afsc october 2011 newsletter

www.afsc.org.au Conference Issue Oct 2011

1

Dear Readers,

Welcome to the Year of the Yin Metal Rabbit, Association of Feng Shui Consultants newsletter - October issue. In this issue, all articles are written by our Feng Shui Experts. There are case study, Feng Shui theories, Chinese Calendar, Decluttering and Classical Feng Shui.

Our editor for this edition is Edgar (Lok Tin) Yung.

The articles are:

Flying in Formation .by Anthony Ashworth

Chinese Calender .by Tyler J. Rowe

Classical Feng Shui & Retail Business.....by Howard Choy

15 Top Tips to Conquer Your Clutter ..by Kerrie Jennings

Feng Shui Case Study Birth Qi .by Edgar Lok Tin Yung

Classifieds..

List of AFSC Professional Members..

A Message from our President Dear Members,

I wish to thank everyone who participated in the AFSC Conference. You all helped to make it a great success. We received many positive comments, also a few criticisms. We value your constructive feedback so that we can endeavour to make the next AFSC event even more successful and enjoyable than ever. Please don't hesitate to send your useful comments to me. My continuing commitment as your president is to do everything possible to further the healthy development of the AFSC.

AFSC is currently undergoing an exciting transition and it is with pleasure that I invite you to participate in the process. The committee will be sending out more details about this soon discussing some of these proposed changes.

In this edition of the AFSC newsletter we have also chosen to include the names and where applicable, the websites of our Professional Members, for your benefit.

ContentofAFSCNewsletterprovidedbymembersanddoesnotnecessarilyreflecttheopinionsoftheAFSC.


2

Anthony Ashworth Feng Shui Consultant, as a university qualified interior and building designer, holistically brings all the aspects of a sacred, healthy and balanced home together in one place, your place. Not only does he bring a deep understanding of Feng Shui but also the principles of healthy non toxic home and a thorough understanding of how to apply a multitude of ancient traditions of sacred place. He also specialises in consulting and teaching the ancient Indian form of Feng Shui called Vastu or Vastu Shastra. www.schoolofsacredplace.com

Flying in formation

The AFSC conference 2011 IwashonouredtobethisyearsMasterofCeremonies(MC).PartoftheroleofanMCistoweavetogethereachoftheindividualspeakersandthreadsofinformation,toidentifyandexpoundthegreatertapestrythatistheconference.Thisrequiredandenabledmetoreallyfeelintotheenergythatweall,asacommunityofpractitionersofthesacred,created,orasspeakerVicKetiswastolatertoremindus,asacommunityofhealers.ForthatisindeedabigpartofourroleasFengShuiconsultants,tohelpourclientstohealby

providinggenuinesupportforthem,andbyenablingtheirownhomesandplacestofacilitatethathealing.


3

Theconferencebeganwithaproverbialandancientbang,wellaseriesofloudanddramaticbangs,withfantasticmythicalloinsaccompaniedbydrumming,metalcymbalsandChinesechanting.TheLionDancewasanexplosionofenergyinjectedintotheverystartoftheconference,aliteralcleansingofthespaceandcelebrationoftheevent.TheLionDanceisatraditionalChineseceremonywiththelionbeingasymbolofpower,wisdom,andgoodfortune.Thedance,soundsandchantsaredesignedtochaseawayanyevilspiritsandnegativeenergyandencouragehappiness,longevityandofcourse,theeverrequiredandmuchspokenof,goodluck.Asapracticingshamanmyself,Iworkwithandthereforeappreciatethepowerofanimalspirits.Thepowerandmajestyevokedbythesedinosaursizedmulticoloured,lightflashing,gapejawedmythicalpuppetswaspaplpable.They,alongwiththeiraccompanyingChinesepercussionband,broughtinarealsenseofoccasion,ceremonyandsacrednessinafunandthrillingway.

TheconferenceroomitselfwasoneofbestIhavehadthepleasuretobein.Oftenconferencesarerelinquishedtothedarkbowelsofahotel,butthisspacewasverylightandairy,andfeltgreat,asitshouldbeforahallfullofFengShuimenandwomen.Thelionsliftedthespaceandusalongwithit,yethigher.Abeautifulmetaphorforwhatweourselvespractice,anddoforothers,liftandfillspacesandplaceswithfresh,enlivened,positiveChi.

Thefocusandcontentofthe2011conferencewasinlargepartbasedonasurveytheCommitteehadtakenearlierintheyearwheremembersoftheAFSCwereaskedwhattheyfeltwouldbestservetheirneeds.TheoutcomewasanemphasisplacedonthepracticalapplicationofprofessionalFengShuiandsupportiveinformationtoexplorewideraspectsoftheart.Forinstance,welookedattheplace(ifany)ofintuitionforFengShuiexponents,aswellastheapplicationoftraditional,moresystematicapproaches.Thespeakersandtopicsofthefirstdaywereofawidevariety,withtheseconddaydedicatedtoexploringactualclientcasestudies,aspresentedbysomeofAustraliasandtheworldstoppractitionersandmastersofFengShui.

OurnewpresidentJodiBrunneropenedtheconferencewiththeannualgeneralmeeting.Manyfactsandfigureswerepresentedalongwiththankstooutgoingcommitteemembers,andwelcominginthenewcommittee,allofwhomgivetheirtimeandconsiderableenergyatnocharge.Whatstruckmewasjusthowmuchthesededicatedmembersactuallydoonourbehalf.ItreallyisaselflessservicetoourFengShuicommunityandwealloughttobeverygratefultothem.MaytheirKarmicbankbalancesbefullofprosperityandlove.


