Starter Packages

Mobile Starter Packages

Pipe Marking Packages

OSHA Packages

5S & Lean Packages

Arc Flash Packages

Total Facility Packages

Multi-Printer PackagesLabelTac 4 Pipe Marking Package

SAVEMONEY


MULTICOLORTHERMAL PRINTING

The Brady GlobalMark Industrial Label Maker is a make-it-yourself industrial-grade, heavy-duty label-production printer. Users have the ability to print custom labels, tags, decals, badges, and signs on demand. Brady’s advanced touch-screen technology, powered by a Microsoft Windows CE operating system, makes producing professional labels as fast and simple as...Touch, Print, Presto!!

The BBP31 Sign and Label Printer is an easy-to-use, versatile printer that can print

drop label design and an intuitive home screen that allows you to create labels quickly and easily - in as little as 2 steps.

The BBP31 Sign and Label Printer can print on hundreds of different labels, tapes, tags and materials. It can operate as a stand-alone printer or connect to a PC.

Brady’s PowerMark® sign and label printer allows you to create custom, multi-color signs and labels, as wide as 10 inches. This sign printer features 4-color quality output and over 300 built-in symbols to help you create high visibility, durable signs and labels for your facility.

The PowerMark sign and label printer also features PC connectivity for printing with MarkWare Facility Identification Software.

The BMP71 Label Printer is a portable printer with an impressive variety of features,

labels faster and more efficiently than before. Its top features include built-in label design wizards, storage space for over 100,000 label files, and a large, full color graphical screen that shows you exactly what your label will look like.

PART # PRICEBBP31 Printer BBP31 $1795.00

PART # PRICEPowermark Printer 13500 $4995.00

PART # PRICEBMP71 Printer BMP71 $895.00

A. Brady GlobalMark 2 Labeling System

B. Brady BBP31 Touchscreen Labeling System

C. Brady Powermark Labeling System

D. Brady BMP71 Labeling System

A

B

C

D

PART # PRICEGlobalMark 2: Multicolor 76800 $3495.00

GlobalMark 2: Color & Cut 76801 $4495.00


electrical and general industrial crews. With label materials designed specifically for harsh environments, the BMP21 portable printer can quickly and easily create clear, legible labels that stick for years - despite extreme temperatures and curved or highly textured surfaces.

This label printer can print on self-laminating vinyl, PermaSleeve™ wire marker sleeves,

operation and a large, backlit display for easy indoor and outdoor reading.

Brady’s IDXPERT™ Portable Label Printer is the ideal tool for on-the-spot labeling in datacomm, electrical, material handling and industrial workplaces. It offers more sizes, symbols and types of labels. The 300 dpi thermal transfer label printing creates professional-looking die-cut labels, self-laminating labels, sleeves, slide-in punch block strips and continuous tape labels.

Create more than 140 different high-performance labels specifically for your application, including wire and cable markers, panel, rack and frame identification labels, datacomm labels, facilities labels and more.

Brady’s Industrial Printers are a great solution for high performance printing and labeling. Whether you’re looking for a large, high volume sign and label printers or a smaller, compact printing system, Brady has a desktop printer to meet your needs.

For Brady Supplies, please contact us at 1-866-777-1360.

PART # PRICEBMP21 Printer BMP21 $145.95

A. Brady BMP21 Handheld Labeling System

Brady IDXPERT Handheld Labeling System

PART # PRICEB. QWERTY Layout XPERT-KEY $395.00

C. ABC Layout XPERT-ABC $395.00

A

B

C


Pre-Made LabelsDurable Labels for Safety, Lean, Facility, and Pipe MarkingMany companies are choosing to make their own labels and signs in-house with an industrial labeling system, but we know that doesn’t work for everybody- either because of IT restrictions, time restrictions, or any number of other reasons. With our pre-made labels, let US do the work for you.

Because they are printed using a thermal transfer print, the labels are extremely durable- resistant to fading from UV rays, water and rain, smearing and smudging, and even most chemicals and cleaning agents.

Our website makes it easy for people with limited time to find and order the labels they need. Plus we offer free

Our pre-made labels are made from an adhesive vinyl that offers an easy peel & stick application, making even large labeling jobs easy.

These labels are highly durable and designed to last- typically lasting over 5 years even in outdoor applications without fading or peeling.

Easy to order Peel & stick Indoor/outdoor


SAFETY LABELS

PPL10003MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10009MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10015MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10021MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10027MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10033MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10039MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10004MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10010MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10016MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10022MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10028MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10034MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10040MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10005MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10011MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10017MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10023MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10029MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10035MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10041MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10006MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10012MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10018MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10024MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10030MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10036MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10042MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10002MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10008MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10014MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10020MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10026MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10032MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10038MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PM-MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10007MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10013MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10019MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10025MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10031MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10037MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70


SAFETY LABELS (continued)

PPL10045MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10051MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10057MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10063MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10069MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10075MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10081MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10046MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10052MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10058MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10064MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10070MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10076MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10082MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10047MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10053MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10059MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10065MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10071MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10077MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10083MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10048MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10054MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10060MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10066MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10072MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10078MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10084MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10044MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10050MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10056MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10062MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10068MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10074MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10080MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10043MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10049MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10055MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10061MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10067MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10073MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10079MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70


SAFETY LABELS (continued)

PPL10087MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10093MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10099MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10105MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10111MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10117MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10088MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10094MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10100MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10106MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10112MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10124MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10089MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10095MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10101MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10107MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10113MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10125MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10090MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10096MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10102MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10108MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10114MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10086MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10092MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10098MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10104MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10110MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10116SML 1” x 4” $0.80MED 2” x 8” $2.60LRG 4” x 16” $8.40XL 6” x 24” $16.20


PPL10122MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10085MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10091MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10097MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10103MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10109MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10115SML 2” x 2” $0.80MED 4” x 4” $2.60LRG 8” x 8” $8.40







FIRE SAFETY AND SMOKING-RELATED LABELS

PPL10135MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10147MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10136MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10142MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10148MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10137MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10143MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10132MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10138MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10144MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10146MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10127MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10128MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10129MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10130MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10131MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10145MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70






Make your own custom labelswith LabelTac printers.Save over 80% vs premade.

Completelycustomizable.

Instant gratification.

With LabelTac printers, if

label in-house, it costs just $0.70!

With savings like that, it’s clear why so many companies choose to have a label and sign printer in their facility.

It’s not uncommon for facilities to have unique safety hazards, requiring unique safety warning signs and labels.

With LabelTac, it’s your message, your logos and pictures, and your design.

Most times when signs and labels are needed, they are needed now.