4

OuropeningspeakerwastherenownedCanadianpractitionerJerryKing,aMasterofthepoeticartandscienceofFengShui.JerrysfocuswasonRelationships.Manyclientsseekourguidancespecificallytoimproveorbringinarelationshipintotheirlives.PartofJerrysfocuswasontheenergyandpotentialpitfallscreatedinandbyourbedrooms.Iwillnowbeevenmorevigilantaboutawarenessof,amongstmanyfactors,whatisactuallyoverourbeds.Weallrecognisebeamsasbeinganissue,butJerry

broughtawholenewperspectiveonthisandwhatisreallyhappeningtotheflowofdamagingSharChi.Iamnowmuchmoreawareoftheenergyoftheshapeandpositionofoverheadlights,letalonethepotentiallypowerfuleffectsasimpleemptyvasemayhaveupondispersingrelationshipenergy.ThisistomentionjustacoupleofthemanyissuesJerrymadeusmoreawareof.

FollowingJerrywasaninformativeintroductiontooneofthesponsorsproducts,FengShuiPhotoArt.HereRobertFretwellshowcasedhisbeautifulandwellthoughtthroughimages.Icanattesttotheenergeticandbeautifulqualityofhisartwork.Itreallyisagreatresourceforpractitioners,checkhimout.

Afterarathersumptuousmorningteabreak,TylerRowepresentedhisresearchintoClassicalChineseBuildingCeremonies,includingreferencestoChinesespaceclearing.TylerlatertoldmehewasinspiredtoresearchthistopicafterhearingapresentationIhadgivenatlastyearsconference,onIndianVastu.HesaidhefeltthatFengShuiwasacompletesystem,lackingnothingandhewassurprisedhehadnotcomeacrossinformationsimilartothatonVastu,butbasedonFengShui.SohesetaboutresearchingoldandobscureChinesecarpentrytextsandasisTylersway,hefounditandthenopenheartedlyfelttosharethiswithallofus.

AcoupleofquotesfromthetextsincludeaninstructiontocarpenterstoUnderstandthespiritbehindbuildingandsomethingInagmybuilderstodo,Buildwithlove.AndanotherwasTheghostsofthedepartedwillnotusetheirspiritualpotencytoharmlivingpeople.


5

Iamnowwonderingifthatcamewithaniforanaslongaswedosuchandsuch?TylersPowerPoint,includedthereferencestotheactualtranslatedancienttexts,asavailableinournationallibrary.HiscompleteslidesaretobepostedontheAFSCwebsite,sohaveareadformoredetail.

WethenjourneyedtosubtleplanesandthroughtheveilwithPaulFentonSmith.Paul,arenownedpsychicandintuitive,spoketousaboutthecordsofenergythatconnectustoothers,andhowmanyofusbearmanyofthesecordsandformanyyearsafterwehavecompletedtheserelationships.Headvisedusonhowtoidentifyandseverthesepotentiallynegativeconnections.Healsospokeofhowweallleaveourenergeticfootprintsbehindinspacesandhowimportantitis,especiallyforhealingpractitionerstospaceclearregularly.Paulnolongerworksfromhealingcentresastheycontainjusttoomuchnegativityforhimtoeffectivelyhealothers.OneofthemethodsPaulsuggestedtohelpempowerandembraceourintuitionwastokeepanintuitivediaryofalltheintuitivehunches,instinctsandpremonitionsweallfeel.Paulhassinceadvisedhereallyenjoyedusanaudienceandhasofferedtoaddressusagain.Itmayalsohavesomethingtodowiththefacthecompletelysoldoutallthebooksetchebroughtalong,angoodindicationofhowwellhistopicwasreceived.IfeelhemaywellhaveanumberofusathisfuturecoursesinSydney.

Thencameourlusciouslunchinthehotelrestaurant,whichwasincludedinthemodestconferencefee.Sumptuousfarewhich,likethewholeconferencewascarefullypreparedtobefullofvitalChi.

AfterlunchKatinaBenisspoketousabouttheimportanceofpsychicprotectionandhowweneedtobeawareofthisinourconstantenteringofotherpeopleshomesandenergies.Katinaspokewarmlyofherfamilysfolktraditionsaroundprotectionandsuggestedmethodswecouldallusetoprotectourselves.AsPaulhadpreviously,shepointedouttheimportanceofsaltsinfusedbathswhenwefeelweneedtoletattachedenergygo.

NextontheplatformofwasourillustriousleaderandPresidentJodiBrunner.Jodisharedaspectsofsomeofhermanyyearsofexperienceasarecognisedandverysuccessfulpractitioner.Includinghowtogiveandleaveagoodimpressiononyourclientswithsimplewaysonemayusetoimpressthem,suchasusingyourLouPancompassonsiteinfrontofthemandeventojusttocheckthesittingandfacingdirection.JodirecognisesclientsseetheLouPanasamysticalandmagicallyindecipherabledevicethatimpressesthemandendearsthemwithrespectforwhatweareabletobringtothem.Jodispokewithsuchenthusiasmthatshedeliberatelyspokerightthroughherscheduledopportunityasasponsoroftheconference,topromoteherownFengShuishopandsupplies.Agenerousgesturethatwastypicaloftheenergyoftheconference.