No longer do you have to wait for signs and labels to show up- print your own with LabelTac and you’ll have your signage in minutes.

Learn more about LabelTac printers on pages 28-41.


FIRST AID LABELS

FACILITY LABELS

PPL10151MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10163MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10169MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10152MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10164MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10170MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10153MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10165MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10171MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10154MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10166MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10172MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10150MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10156MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10162MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10168MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10149MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10155MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10161MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10167MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70





OrderOnline24/7visit our websitewww.creativesafetysupply.com


FACILITY LABELS (continued)

PPL10175MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10181MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10187MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10193MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10199MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10205MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10211MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10176MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10182MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10188MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10194MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10200MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10206MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10212MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10177MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10183MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10189MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10195MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10201MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10207MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10213MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10178MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10184MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10190MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10196MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10202MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10208MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10214MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10174MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10180MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10186MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10192MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10198MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10204MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10210MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10173MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10179MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10185MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10191MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10197MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10203MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10209MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70


FACILITY LABELS (continued)

PIPE MARKING LABELS

PPL10217MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10223MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10224MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10225MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10226MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10216MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10222MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

PPL10215MED 4” x 6” $3.90LRG 6” x 9” $7.80XL 8” x 12” $12.70

PPL10221MED 6” x 4” $3.90LRG 9” x 6” $7.80XL 12” x 8” $12.70

Pipe Marking label arrows indicate direction of flow of the pipe’s contents- left-facing arrows, right-facing arrows, or no arrows. Be sure to identify which configuration you need for each label when ordering.

Pipe Marking label sizing is based on the diameter of the pipe the label is to be adhered to. 5 sizes are available, and are calculated based on the chart to the right.

If you are unsure what size labels you need for your pipes, give us a call and we’d be happy to help you figure out ideal sizes.

Available in 3 arrow options

Label Sizing10”+

min label length

4” x 32”text height

3.5”

8.0”- 9.9”min label length


2.5”



1.25”



0.75”

.75”- 1.4”min label length


0.5”

PIPE DIAMETER PIPE DIAMETER PIPE DIAMETER PIPE DIAMETER PIPE DIAMETER

PM-110HOTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-2PSINATGASfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-110HOTWTRRTNfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-5PSINATGASfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-110HOTWTRSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-ACIDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-140HOTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-ACIDWASTEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-140HOTWTRRTNfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-AIRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-AMMONIAfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-140HOTWTRSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90





PIPE MARKING LABELS (continued)

PM-ARGONfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CHEMICALFEEDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CITYWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CONDSTDRAINfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-DOMSTCWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-FIREDAMPERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-BOILERBLOWDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CHILLWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-COLDWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CONDSRWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-DRAINfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-FIREPROTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-BOILERFEEDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CHILLWATERRETfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-COLDWATERRETfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-COOLINGWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-DUALTEMPRTNfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-FIRESMKDPRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-BOILERFDWTRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CHILLWATERSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-COLDWATERSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-DEIONIZEDWTRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-DUALTEMPSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-FIRESPRINKLERSfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-BRINEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CHLORINEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-COMPRESSAIRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-DISTILLEDWTRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-EXHAUSTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-FIRESPRINKWTRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-FUELOILfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-FILTEREDWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-DOMHOTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CONDENSATEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CIRCWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-CARBONDIOXfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90





PM-GASfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HEATWATERSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HOTWATERSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LOOPWATERRETfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-MEDICALAIRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-NITROGENfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-GLYCOLfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HIPRESSCONDSTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HYDROGENfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LOOPWATERSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-MEDVACUUMfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-NITROUSOXIDEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-GRNDLOOPRETfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HIPRESSSTEAMfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-INDRLWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LOWPRESSCONDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-MEDPRSCONDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-NONPOTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-GRNDLOOPSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HIPRESSGASfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LABAIRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LOWPRESSSTMfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-MEDPRSSTEAMfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-OILfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HEATINGWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HOTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LABVENTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LOWPRESSGASfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-METHANOLfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-OVERFLOWfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-OXYGENfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-NATURALGASfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LUBEOILfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-LABWASTEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HOTWATERRETfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-HEATWATERRETfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90





PM-POTCOLDWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-PROPANEGASfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-REFRIGERANTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SANITVENTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-STEAMCONDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SUPPLYfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-POTHOTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-PUMPDISCHARfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-REFRIGLIQUIDfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SANITWASTEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-STEAMRETURNfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-VACUUMfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-POTABLEWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-PUMPCONDSTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-REFRIGSUCTIONfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SPRINKLERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-STEAMSUPPLYfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-VENTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-PROCWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-RADONVENTfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-ROOFDRAINfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SPRINKLERFIREfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-STORMDRAINfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-WASTEfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-PROCWTRRETfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-RAINWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SANITARYDRAINfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SPRINKLERWTRfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-STORMSEWERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-WASTEWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-WATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-STORMWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-STEAMfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-SANITSEWERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-RECHOTWATERfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90

PM-PROCWTRSUPfor pipes .75”-1.4” dia. $1.40for pipes 1.5”-2.4” dia. $1.60for pipes 2.5”-7.9” dia. $2.30for pipes 8.0”-9.9” dia. $4.90for pipes 10”+ dia. $5.90




Smart Stripe Alignment Markers

Get products and people where they needto go with our versatile floor marking shapes.Smart Stripe Alignment Markers are made from the same durable, no-stretch material as our popular Smart Stripe tape.

With their low profile and simple peel & stick application, our Corners, T’s, X’s and Dots are the perfect tool for marking the correct alignment of pallets & other movable items, and the Footprints and Arrows easily guide employees and visitors to where they need to go and can withstand even the heaviest foot traffic once applied.

seepage

25


SERIOUSLYSTRONG.SafetyTac Floor Tapes are engineered to

withstand even the harshest environments, including those with heavy forklift traffic.

Learn more: www.creativesafetysupply.com


5S Red TagsA Small Product with Big Results 5S Red Tags are used for visual management of a workspace, clearly marking items that need to be moved or disposed of, assisting workplace organization and awareness.

Available as either a tie-on or adhesive tag, Red Tags allow items that are unused to be placed in a centralized location

home, it can be returned.

Red Tags are designed to be written on, with fields that identify who the person was that tagged the item, when it happened, and where the item comes from, as well as fields that identify the reason for tagging and the proposed action to take- whether it be to move it to a new location, recycle it, scrap it, or move it to the Red Tag holding area.

Red Tags help to keep track of items needing to be removed, recycled, or re-purposed.


Our 5S Red Tags are made from a durable card stock and feature all the information you need to clearly communicate Red Tag reason and action to take. Highly visible; Comes with a wire tie pre-installed for convenience.