ThefinalspeakerforthedaywasVicKetis.Vicspokefromhishearttoourhearts,bringingtheenergiesofthecosmosdowntoearthwithusinthemiddle.Hespokeaboutthewisdomneededtoseeandfaceuptothecurrentworldturmoilandconsequentlyourownpotentialinnerturmoilintheseseeminglydifficulttimes.Lineup,lineup,haveyourcrisisnowavoidtherush.HespokeabouttheenergyoftheAgeofEight,


6

theyearoftheGoldenmetalRabbitandhowweashealersarebeingcalledintobeingbythecosmicastrologicaleffectsoftheplanetoidChiron.

ChironsenergyisthatofThewoundedhealerandthehealerofallthesignsofthezodiac.WeasFengShuicounsellorsarehealersourselvesandwemaywellbeaskedtobringtothesurfaceallandanyofourowndeepissuestobehealedfirst,inorderthatweareabletotakeourclientsforwardandthoughthesedifficulttimes.Wecanonlytakeotherswhereweourselveshavegonebefore.IfindVicssharingisalwaysmorethanjustknowledge.Hebringsindeepwisdomandreflection,seeminglyspeakingtoeachofuspersonally,aswellasthecollectivegroup.

Just some of the conference attendants in the Chinese Gardens

DaytwowasadayofdeeplearningandgeneroussharingwithsomeofFengShuisleadingpractitionersandmastersoftheart,sharingrealcasestudies.SeeinghowotherpractitionersandmastersdealwithactualcasestudiesisaprofoundwaytoexpandonesapproachtoFengShui,irrespectiveofhowmuchexperienceonehas.Daytwocertainlydeliveredthis.Ourgratitudegoestothepresentersforsharing.

TheconferenceconcludedwithavisittotheChinesegardens.IunfortunatelywasunabletoattendsoheresJodistakeontherestoftheday:

TheChineseGardenwassimplyalovelywaytowinddownaftertheconference,sipChineseteaandeatdimsumorscones(orboth!).AfterwecircumnavigatedthegardensandfollowedAnthonysadvicetogotothetopmostpoint,thePagoda,andtherecontemplateourlife'sjourneyandwhereweareheaded(orsomethinglikethat...).IfeltverycalmandpeacefulwhenIleftthegardens.It'sapitysomeofourmembersdidn'thaveenoughtimetocomeandjoinus.Jodi.


7

Gale Atherton presenting a case study Edgar Yung presenting a case study Perrie Burton presenting a case study

Inreflection,Iwanttoencouragemoreofourmemberstoattendtheseconferences.Theyareachancetoconnectwithotherswhodowhatyoudoandwhosharesimilarexperiences.WhatIfindisourconferencegoeswellbeyondtheinformationthatispresentedonstage.Thehallwaycoffeebreakconversationscanbeequallyimportant,asaretheamazingcontactsonemaymake.ThesesAFSCconferencesenlivenandinspireonetobuildandimproveonesFengShuibusinessandtopursueyetgreateranddeeperknowledgeofFengShui.Theyallowustofeelwebelongtoacommunity,afamilyoflikemindedandlikeheartedpeoplewhoshareourpassionforFeng

Shui,alargeroomfullofpeoplewhogetyouandgetwhatyoudo.Whodoesnotwanttobeunderstood,appreciatedandencouraged?ThebenefitonecangetfromgettingtogetherwithotherFengShuipractitioners,manyofwhomhavetotallydifferentapproaches,cannotbeoverstated.IwillendthisarticleasIstartedtheconferencewithasmallstoryaboutflying.

Aconferencesuchasthisoneisnotunlikeaflockofbirdsflyinginformation.Birdsflyinformationforagoodreason.Itsimplytakesalotlessenergytoflythatway.Itsfaster,easierandmoreenjoyableasagroupandinformation,andaconferenceisaformationtoo.Thebirdsreceivemuchgreaterliftwhentheyflythisway,upto85%more.Soletsalllifteachotherupandtogetherinformation,wecanthenflyevenfurtherandenjoytherideevenmore.

WrittenbyAnthonyAshworth

Jodi thanking Anthony Ashworth for his case study and for being our MC


8

Tyler is a registered Chinese Medicine practitioner. He holds bachelor degrees in Acupuncture and Chinese Herbal Medicine, a diploma of Chinese Massage, Certificate IV in Feng Shui as well as certification in Chinese Dietary Therapy, Chinese Astrology, Qi Gong and Taichi.

Tyler has been studying, practicing and teaching Traditional Chinese Medicine and related arts for more than 15 years. He regularly presents at conferences, runs seminars and writes articles for professional journals. A healthy, fit and knowledgeable presenter, his enigmatic style and sense of humour embody the enjoyment that can be gained through dedication to good living. www.chinadragon.com.au

The Chinese Calendar

Tyler J. Rowe BTCM-Acu BTCM-Chm Dip-Tn CertIV-Fs Cert-CA Cert-ONM

In modern practice, Chinese Astrology requires little study of the stars and skies (see previous article by the author entitled Traditional Chinese Astronomy). It does however require a basic familiarity with the Chinese Almanac. Furthermore, having a broader knowledge of the Chinese Calendar - its development, construction, correspondences and applications, is likely essential to achieving greater depth of understanding in the popular methods of fate calculation and divination available today.

The Chinese Calendar has had many incarnations throughout its long life of somewhere between of 3,500 5,000 years. It has been known variously as the Xil 1st Dynasty Calendar, the Nngl Farmers Calendar, Xngl Astral Calendar, Ynyngl Luni-solar Calendar, Wnninsh 10,000 Year Book and as a vital component of the Chinese Almanacs - Hungl Emperors Calendar and the Tngsh Know-all Book.

Incorporating the Chinese Calendar, the Tongshu is the longest continually printed book in history. Often rewritten, reformed and recalculated by succeeding dynasties and emperors, its release each year was a symbol of power and right of rulership. Over the centuries it absorbed Daoist, Confucian, Buddhist, Muslim and even Christian influences. Every home has one and because of this it has become a talisman, often hung on red ribbon behind the door and burned at the end of year.

Its use is in Chinese Metaphysics is chiefly temporal rather than spatial ie. time over space. The calendar shows the mathematical rhythm of the cycles of nature through observation of the heavens. It is important to recognise though, that predictions made from the calendar are based on arithmetic procedures, not the geometry of celestial bodies. It is inherently problematic to rely solely on examination of the stars in the present to foretell future events, we are simply too out of sink with nature to fully understand its ways. Early Chinese astronomers only needed to be seen not to be wrong (eg. as long as the full moon appeared roughly when forecast), some degree of approximation based on averages is always necessary in any calendar construction. The figures generated by these computations are, after a certain point, affected significantly by cosmographic change. Similar our own modern Gregorian Calendar, the Chinese Calendar is of the sfn quarter remainder type, measuring 365 days between solstices.

The solar calendar, reflecting the cycle of the sun and its seasons, had its origins in farming, but is now utilised in the majority of astrological calculations. It numbers the days, months and years. The lunar calendar, predicting the phases of the moon, is almost exclusively used nowadays in the determining of the various Chinese festivals throughout the year. In both cases there are exceptions. The Zwi Dush Purple Star Astrology practitioners often use the lunar calendar for their chart calculation. This anomaly is perhaps owing to the fact that the method seems to be an early amalgam of eastern and western astrology, bearing traces of Hellenistic, Hindu and Persian influence. One exception from the solar calendar is the Qngmng Festival where many Chinese visit the graves of their ancestors to pay respects. Its date is fixed on April 5th yearly. Every year it causes as much confusion in a traditional culture (that determines events based on the lunar calendar) with regard to the date, as finding Chinese New Years day does to us.


9

From these basic units of measurement, the sun and the moon, came the building blocks of the calendar. Of course their cycles are not entirely predictable in any usable manner, so at times the calendar will merely effect a compromise of man-made theory and the actual positions of heavenly influences like our leap year. The primary solar indicators on the calendar are the jiq Seasonal nodes (also known as Solar terms). These are twenty four seasonal markers traditionally used to assist with the planting of crops. They occur around the same date each year in the solar calendar and include the solstices and equinoxes. There are both minor (also called jieqi) and major ( zhngq) terms which are odd and evenly numbered. The summer periods are longer as the ecliptic causes the sun/earth to move more slowly when further apart. They are determined by equally spaced intervals of 15o along the horizon, measuring the path of the sun.

+/-1 Chinese English Interpretation Deg Feb 4

Lchn beginning spring According to the Chinese

seasonal definition, new year festival

315

Feb 19 Yshu

rain water Temperatures increase making rain more likely than snow

330

Mar 6 jngzh ( qzh)

awaken insects Hibernating creatures rise 345

Mar 21 chnfn spring divide Spring Equinox 0 Apr 5 qngmng clear bright Skies are clear and sun is

strong, Ancestral offerings festival

15

Apr 20 gy

grain rains Rains assist in grain crop growth

30

May 6 lxi

beginning summer According to the Chinese seasonal definition

45

May 21 xiomn small fulfilment Grain crops begin to bear fruit 60 Jun 6 mngzhng awns grow Beards of grains grow, grain

ears 75

Jun 22 xizh

summer extreme Summer solstice 90

Jul 7

xiosh minor heat Heat starts to rise 105

Jul 23 dsh

major heat Hottest days of the year 120

Aug 8 lqi

beginning autumn According to the Chinese seasonal definition

135

Aug 23 chsh

dwell heat Limit of hot weather 150

Sep 8 bil

white dew Condensed moisture changes colour

165

Sep 23 qifn

autumn divide Autumn equinox 180

Oct 8 hnl

cold dew Frosts begin to form 195

Oct 24 shungjing frost falls Temperature drops 210 Nov 8

ldng beginning winter According to the Chinese

seasonal definition 225

Nov 22 xioxu minor snow Light snow starts falling in colder regions

240

Dec 7 major snow Snow falls more heavily 255


10

dxu everywhere Dec 22 dngzh winter extreme Winter solstice 270 Jan 6

xiohn minor cold Cold starts to increase 285

Jan 20 Dhn

major cold Coldest days of the year 300

Table 1. THE 24 JIEQI SEASONAL NODES

Chinese new year currently starts at the second new moon after dongzhi winter solstice usually after dahan and during lichun.

The primary lunar indicators are the lunar months. They begin at begin at midnight of the full moon, 14-17 days after the new moon. The moon does not have a set cyclical time but due to intricate variations in its orbit (making it actually move faster and slower at certain times) ranges from 29 - 29 days, with a mean average is 29.53 days. The Chinese lunar month measures 29-30 days in length, each year is made up of roughly six xioyu small months of 29 days, and six dyu big months of 30 days (this will be out of time with the actual phases of the moon by 1 day every 30 months, therefore an extra big month added at this point). The short/long months are not alternating due to the complex nature of the moon itself.