Import key 5S Red Tag data into your RTR database for more timely control and access to the information you need to continue to improve your 5S Program.

5s Adhesive Tags are a great way to attach Red Tags to items quickly, or to objects

They feature a high tack adhesive along the top side of the label and communicate all of the data important for proper tagging and 5S execution in most 5S, healthcare, and manufacturing environments.

Place these mini 5S Red Tag Stations in areas where you can make it easy for everyone to get a 5S Red Tag and use them. Fits standard 5S Red Tags, and each board includes 50 of our 5S Red Tags as well as a dry erase marker and 2 magnets for the writable area.

A. 5S Red Tags

D. 5S Red Tag Database Software

B. 5S Adhesive Red Tags

C. 5S Red Tag Holders

PART # PRICERed Tags (100/pack) CSSREDTAG $14.99

PART # PRICE5S Red Tag Database Software TAGDBSFTW $39.99

PART # PRICEAdhesive Red Tags (100/pack) CSSADHTAG $16.00

A

B

PART # PRICE1 Board (w/ 50 tags) 5SBOARD1 $45.99

2 Boards (w/ 100 tags) 5SBOARD2 $88.99

3 Boards (w/ 150 tags) 5SBOARD3 $119.99

C

D


Use these signs to identify Red Tag holding area locations. Red Tag holding areas are an effective way for items to be given a ‘grace period’ before disposal, as well as provide a centralized area for all Red Tagged items to be kept.

This 5S Red Tag Holding Area Poster is a high-impact way to identify holding area locations, as well as remind employees to correctly tag and routinely evaluate tagged items. Its bright red color is indicative of its purpose and it matches our 5S Red Tag Holding Area Floor Signs well.

This poster can be customized or modified to fit your needs and messages at no extra cost- If you would like to customize it- please contact us at 1-866-777-1360.

PART # PRICEHolding Area Poster 1005REDPSTR $28.95

PART # PRICETPM Blue Tags (100/pack) TPMTAG $14.99

A. Red Tag Holding Area Floor Signs

B. Red Tag Holding Area Poster

C. TPM Blue Tags

A

PART # PRICEFloor Sign: 12” x 9” FS-REDTAGA-12 $15.00

Floor Sign: 24” x 18” FS-REDTAGA-24 $45.00




B

COur TPM Tags are used as the foundational tool to Total Productive Maintenance. This tag is an effective communication label to ensure your project team and maintenance are working together.


Need to make your own custom tool shadows? Then this is your answer. This vinyl is the perfect solution to create shadows for your tools and workplace items. Just trace your item on the back side, cut out, peel and stick. It’s that easy! Each roll should be more than enough to cover a 4’ x 8’ tool shadow board.

A. Tool Outline Vinyl

DIMENSIONS PART # PRICEYellow TOV01 $18.00

White TOV02 $18.00

Black TOV03 $18.00

Red TOV04 $18.00

Green TOV05 $18.00

Orange TOV06 $18.00

Blue TOV07 $18.00

Gray TOV08 $18.00

A

This 4 page 5S Audit Checklist asks the important questions in each step of the

score to let you know where you stand in each category with a rating from 0 - 5.

Available as an instant PDF download after purchase so it can be printed and used as many times as you like.

PART # PRICE5S Audit Scorecard 5SAUDCARD $4.95

B. 5S Audit Scorecard

INSTANTDOWNLOAD


project management, etc.

Available in either Magnetic or Peel & Stick options. Designed to be used on a

Quick Grids

PART # PRICEA. Yellow - Magnetic GRID01M $68.34

A. Black - Magnetic GRID03M $68.34

A. Red - Magnetic GRID04M $68.34

A. Green - Magnetic GRID05M $68.34

A. Orange - Magnetic GRID06M $68.34

A. Blue - Magnetic GRID07M $68.34

A. Yellow - Peel & Stick GRID01P $47.44

A. Black - Peel & Stick GRID03P $47.44

A. Red - Peel & Stick GRID04P $47.44

A. Green - Peel & Stick GRID05P $47.44

A. Orange - Peel & Stick GRID06P $47.44

A. Blue - Peel & Stick GRID07P $47.44

B. Yellow Magnetic Tags (24/pack) GRIDTAG01 $4.68

B. Black Magnetic Tags (24/pack) GRIDTAG03 $4.68

B. Red Magnetic Tags (24/pack) GRIDTAG04 $4.68

B. Green Magnetic Tags (24/pack) GRIDTAG05 $4.68

B. Orange Magnetic Tags (24/pack) GRIDTAG06 $4.68

B. Blue Magnetic Tags (24/pack) GRIDTAG07 $4.68

A

B

Get your workbenches and tool areas organized with our Heavy Duty Industrial Pegboard Kits.

2-Board Kit includes: 48 hooks, 4 bins, and spacer kit; 4-Board Kit includes: 96 hooks, 8 bins, and spacer kit.

C. Industrial Pegboard Kits

PART # PRICE2-Board Kit 2PEGB $169.99

4-Board Kit 4PEGB $299.99

C


Knowledgeable staff.

Large inventory.

Innovative products.

Free shipping on all US orders.

Same day shipping.

Free safety & lean guides.

Industry leading warranties.

... Just a few reasons why we are the leaders in visual safety.

* Free Shipping orders use UPS Ground- delivery time between 2-5 business days.

** Same day shipping is available on most, but not all items- notably custom products, which may require a longer lead time.


Custom Foam OrganizersProtect Your Drawers, Your Tools, and Your Sanity

Trace. Cut. Peel & stick.

One of the biggest time-wasters in most facilities is, without a doubt, the hunt for missing tools.

Meticulous organization is the only way to avoid losing or misplacing tools, especially when people share common tools in a work area, and our Foam Organizers are the easiest way to create your own cost effective drawer organization system.

Organizers come with a secondary bright foam sheet- allowing you to peel the backing form the top sheet, and adhere it to the backing sheet. Where the tools have been cut out, you will see the bright foam ‘shine’ through- This makes it glaringly obvious when a tool is missing and what tool it is, and the cutout ensures that the tool is placed back in it’s correct place when finished.