# Chinese English Longitude 11 shyyu eleventh month 270 12 shryu twelfth month 300 1 zhngyu first month 330 2 ryu second month 0 3 snyu third month 30 4 syu fourth month 60 5 wyu fifth month 90 6 liyu sixth month 120 7 qyu seventh month 150 8 byu eighth month 180 9 jiyu ninth month 210 10 shyu tenth month 240

Table 2. THE LUNAR MONTHS

The 12 lunar months total 354 days, which is short of a full solar year. To compensate, every 2-3 years a leap month called a rnyu Intercalary month is inserted, carrying the same designations as the preceding month. Seven of these occur every nineteen years (19x12+7 = 235 months = 1 zhng rule cycle of 19 years). The addition is made whenever the sun remains in one jieqi seasonal node throughout the entire month, hence not entering into a new sign or containing a zhongqi. This commonly occurs in the 2nd to 9th months, never the 1st, 11th or 12th. The complex nature of this process and subsequent difficulty in their understanding has lead to an inaccurate superstition of these being labelled bad luck months.

By far the most important indicator to the Chinese Astrologer though, is the Gnzh Stem branch cycle. The jiz sixty combinations of the twelve dzh earthly branches and the ten tingn heavenly stems are utilized to specify years, months, days and hours. The founding of the cycle and therefore beginning of the calendar is attributed to the legendary semi-mythical sage-emperor Hungd Yellow Emperor in the 61st year of his reign 2637 BCE. The stems and branches apply exclusively to the solar calendar their calculation is based on the position of the sun. The rise and fall of sun determines days, however the rise and fall of moon does not determine nights. Lunar calendar months and days are merely numbered, they are not represented by ganzhi of their own. This is why the lunar calendar months (or days) cannot be used in calculating Szh Bz Four pillars, Eight characters astrology. Most Chinese calendars and almanacs show the stem branch combinations for the year, month and days, with tables provided for calculating the hours. Every cycle of sixty years is called a yun era and as all


11

Xunkng Fixng (Mysterious Void) Flying Star practitioners know, each of these is divided into three yn age of 20 years each. Calendrical studies also incorporates a number of greater cycles including B obscuration cycle of 76 years, equalling 4 zhang rule cycles (19 years, see above). This indicates the time taken for winter solstice and the new moon to fall together at midnight. j Era cycle of 1520 years, equalling 20 bu obscuration cycles (or 80 zhang rule cycles). Indicative of the time taken for winter solstice, the new moon and the 1st day of the jiazi to all fall together at midnight. yun Epoch cycle of 4560 years, equalling 3 ji era cycles (or 60 bu obscuration cycles or 240 zhang rule cycles). This is the time taken for winter solstice, new the moon, the 1st day and the 1st year of jiazi to all fall together at midnight. shngyun Great epoch of 9120 years or 2 yuan Epoch cycles. Largely theoretical this suggests all the above plus an alignment of five planets. It is however numerically based, exact conjunctions are much rarer. Whilst these seem of little significance to the reading of an astrology chart, they do clearly display the intense research and formulation that went in to the current calendar used today.

The next layers to the calendar are the hundreds of different systems auspicious and inauspicious portents of the individual days, known commonly as stars. There are over 350 of these imaginary stars, good and bad. Encyclopaedic entries on almanacs (which comprise of uncalculated formulas good for any year) give directions for their application and functions. Some are named after reals stars, while many others are given personalities, named for heroes from popular novels. Two of the major groups are tingng heavenly gods (numbering 36) and dsh earthly demons (numbering 72). The number of activities associated with them has increased over time, up to almost one hundred. They signify predictable regularly recurring forces that substantially encourage or interfere with specific human actions and activities.

Firstly the Zbi Purple-white system. Based on the famous nine stars of the Bi du Northern dipper the cycle repeats in an anticlockwise manner for years and a clockwise manner for months and days.

# Chinese English Portent 1 Bi White favourable 2 Hi Black unfavourable 3 B Blue unfavourable 4 L Green unfavourable 5 Hung Yellow unfavourable 6 Bi White favourable 7 Ch Red unfavourable 8 Bi White favourable 9 Z Purple favourable

Table 3. THE ZIBAI PURPLE WHITE STARS

The Jinch shrshn Twelve spirits repeating portents is a second commonly found example. Its cycle begins with the Yujin Establishing month on the 1st day dizhi earthly branch matching that of the given month. Once a month (on odd numbered jieqi seasonal node days) one portent is repeated on two consecutive days to shift the sequence by a day. Each has lucky and unlucky implications dependant upon choice of deed.