We offer many different sizes, allowing you to custom cut them down to size to fit your toolboxes or drawers, and even


A

A. Customizable 2-Piece Foam Tool Organizers

“Drawer Liners” (Primary Sheet Only)

SIZE PRIMARY COLOR (1/2”) SECONDARY COLOR (1/4”) PART # PRICE16.625” x 22.25” Black Yellow FOAM1BKY $39.00

16.625” x 22.25” Black Red FOAM1BKR $39.00

16.625” x 22.25” Blue Yellow FOAM1BLY $39.00

16.625” x 22.25” Blue Red FOAM1BLR $39.00

18” x 36” Black Yellow FTK1836BKY $43.95

18” x 36” Black Red FTK1836BKR $43.95

18” x 36” Blue Yellow FTK1836BLY $43.95

18” x 36” Blue Red FTK1836BLR $43.95

27” x 36” Black Yellow FOAM2BKY $49.95

27” x 36” Black Red FOAM2BKR $49.95

27” x 36” Blue Yellow FOAM2BLY $49.95

27” x 36” Blue Red FOAM2BLR $49.95

48” x 48” Black Yellow FOAM3BKY $149.00

48” x 48” Black Red FOAM3BKR $149.00

48” x 48” Blue Yellow FOAM3BLY $149.00

48” x 48” Blue Red FOAM3BLR $149.00

4ft. x 9ft. Black Yellow FOAM4BKY $349.00

4ft. x 9ft. Black Red FOAM4BKR $349.00

4ft. x 9ft. Blue Yellow FOAM4BLY $349.00

4ft. x 9ft. Blue Red FOAM4BLR $349.00

SIZE PRIMARY COLOR (1/2”) QUANTITY PART # PRICE16.625” x 22.25” Black Single FOAM1BK1 $29.00

16.625” x 22.25” Blue Single FOAM1BL1 $29.00

16.625” x 22.25” Black 2 Pack FOAM1BK2 $39.00

16.625” x 22.25” Blue 2 Pack FOAM1BL2 $39.00

16.625” x 22.25” Black 8 Pack FOAM2BK8 $129.00

16.625” x 22.25” Blue 8 Pack FOAM2BL8 $129.00


A

Just like our standard Foam Tool Organizers, but thicker. This foam is ideal for deeper drawers where larger tools and other objects are kept. They are also useful for protecting items in mobile travel cases, such as technical equipment, computers, firearms, photography gear, and other sensitive equipment.

A. Customizable Thick Foam Tool Organizers

SIZE THICKNESS COLOR PART # PRICE2” x 2” 1” Black TFOAM221B $24.99

2” x 2” 1” White TFOAM221W $24.99

2” x 2” 2” Black TFOAM222B $34.99

2” x 2” 2” White TFOAM222W $34.99

2” x 2” 3” Black TFOAM223B $44.99

2” x 2” 3” White TFOAM223W $44.99

2” x 4” 1” Black TFOAM241B $44.99

2” x 4” 1” White TFOAM241W $44.99

2” x 4” 2” Black TFOAM242B $62.99

2” x 4” 2” White TFOAM242W $62.99

2” x 4” 3” Black TFOAM243B $79.99

2” x 4” 3” White TFOAM243W $79.99

This 130 watt, heavy-duty hot knife cuts foam, EIFS, ICF, nylon rope, webbing, synthetic fabric and plastic. Use it for sculpting foam or other craft materials.

With its retractable, disposable razor-sharp segmented blades, this tough utility knife is useful for cutting our Thick Foam Tool Organizers for 5S and lean programs.

B. Heavy Duty Hot Knife

C. Long Foam Utility Blade

PART # PRICEHot Knife ZFHARB $39.99

PART # PRICEUtility Blade LFOAMBLD $3.95

B

C


This is one of the best videos of 5S on the market, professionally written and produced to ensure the key concepts of 5S are communicated to an audience that considers managers as well as employees.

The Extreme Lean 5S Series is an informative, engaging 41 minute long video series. Produced to ensure the key concepts of 5S are communicated.

Nearly every company on the lean journey has taken its first steps into the process

name from five Japanese words, each representing one of five steps.

In a setting that should be familiar to everyone, the typical household garage, the audience is taken through each step of the 5S process from Sort through Sustain by Paul Schmid, Lean Facilitator and creator of 5S Garage.

The purpose of the Errand Run video is two-fold. First, to get the audience thinking of their jobs in terms of a value stream. Second, to show the audience how to create value stream maps to identify and eliminate waste.

Whether you are already on the Continuous Improvement journey or you are just beginning to realize the power of continuous improvement implementation, this video is an essential learning tool for your entire workforce.

A. 5S Into Action DVD

B. Xtreme Lean - 5S DVD

D. 5S: 5 Challenges DVD

C. 5S Garage DVD

E. The Errand Run: Introduction to Lean DVD

F. Toast Kaizen DVD

PART # PRICE5S Into Action DVD VID5SACTION $195.00

PART # PRICEXtreme Lean - 5S DVD VIDXTLEAN $159.00

PART # PRICE5S: 5 Challenges DVD VID5CHALG $129.00

PART # PRICE5S Garage DVD VID5SGARG $145.00

PART # PRICEIntroduction to Lean DVD VIDERRAND $149.00

PART # PRICEToast Kaizen DVD VIDTSTKAIZ $99.00

A

B

C

E

D

F


readers how to get process improvement.

This book discusses the Kaizen mindset that enables a company to utilize its resources to the fullest by directly involving all of its manpower in the enhancement and improvement of the productivity of its operations.

Here is a book, actually a manual in book form, which can be used to drive your lean

are classics.

Hiroyuki Hirano’s five pillars of the visual workplace: sort, set in order, shine, standardize and sustain are the most fundamental and often overlooked aspects in continuous improvement initiatives. Together, these concepts form the 5S System.

GM and Ford were the world leaders in automobile manufacturing, and among the richest companies in the world. This book details the rebirth of the new American industry.

The Toyota Production System is the benchmark used throughout the world for lean thinking. Now you can model your own processes after those of the company that wrote the book on supply chain management.

A. Best Practices in Lean Six Sigma Book

B. The Idea Generator Book

D. JIT is Flow Book

C. 5S for Operators Book

E. The Rebirth of American Industry Book

F. Toyota Supply Chain Management Book

PART # PRICEBest Practices Lean Book BOOKSIXSIG $40.00

PART # PRICEThe Idea Generator Book BOOKIDEAGN $47.52

PART # PRICEJIT is Flow Book BOOKJITFLW $47.52

PART # PRICE5S for Operators Book BOOK5SOPS $25.00

PART # PRICERebirth of American Ind. Book BOOKAMIND $47.52

PART # PRICEToyota Supply Chain Book BOOKTOYSUP $34.95

A

B

C

E

D

F


DIMENSIONS PART # PRICEA. Sustaining a 5S Environment Poster 10005SPSTR $28.95

B. Road to Safety: 6S Poster 10016SPSTR $28.95

C. Composite Risk Management Poster 1002CRMPSTR $28.95

D. 8 Wastes of Lean Poster 1003WASTES $28.95

E. 5S Steps for Success Poster 10045SSTEP $28.95

F. GHS Pictograms Poster 1001GHS $28.95

G. GHS Labeling Guide Poster 1002GHS $28.95

H. NFPA Guide Poster 1001NFPA $28.95

A

E

B

F

C

G

D

H

VIEW OUR ENTIRE POSTER SELECTION ONLINE : www.creativesafetysupply.com

Our lean and safety posters are printed on durable high grade poster paper and feature quality hi-res graphics & artwork that cover a number of common workplace topics and philosophies including: 5S & 6S, Lean, GHS, NFPA, Floor Marking, Pipe Marking, and more.