Chin. English Auspicious Inauspicious Jin

Establish 10,000 things are generated

Cut out garment, pay bills, barter & trade, travel, set up posts

Digging, travel by boat, open stores and treasuries

Ch

Removal sweep away evil

Cleansing, wash & bathe, take purgatives

Wedding ceremonies, travel, open wells


12

Mn

Fulfil treasuries full to the brim

Wedding receptions, go on journeys, move house

Planting, cutting, unstopping water courses

Png

Balance official gathering & equal divide

Wedding ceremonies, move house, cultivating the way, whitewash walls

Planting, excavating ditches, cutting, open sluices

Ding

Stability five grains are in abundance

Cut, plant, organise weddings, yoke the ox & horse, dig the ground, open wells

Accusations

Zh

Manage administering heavens blessing

Wedding ceremonies, planting, cutting, open wells

Moving house, travel, open storehouses

P

Broken the stars indicate conflict

Face to face arguments, quarrelling

Going fishing, punishing criminals Wi

Danger winds blow fiercely

Great peril Be joyous, drink wine

Chng

Accomplish recording the lives of 10,000 things

Wedding receptions, long journeys, digging the earth

Casting aspersions

Shu

Receive precious treasuries received

Open granaries, trade, enter college, arrange weddings, be active, dig earth

Travel, arranging funerals, acupuncture and moxibustion

Ki

Opening messenger out of danger

Study crafts, complete business deals, arrange

Funerals & burials


13

wedding ceremonies, travel B

Closing burial and concealment

Set up placards

Most events

Table 4. THE TWELVE JIANCHU SPIRITS

There are many other systems for the addition of these fantasic stars to days of the year, but most follow a similar system of associating a known sequential cycle with benevolent and malevolent energies. By virtue of this, suitable and unsuitable uses of the day can be determined therein. The importance of the Chinese calendars to the culture of China and its people is displayed in their long history. It is this significance placed on understanding the cycles of the universe as plotted by the orbits, seasons, duodenal and various other cycles, that most probably led to the birth and development of Fate Calculation in the middle kingdom. The existence of the calendar makes this wisdom accessible. However, without a sound knowledge of the main factors that influence the calendar system, the solar and lunar components, the complexities and differences can be misunderstood and lead to errors in interpretation. Without this, predicting the recurring archetypal forces represented by the stars of Chinese Astrology, is all but pointless and without meaning.

Appendix Wnninsh 10,000 Year Calendar translation

1. Yubi Lunar months (see table 2), the forth month in this example is followed by a () rn intercalary month (see discussion above). 2. Gnzh Stem branch of the months. 3. Jixng Nine Star (see table 3) of each month.


14

4. () Mngu Peoples Republic (#101) nin year - the year of the current dynasty. 5. () Jiq Seasonal Nodes (see table 1), including the () sh time of the shu dark or new moon. Black boxes highlight their dates, start and midpoint of the month, within the calendar body. 6. () Nngl Farmers calendar, numbering the lunar days.7. Gnzh Stem branch of the day and the () Gul National calendar dates according the international standard Gregorian calendar. 8. () Suc Year order, the year stem branch.9. () Xl Western calendar (#2012) nin year the year according to the international standard Gregorian calendar. 10. () Tisu translated variously as Great year, God of year, Year Master, Counter Jupiter or Grand Duke, the xngmng Surname & given name of the specific god residing for the year. Each of the jiz sixty combinations is associated with a different deity. 11. xio Resembles () lng dragon, which animal of the shr shngxio Twelve birth emblems is associated with the branch of the year. References

Aslaksen, H. (2010) The Mathematics of the Chinese Calendar National University of Singapore

Aylward, T (2007) The Imperial Guide to Feng Shui & Chinese Astrology Watkins

Biaozhun Zhongxi Duizhao Wan Nian Li 10,000 Year Calendar (2003) Xuanxue Press

Cullen, C (2008) Astronomy and Mathematics in Ancient China: The 'Zhou Bi Suan Jing' Needham Research Institute Studies Cambridge University Press

Golding, R (2008) The Complete Stems and Branches Time and Space in Traditional Acupuncture Churchill Livingstone Elsevier

Liu An [translation Major, J.S.] (2010) The Huainanzi: A Guide to the Theory and Practice of Government in Early Han China Columbia University Press

Lo, Raymond (2011) Chinese Almanac 2011: The Book of Auspicious Days Feng Shui Lo: Hong Kong

Rowe, T (2010) Traditional Chinese Astronomy available online: (apply to the author)

Martin P. (1986) Tung Shu : the Ancient Chinese Almanac Shambhala Publications

Walters, D. (2004) The Complete Guide to Chinese Astrology Watkins publishing

Yoke Ho Peng (2003) Chinese Mathematical Astrology: Reaching Out to the Stars Routledge Curzon


15

Howard Choy is a practicing architect and his passion is in architecture and Taijiquan/Qigong, so Feng Shui is a perfect vehicle to combine these two life-long interests. http://www.fengshui-college.org/

ClassicalFengShui(KanYu)andRetailBusinessByHowardChoy(CaiHong),FengShuiArchitect

WhenprivateenterprisewasactivelyencouragedinChinabeforethecomingofCommunismin1949,therewasapopulareightcharacterssayingamongsttheChinesebusinesscommunity,thatifonewantstosucceedinbusinessthenoneshouldbeChengXin,RenYi,LiZhianduseKanYu.()

ThetwocharactersChengXincanbetranslatedasbeinghonestandtrustful,RenYiasbeingbenevolentandjust,LiZhiasbeingamanagerwithintelligenceandKanYuisanothernameforClassicalFengShui(asdiffertoNewAgeFengShui).ThefirstsixcharactersreferredtohumanbehaviourinbusinesswhilethelasttworeferredtotheuseofFengShuiinbusiness,togethertheyformedthecorefortraditionalbusinesspracticesinChina.

ManyoftheBainianLaodianorHundredYearsOldStores(lastingbusinessbrands),survivedandprosperedaccordingtothiseightcharactersformulaandKanYuFengShuiwasavitalpartofasuccessfulbusinessinoldChina.Nowadays,theemphasisintheWestisoninnovationinbusinessandwhilethatistruetoacertainextent,wecanalwayslearnsomethingnewfromtheoldwayofdoingbusiness,andusingFengShuitoimproveabusinessisagoodexample.