We offer several poster protection options for a small charge, including UV-resistant lamination and clear plastic poster sleeve hangers.

Many of our posters can be modified or edited to fit the needs of your company, so if there are any changes you’d like to request on any of our posters, please contact us at 1-866-777-1360 and speak with one of our representatives and we’d be glad to help you out.

Lean & Safety Posters


Our 5S Awareness Packages are a great addition to any 5S program. Our bold & high-resolution banners, posters, and floor signs are easy to see and keep 5S Awareness always at the forefront of employees minds.

Use these bold poster packs to communicate the steps of 5S to all personnel. Each pack includes 5 individual large 3ft x 2ft posters.

Sort, Set In Order, Shine, Standardize, Sustain

The perfect hat for any 5S Event!

The dimensions and features of these hats are seven-by-seven inches in diameter with a quality fabric strap with buckle closure for adjusting the caps size. Other features include cotton sweatband, sewn eyelets for insulation and a comfortable environmentally friendly cotton material.

Includes

5S Awareness Banner, Poster, and Floor Sign Packages

5S Individual Steps Poster Packs

E. Lean Machine Hat

PART # PRICEA. “5S Steps” Package PKG5SSTEP $279.99

B. “5S Sustain” Package PKG5SSUST $279.99

PART # PRICEC. “5S Steps” Posters PSTRPK5SBK $159.99

D. “5S Sustain” Posters PSTRPK5SGY $159.99

PART # PRICELean Machine Hat CSSHAT $8.95

A B

C

DE


This 5S Kit includes everything you need to jumpstart your 5S program! Includes 5S Tapes, 5S Red Tags, 5S Training DVD’s & Powerpoint Presentation, Posters & More!

Great starting place for companies trying to implement a new 5S program, or for companies looking to take the next step in the 5S process. The training DVD’s & Powerpoint are made to easily communicate the 5S process to both managers and employees.

Our 5S Event Cart includes everything you need to bolster your organization’s

Includes helpful printed guides and Audit Scorecards for keeping track of 5S progress; 5S Marking Tape for marking floors, walls, and workspaces; Hazard

all in a collapsible mobile cart.

Includes

Includes

A. 5S Starter Kit

B. 5S Event Cart

PART # PRICE5S Starter Kit CSS-5SSRTKIT $449.99

PART # PRICE5S Event Cart 5SEVENTCART $339.99

A

B


Our 5S for Healthcare Workshop Kit Includes everything you need to conduct a 5S

time, wasted time, and resources.

Filmed with the participation of a number of healthcare organizations, the 5S for Healthcare DVD outlines the benefits of implementing the 5S system, defines the 5S’s, and shows the 5S’s in action.

Drawing on his years of working with hospitals, Mark Graban explains why and how Lean can be used to improve safety, quality, and efficiency in a healthcare setting.

direct observation or experience. It offers a structure that begins by always defining the issue through the eyes of the customer.

A. 5S for Healthcare Workshop Kit

B. 5S for Healthcare DVD

C. Lean Hospitals Book

D. A3: Problem Solving for Healthcare Book

PART # PRICE5S for Healthcare Kit 5SHEALTHKIT $499.00

PART # PRICE5S for Healthcare DVD 5SHEALTHDVD $199.00

PART # PRICELean Hospitals Book BOOKLNHOSP $45.99

PART # PRICEA3: Healthcare Book BOOKA3CARE $56.99

5S & Leanfor Healthcare Professionals

A

B

C

D


SafetyTac Industrial Floor Marking Tapes clearly and visually identify areas that present danger to both your employees and visitors, as well as marking off areas such as work cells and identifying proper locations of often-moved items such as trash cans.

SafetyTac Tapes are the strongest floor tapes on the market, and are able to withstand even the heaviest of truck and forklift traffic. No longer do you need to paint you floors with messy paints, or use inferior vinyl floor marking tapes, only to have to re-tape your floor within months. The future of floor marking is already here.

Call us today for a free sample of SafetyTac: 1-866-777-1360

THE THIN LINE BETWEEN &


Industrial Wall SignsPre-made / Customized / 100% CustomYour most important resource is your employees. Be sure to use safety signs within your facility to ensure your staff stays protected. Our safety signs will save up to 75% compared to buying them from an outside vendor. Instant ready-to-use OSHA Safety Signs and ANSI Safety Signs.

Mounted on 3mm PVC, these signs are tough and great for all facilities. PVC has pre-drilled corner holes to make sign application easy. You can either screw the sign into a wall, or can mount the sign with wire or zip ties.

Choose from a variety of pre-made signs suited for many different applications- from Lean and 5S, to Facility Traffic, and Safety- modify them if you desire at no charge, or even have your own custom signs created.

There are no no set-up charges or extra costs for customization, just give CUSTOM SIGNS

Looking to modify one of our existing signs, or even create your own unique signs from scratch? Give us a call and we’d be glad to help.

We have a large selection of popular pre-made signs that are available in a number of sizes. See our commonly purchased signs on the next page, or view all our signs online at:

1-866-777-1360


PRE-MADE SIGNS

Customize Signs For FREE





POPULAR PRE-MADE WALL SIGNS

For a quote on an atypical size or shaped sign please contact one of our representatives at 1-866-777-1360.STANDARD SIZING & PRICING

TYPE C SIGNS TYPE D SIGNS TYPE E SIGNSRound/Square Signs Rectangular Signs Long Rectangular Signs

12” x 12” - $16.99

24” x 24” - $59.99

36” x 36” - $135.99

12” x 9” - $16.99

24” x 18” - $47.99

36” x 27” - $99.99

12” x 24” - $32.99

36” x 18” - $68.99

48” x 24” - $124.99

No Pedestrian Tfk.TYPE D

Recycle MaterialsTYPE D

No SmokingTYPE D

Wash HandsTYPE D

Arc Flash HazardTYPE D

Six S’sTYPE D

Warn: Forklift TrafficTYPE D

No SmokingTYPE D

5S ChecklistTYPE D

Confined SpaceTYPE D

Emergency Eye WashTYPE E

Electrical BoxTYPE E

FOD Critical Area ATYPE C

Enter Right ArrowTYPE C

Food AreaTYPE C

WS-NOPEDTF

WS-RECYCLE

WS-NOSMOKE

WS-WASHHAND

WS-AFHAZRD

WS-REMB6S

WS-WATCFORK

WS-NOSMOK2

WS-5SCHECK

WS-DANCONF

WS-EMEREYE WS-ELECDNB WS-FODCRITA WS-ENTERR WS-FOODARA

NOSMOKING

VIEW OUR ENTIRE WALL SIGN SELECTION ONLINE : www.creativesafetysupply.com


Industrial BannersPre-made / Customized / 100% Custom

outdoor banners.

Our banners are completely customizable- so just let us know what you are after and one of our designers will make it up to your specifications- OR - choose one of our popular pre-made banners!

Made from 13 oz Extra Tough Scrim instead of vinyl- these banners are pre-grommeted for your convenience and designed to last 5-7 years outdoors.

&86720�%$11(56Looking to modify one of our existing banners, or even create your own unique banner from scratch? Give us a call and we’d be glad to help.

We have a large selection of popular pre-made banners that are available in a number of sizes. See our commonly purchased banners on the next page, or view all our banners online at:

1-866-777-1360


35(�0$'(�%$11(56

Customize Banners For FREE


Pre-Grommetted



The corners of our banners include grommets pre-installed to allow for sturdy hanging.


POPULAR PRE-MADE BANNERS

For a quote on an atypical size or shaped banner please contact one of our representatives at 1-866-777-1360.STANDARD SIZING & PRICING

2’ x 5.25’ - $139.00 3’ x 8’ - $216.00 3.75’ x 10’ - $279.00


A

B C

mounted.

to give a modern effect- and smaller dimensional letters can be used for a host of purposes, including office nameplates, facility marking, door marking, and so on.

Reception signs are the first impression of your brand that you will leave on your customer. We offer 100% customizable vinyl Reception Area signs that will really make your front area pop. Of course our wall decals can be used in other areas as well- anything from marking

A. Custom Dimensional Letters

B & C. Custom Reception Signage

Custom Facility BrandingMake Your First Impression Count

Call for custom pricing



A

B

We can help mobilize your company’s brand with our completely customizable vinyl vehicle wraps.

Whether it be on a car, truck, van, or even on a boat, these graphics will showcase your business wherever you go. Our auto wraps will advertise your services, display your products, and let your vehicle represent you in parking lots, roads, or on the highway.

are made on tough vinyl that resists fading and resists the elements and will stay looking sharp for a long time to come. We can create decals of any kind, including full color graphics.

A. Custom Vehicle Wraps

B. Custom Vehicle Decals

Custom Fleet GraphicsTransform Your Vehicles into Moving Billboards




With one of the widest label printing capacities and an armor-like metal chassis, the LabelTac 9 steps forth todominate as one of the true champions of the industrial labeling battlefield. Engineered to withstand industrial environments like those found on factory floors or warehouses, but versatileenough to even fit into office environments- the LabelTac 9 hooks up to any PC and allows you to create highly visible custom signs and labels for your workplace. These signs and labels are water, UV, and chemical-resistant, and last for years, indoors or outdoors.

Introducing the LabelTac 9 Industrial Thermal Transfer Printer

Find out more at: www.creativesafetysupply.com


seepage

6


by Honeywell | Products Dealer

Provide the initial irrigation of eyes after an accident. Wall stations come complete with 32 ounce bottles of Eyesaline® solution. Bottle design extends the flow of solution to the eyes and ensures a sterile flush - bottle cannot be resealed. 32 ounce bottles include grip strips. Bottles are safety sealed and dated.

The Fendall Porta Steam II Eyewash Station offers versatile portability and a full 15-minutes of uninterrupted flushing without having to pay the price of costly plumbing. It is self-contained and it features a nozzle strap that is easily removed to activate flushing.

Innovative design dispenses eyewash at a constant pressure for the entire 15 minute flush cycle. Unit houses two 3.8 gallon cartridges which are safety-sealed until activation, providing a 24 month service-life. Choose from Standard or Sterile Eyewash Solution, sold separately. Set-up and maintenance costs are kept to a minimum because no solution mixing or unit removal is required. An easy-view window allows you to inspect cartridges with just a glance. Fluid reservoir captures its own waste fluid to eliminate slip hazards.

Flash Flood utilizes sealed cartridges that contain one gallon of preserved and pH balanced Eyesaline solution. The Flash Flood delivery system offers immediate, hands-free eye flushing - It is portable to meet the needs of changing workplace hazards. Removing the pull strap easily activates the system, while dual nozzles provide flushing to both eyes simultaneously. When activated, Flash Flood delivers Eyesaline solution for three minutes.

PART # PRICEPorta Stream II SPERPORTAII $299.99

PART # PRICEPure Flow 1000 SPERPURFLW $405.18

PART # PRICEFlash Flood Station SPERFLSH $132.71

A. Sperian Saline Wall Station

B. Sperian Fendall Porta Stream II

C. Sperian Fendall Pure Flow 1000

D. Sperian Flash Flood Station

PART # PRICESingle Bottle SPER0462A $29.99

Double Bottle SPER0462B $36.99

A

B

C

D


we carry


Don’t let potential Spill Hazards turn into dangerous and costly events- Our Spill Kits are designed to protect you against Oil Spills, Hazardous Chemical Spills, or other spills. Spill kits contain specially formulated sorbent socks and pads designed for these specific events.

Industrial Spill Kits

Loose Sorbents

PART # PRICE5 Gallon: Oil Only SPILL5GO $49.99

5 Gallon: Hazardous SPILL5GH $49.99

5 Gallon: Universal SPILL5GU $49.99

20 Gallon: Oil Only SPILL20GO $110.99



50 Gallon (wheeled) : Oil Only SPILL50GO $359.99

50 Gallon (wheeled) : Hazardous SPILL50GH $359.99

50 Gallon (wheeled) : Universal SPILL50GU $359.99







A A

B

C

D

E

B

C

D

E

Recycled Loose Cellulose Absorbent soaks up oils, coolants, solvents, water, fuels and antifreeze.

Recycled paper waste absorbs five times as much as clay, without the dust. Fast wicking, non-abrasive and non-toxic.