ExperienceshaveshownwithoutdoubtthatthepracticeofFengShuicanleadtoimprovedprofitandproductivityinbusiness.Eveninmoderntimes,mostAsianbusinesswouldnotproceedwithoutconsultingaFengShuiexpert.Thereasonbeingfindingasuitablesiteforaparticularbusiness,whetheritberetailorcommercial,isastartingpoint,andifwecanuseFengShuitocreateacomfortableandwelcomingenvironment,wheretheexteriorandtheinteriorarebothattractiveandeasytofindandnavigate,thenaffectionscanbedevelopedandcultivatedeasilyamongsttheworkersandcustomers,makingitanattractiveandviablebusiness.

ToatraditionalChinesebusinessowner,thefrontageofashoporanofficeisitsface,thefurnishingisitscloths,beinghonestandtrustfulisitssoul,havinggoodqualityproductsisitslifeandefficientserviceisitsessence.Thisstillholdstrueformostbusinessinourtimes,butwiththeadventofebusiness,theamountandthevarietyofgoodsthatcanbesoldhavegreatlyincreasedandthedemandforservicesandinnovationshavealsoincreasedtremendously.Peopledontjustbuysgoodsinthestoresorworkinanofficealldaylonganymore,makingtheFengShuiofabusinessenvironmentevenmorecomplexanddemanding.

ThisiswheresomeoftheprinciplesinherentinthepracticeofKanYuFengShuicancometotherescue,inparticulartheconceptofGanYing (mutualresonance)andYinYang(thetwocomplementaryopposites)usedintheinnerworkingsofClassicalFengShui.TheprincipleofYinandYangisself


16

explanatoryandtheprincipleofGanYingstatesthatforFengShuitoworkinpracticeitmusthaveGanYingormutualresonancebetweentheusersandtheobjectsbeingusedandbetweentheserversandthepeoplebeingserved.Sowhetheritisanebusinessoratraditionalbusiness,theremustbemutualresonancetakingplacebetweenpeopleandpeopleandbetweenpeopleandtheenvironment,withthisinmindwecanpositivelyenhanceonebusinessmodelwithanotherbasedontheprincipleofGanYingandYinandYang.

Forexample,ifeverythinghasYinandYang,thentheoldwayofdoingbusinesshasitsadvantageanddisadvantage;likewise,thesameistrueofanewwayofdoingbusiness.ThericksistoindentifytheYinandtheYangofagivensituationandfindaThirdWaytomaximizeontheadvantageousandtominimizedorgetridofthedisadvantageous,sothehybridcanworkbettertocreateamutualresonancethatwillbenefitthebusinessowners.

Takeasmallcountrystoreforexample,itmightnothaveenoughspaceorworthitswhiletoincreasethefloorspacetosellmoregoods,butwiththenewinternettechnology,thecustomersandturntoaterminalthatshowsthemamuchwidervarietiesofgoodsavailableelectronicallyandhavethestoreownerorthestoreassistantsexplaininpersonthetechnicalprosandconsandthevalueformoneyinvolved,sothecustomersarebetterinformedinapersonalfriendlyfacetofaceway,makingitawinwinsituationforboththebusinessandthecustomers.

ByusingKanYuFengShui,onecanhastentheauspiciousandavoidtheharmfultoimproveabusiness.

MainshoppingstreetinthecityofShenYang,thecapitalofLiaoningProvinceinNortheasternChina,duringthe1980s(topphoto)andduringthe1930s(bottomphoto).

HowardChoyisconductingFengShuiforRetailBusinessesinMelbourneandSydneyin2012.

Melbournedates:1114February2012attheKilbrideCentre

Contact:[email protected]

Sydneydates:1821February2012atttheCrowsNestCommunityCentre

Contact:JaneDempsterSmithon+61400982441oremailjane@fenghuangconsulting.com


17

Kerrie is passionate about helping you make positive changes in your life and believes that Feng Shui can help you achieve this.

Kerrie is a fully qualified Feng Shui consultant having completed Certificate 1V in Feng Shui at the Australian College of Environmental Studies. Kerrie is also a qualified horticulturalist who implements Feng Shui into her landscape designs for your garden. www.eagletreefs.com.au

15 Top Tips To Conquer Your Clutter Three Rules of Work: Out of clutter find simplicity; from discord find harmony; In the middle of difficulty lies opportunity. - Albert Einstein

Clutter is the physical embodiment of emotional baggage that we dont realise we are carrying around and by decluttering we are clearing ourselves of these old emotions that hold us back.

When we let go of clutter we are free to forget about those things and we can live life in this moment to appreciate life as it happens, instead of looking back on what has happened before, or looking forward to what might happen later.

Of course it is quite possible to live in the moment even if we do have clutter; but decluttering can be a beautiful process of helping ourselves let go of the things we dont realise were holding on to (emotionally, physically and spiritually).

When our homes are filled with clutter, trying to tackle a mountain of stuff can be quite overwhelming.

Here are two important questions to ask before we begin to declutter: 1. Why do we have clutter in the first place? 2. Why do we keep it when we dont really need it?

Often clutter comes in the form of emotional attachment to objects that have significance to us. They might remind us of a loved one, a holiday, or a special event like a birthday or a wedding or it might be a gift from someone.

These things are keeping us in the past and letting them is a way of releasing our hold on the past. Decluttering is a way of living more in the present.

Clutter might be things we think we might need again one day so we hold on to them just in case. We dont want to be unprepared for the future, but trying to do so means that were never really living in the present moment. Were always preparing for what might (or might not) come.

Now, look at your clutter carefully, one object at a time, and ask yourself why youre holding onto each object: Do you love it? Is it useful? Do you really need it?