PART # PRICECellulose (30 lb bag) SORBCELL $15.99

PART # PRICELite-Cell (25 lb bag) SORBLITE $17.99

PART # PRICECellulose (40 lb bag) SORBCOB $19.99

F. Cellulose

G. Lite-Cell

H. CornCob

F G H


Outer layers of tough-skinned, HeavyWeight SpunBond material resist abrasions and tears — can withstand rough handling and won’t tear apart when pulled or positioned under equipment. It’s ideal as a liner for oily parts and tools or for use in rugged applications near machinery.

Loose stacked-weave design increases surface area on spill. Mat starts wicking on contact to save time in critical situations. Works equally well on land or water — it even floats when fully saturated. Oily grunge can’t hide on bright White MeltBlown Mat. Makes it easy to see when it’s fully saturated — you save money by not throwing it away too soon.

See a drip? Rip off a FineFiber Mat Pad from this handy 20-sheet Tablet — and the spill is history in a snap.

Multi-perforations provide easy access to sorbents for quick leak-and-spill response;

center.

Hang tabs let you put it anywhere in your plant for convenience, while rigid cardboard backing allows Tablet to tuck under your arm for on-the-go use.

Rugged SurvivorSeries™ Mat Roll is strong for your toughest jobs. It survives the punishment of everyday wear and tear. One product is all you need! Use conveniently packaged All-in-One SurvivorSeries™ Mat Roll as a Roll, Pad or a Sock. Handy dispenser box keeps Mat clean and can be stored anywhere for easy access.

This innovative Mat features a SpunBond top layer that wicks liquids away into the MeltBlown core where it is trapped to keep the Mat and floors safe and dry. The bottom layer is built of densely woven strands of FineFiber to increase surface area, enabling the Mat to grip the floor and securing it for safer walking.

A. Heavyweight Sorbent Mats - Universal

B. Heavyweight Sorbent Mats - Oil Only

C. Drip and Rip Tablet

D. Survivor Sorbent Roll - Universal

E. Survivor Sorbent Roll - Oil Only

PART # PRICESorbent Mats: Universal (100/pack) TMATUNIH $48.99

PART # PRICESorbent Mats: Oil Only (100/pack) TMATOILH $49.99

PART # PRICEPack of 9 Tablets TDRIPRIP $99.99

PART # PRICESorbent Roll: Universal 15” x 150’ TSSUNI $35.99

PART # PRICESorbent Roll: Oil Only 15” x 150’ TSSOIL $49.99

A

B

C

D

E


The ERGOMAT Advantage

ERGOMAT anti-fatigue mats were developed specifically to solve the problems of short-term fatigue and long-term injury associated with standing work positions.

By providing an elastic surface to stand on, an ERGOMAT stimulates muscle activity in feet and legs. As described above, this is important for the proper function of the venous pump and hence for the prevention of fatigue and injury.

For pric

The perfect mat for the food industry as well as for laboratories. Designed for easy cleanability and daily sanitation. Available in 4 vibrant colors for easy identification and cross contamination

Color: Green, Gray, Blue & Red Warranty: 3 years

An anti-static mat that is ideal for dry and non-abrasive areas and where static electricity is present. Perfect for assembly and

Color: Dark Charcoal Warranty: 8 years

A great mat for areas where heat, oil and petrochemical

and has great anti-bacterial cleanability properties. Complies to

Color: Black Warranty: 3 years

Same characteristics as the Nitril matting, but in a smooth version for areas with trolleys and carts.Color: Black Warranty: 3 years

Ergomat Classic


NO MOREZZZZZZZ'sSay goodbye to your old boring training tapes.Welcome in a new era of exciting, sleep-free environmental health and safety training.

dŚĞƐĞ�ǀŝĚĞŽƐ�ĨĞĂƚƵƌĞ�,ŝŐŚ�YƵĂůŝƚǇ��'/�ĂŶŝŵĂƟŽŶ�ĂŶĚ�ƉƌŽǀŝĚĞ�Ă�ŇĞǆŝďůĞ�ƐĞƚ�ŽĨ�ƚƌĂŝŶŝŶŐ�ƚŽŽůƐ�ƚŚĂƚ�ĐĂŶ�ďĞ�ƵƐĞĚ�ŝŶĚŝǀŝĚƵĂůůǇ�ĨŽƌ�ĨŽĐƵƐĞĚ�ƐĂĨĞƚǇ�ŵĞĞƟŶŐƐ�Žƌ�ŝŶ�ƉĂĐŬĂŐĞƐ�ĂƐ�ƉĂƌƚ�ŽĨ�ĐŽŵƉůŝĂŶĐĞ�Žƌ�ĐĞƌƟĮĐĂƟŽŶ�ƚƌĂŝŶŝŶŐ͕�ƐƵĐŚ�ĂƐ�K^,�ͲϭϬ�,ŽƵƌ�ĨŽƌ�ĐŽŶƐƚƌƵĐƟŽŶ�Žƌ�ŐĞŶĞƌĂů�ŝŶĚƵƐƚƌǇ͘

Asbestos Awareness Training

Confined Space Awareness

Ergonomics

Fire Extinguisher Safety Fire Safety

First Aid for EmergenciesFirst Steps in All First Aid EmergenciesFormaldehyde Awareness

Ladder SafetyLaser SafetyLead AwarenessLockout Tagout

& more...

CTAERCTASBCTBBPCTCSACTELECTERGCTESCCTFPPCTFESCTFSTCTFCICTFAECTFSTCTFAWCTHPTCTHSFCTHCMCTHCVCTHSACTLSFCTLASCTLAWCTLOTCTPEDCTPERCTRADCTRESCTSWP

or available as topic-specific DVD bundles

Training DVD Topics

$129 ea.

For video details and samples, visit us at:



Lockout/Tagout Solutions

Brady’s Personal Basic Lockout Kit contains the basic devices needed to lockout common breakers, valves and plugs.

Our combination lockout satchel gives you everything you need to lockout the most common mechanical and electrical control points.

A. Brady Personal Basic Lockout Kit

C. Brady Combination Lockout Satchel

B. Brady Lockout Keyed-alike Kit

PART # PRICEBasic Lockout Kit BRADLOTO1 $138.99

PART # PRICELockout Satchel BRADLOTO3 $369.25

PART # PRICELockout Keyed-alike Kit BRADLOTO2 $99.99

Includes

Includes

IncludesA

B

C


ready access to locks, tags, lockout devices and information.

Perforated card stock tags come with detachable key stub, making it easy to match up a tag’s padlocks with the right key. Matching identification numbers are printed on each

A. Bilingual Safety Lockout Center

C. Lockout Tags w/ Detachable Key Stub

PART # PRICELockout Center LOTOCENTER $299.99

Includes

Our industrial strength lockout station includes a lockable, all metal, yellow powder-coated cabinet with one adjustable shelf. Lockout safety tips are conveniently located inside of door for frequent reminders of proper lockout procedures. Lockout station can be wall mounted or easily transported.

B. Mountable/Portable Lockout Station

PART # PRICELockout Station LOTOSTATION $499.99

PART # PRICELockout Tags (25/pack) 105368B $39.99

Includes

A

B

C


ARCAD helps facilities create safer working environments for individuals who service electrical systems by providing On-Line and PC based software tools for Short Circuit and Arc Flash Hazard Analysis. NFPA requires that any panel likely to be serviced by a worker be surveyed and labeled.

ARCAD service includes resources and tools allowing plant and facility managers and personnel to perform short circuit, incident energy, arc flash protection boundary, level of PPE calculations, and create customized arc flash warning labels themselves reducing the cost of obtaining compliance with OSHA, NFPA70E and new Canadian CSA Z462 standards.

ArcAD: Arc Flash Analysis & Label Software

PART # PRICEVersion 3.2 ARCAD32 $150.00

Version 4.1 ARCAD41 $220.00

Version 5.0 ARCAD50 $290.00

DC Advisor ARCDC $240.00

Calculation Modelsv3.2 v4.1 v5.0 DC

IEEE 1584 Empiricaly Derived Model

3 3 3

Lee method

3 3 3

3 3 3 Phase to Ground Arcs in Open Air 3

3

3 33 3

Warning Label Information

3 3 3 3

3 3 3 3

3 3 3

3 3 3

Language

3 3 3 33 3

Other

3 3 3 3

ArcAD Arc Flash Analysis Softwareby Arcad Inc.


Arc Flash Protective Gear

HIGH QUALITYMANY SIZE OPTIONS

COST EFFECTIVE

ANSI Z87.1, Z89.1

OBERONby

meets or exceeds



Coulmn Protectors are made from a semi-flexible and crack-resistant plastic and protect your facility’s columns from impact damage that can occur from tow motors and forklifts.

Column Protectors fit around most standard columns and can be installed by one employee in seconds. Easily removable for painting and construction.

intermolecular forces, tensile strength and solvent resistance. Post covers protect both vehicles and structures from expensive damage not only by absorbing impact but also by increasing visibility thanks to two reflective safety stripes.

A. Column Protectors

B. Post Cover

PART # PRICE4” x 4” Square, Small $189.00

6” x 6” Square, Small $189.00

6” x 6” Square, Medium $266.00


8” x 8” Square w/ FE Cutout, Medium $266.00

8” x 10” H Cutout, Medium CLMMD810H $266.00

9” Round, Medium CLMMD9RND $266.00


10” x 10” H Cutout, Medium CLMMD1010H $266.00


12” x 12” Square w/FE Cutout, Medium $266.00

14” x 14” Square, Large $266.00

16” x 16” Square, Large $266.00

18” x 18” Square, Extra Large $448.00

20” x 20” Square, Extra Large $448.00

12” x 24” Rectangle, Extra Large CLMXL1224REC $448.00

PART # PRICE4.5” x 52” POST1 $29.50

4.5” x 64” POST2 $33.50

7” x 60” POST3 $37.50

7” x 72” POST4 $41.50

A

B


Warning and protective bumper guards effectively prevent impact damage and protect your buildings, furnishings and equipment. They absorb even the hardest impacts, effectively reducing the risk of damage to property or injury to personnel.

Knuffi® Soft Edge Bumper Guards

A

G

B

H

C D

E F

LENGTH DIMENSIONS PART # PRICETYPE A. Corner Guard 5 Meters KNUFFIA $189.00

TYPE B. Edge Guard 5 Meters KNUFFIB $196.00

TYPE C. Surface Guard 5 Meters KNUFFIC $200.00

TYPE D. Surface Guard 5 Meters KNUFFID $250.00

TYPE E. Corner Guard 5 Meters KNUFFIE $204.00

TYPE F. Surface Guard 5 Meters KNUFFIF $197.00

TYPE G. Edge Guard 5 Meters KNUFFIG $210.00

TYPE H. Corner Guard 5 Meters KNUFFIH $263.00

JI

High contour dual lens with 180 degree distortion-free viewing. High impact anti-scratch polycarbonate lens.

Our goggles provide a wide, unobstructed field of vision and can be worn with most half-mask respirators and prescription eyewear while protecting against impact and splash.

I. Anti-Fog Safety Glasses J. Anti-Fog Safety Goggles

PART # PRICESafety Glasses SGLASSES $17.95

PART # PRICESafety Goggles SGOGGLES $7.95


A B C

Capable of being sprayed onto almost any surface and provide high visibility in night and low-light situations, the aerosol spray from Reflect-All offers safety options with just a quick spray.

With a quick-drying transparent coating of reflective microbeads that capture, intensify and reflect light back, this spray is a great solution for illuminating safety signs, dangerous objects, or equipment around your property.

Vinyl Up is a GREEN, non-toxic product, designed to assist the vinyl removal process, both indoors and outdoors. Vinyl Up is engineered to only remove vinyl, and will not remove paint form painted surfaces, or damage floors. It really shines when removing very old and difficult to remove vinyl tape and decals from floors or other surfaces.

Simply spray or wipe Vinyl Up ONLY on the vinyl tape you intend to remove and let the product sit for a minute or two- the Vinyl Up will penetrate the vinyl and attack the adhesive behind it. Sometimes a small amount of warmth from a heat gun or propane will assist the process. The vinyl will come up in large pieces, if not one whole piece, rather than breaking into small fragments.

SolidStepCote represents the most advanced technology available on the market today in non-slip floor coatings. It is an entirely green, water-based solution that dries crystal clear and creates an invisible anti-skid finish. It creates a lasting bond with practically any surface and reduces the need for regular waxing, buffing and other costly maintenance procedures.

SolidStepCote does not attract dirt, creates a protective barrier against stains and spills, and prevents grout from soiling and discoloration. Cleaning simply requires a mild detergent, or soap and water.

SolidStepCote is the best line of defense against slip and fall accidents. It is extremely durable and is designed to be used in demanding indoor and outdoor environments.

A. Reflect All Reflective Spray

C. Vinyl Up Spray

B. SolidStepCote Liquid Anti-Slip Coating

PART # PRICEReflect All (12 oz.) REFLECTALL $26.99

PART # PRICEVinyl Up (4 oz.) VINYLUP $19.95

PART # PRICESolidStepCote (1 Quart) $79.99

SolidStepCote (1 Gallon) $219.99

creative safety supply catalog

Documents