Books are a good example of popular clutter we hold onto the ones we have already read as trophies of our reading accomplishments and we hold onto books we should read in the future to enhance our education or intellect (but probably wont).

I like to get rid of clutter a little bit at a time (I have a permanent charity box in my garage). In doing this I release any attachments, memories or fears. You should try it its very liberating!


18

So heres my advice: start with just five minutes.

Baby steps are important. Sure, five minutes will hardly make a dent in your mountain, but its a start. Celebrate when youve made that start! Then take another five minutes tomorrow. And again the next day. Before you know it, youll have cleared a whole closet or a room and then half your house!

For those who are overwhelmed by their clutter, here are 15 top tips to get started, five minutes at a time.

1. Designate a spot for incoming papers. Papers often account for a lot of our clutter. This is because we put them in different spots on the counter, on the table, on our desk, in a drawer, on top of our dresser, in our car. Designate an in-box tray or spot in your home and dont put down papers anywhere but that spot. Got mail? Put it in the inbox. Got school papers? Put it in the inbox. This one little change can really transform your paperwork. NB - Make sure you go through the inbox on a regular basis otherwise it will be overflowing (see next point).

2. Learn to file quickly. Once youve created a filing system, you just need to learn to use it regularly. Take a handful of papers from your inbox, and go through them one at a time, starting from the top paper and working down. Make quick decisions: trash them, file them immediately, or make a note of the action required and put them in an action file. Dont put anything back in the inbox, and dont put them anywhere but in a folder or in the trash/recycling bin.

3. Clear off a counter. You want to get your house so that all flat spaces are clear of clutter. Maybe they have a toaster on them, maybe a decorative candle, but not a lot of clutter. So start with one counter. Clear off everything possible, except maybe one or two essential things. Have a blender you havent used since that cocktail party last year? Put it in the cupboard! Clear off all papers and all the other junk youve been tossing on the counter too.

4. Pick a shelf. Now that youve done a counter, try a shelf. Could be a shelf in a closet, or on a bookshelf. Dont tackle the whole bookshelf just one shelf. Clear all non-essential things and leave it looking neat and clutter-free.

5. Schedule a decluttering weekend. Maybe you dont feel like doing a huge decluttering session right now. But if you take the time to schedule it for later this month, you can clear your schedule, and if you have a family, get them involved too. The more hands pitching in, the better. Get boxes and trash bags ready, and plan a trip to a charity to drop off donated items. You might not get the entire house decluttered during the weekend, but youll probably make great progress.

6. Spend a few minutes visualising the room. When Im decluttering, I like to take a moment to take a look at a room, and think about how I want it to look. What are the most essential pieces of furniture? What doesnt belong in the room but has just gravitated there? What is on the floor (hint: only furniture and rugs belong there) and what is on the other flat surfaces? Once Ive visualised how the room will look uncluttered, and figured out what is essential, I get rid of the rest.

7. Create a maybe box. Sometimes when youre going through a pile of stuff, you know exactly what to keep (the stuff you love and use) and what to trash or donate. But then theres the stuff you dont use, but think you might want it or need it someday. You cant bear to get rid of that stuff! So create a maybe box, and put this stuff there. Then store the box somewhere hidden, out of the way. Put a note on your calendar six months from now to look in the box. Then pull it out, six months later, and see if its anything you really needed. Usually, you can just dump the whole box, because you never needed that stuff.


19

8. Put a load in your car for charity. If youve decluttered a bunch of stuff, you might have a to donate pile thats just taking up space in a corner of your room. Take a few minutes to box it up and put it in your trunk. Then tomorrow, drop it off.

9. Create a 30-day list. The problem with decluttering is that we can declutter forever but it just comes back because we buy more stuff. So fight that tendency by nipping it in the bud: dont buy the stuff in the first place. Take a minute to create a 30-day list, and every time you want to buy something thats not absolutely necessary, put it on the list with the date it was added to the list. Make a rule never to buy anything (except necessities) unless theyve been on the list for 30 days. Often youll lose the urge to buy the stuff and youll save yourself a lot of money and clutter.

10. Teach your kids where things belong. If you teach your kids where things go, and start teaching them the habit of putting them there, youll go a long way to keeping your house uncluttered. Of course, they wont learn the habit overnight, so youll have to be very patient with them and just keep teaching them until theyve got it. And better yet, set the example for them and get into the habit yourself.

11. Pull out some clothes you dont wear. As youre getting ready for work, and going through your closet for something to wear, spend a few minutes pulling out ones you havent worn in a few months. If theyre seasonal clothes, store them in a box. Get rid of the rest. Do this a little at a time until your closet (and then your drawers) only contains stuff you actually wear.

12. Clear out your medicine and toiletries cabinet. Go through everything such as outdated medicines, the stuff youll never use again, and then do the same with your toiletries and make-up. Be ruthless, chances are you will never wear that blue eye shadow again. Simplify to only the essential (and in date).

13. Clear out the kitchen junk drawer. Just take the drawer out and empty it on a table. Then sort the drawer into three piles: 1) stuff that really should go in the drawer; 2) stuff that belongs elsewhere; 3) stuff to get rid of. Clean the drawer out nice, then put the stuff in the first pile back neatly and orderly. Deal with the other piles immediately!

14. Have a conversation with your partner or roommate. Sometimes the problem isnt just with us, its with the person or people we live with. An uncluttered home is the result of a shared philosophy of simplicity of all the people living in the house. If you take a few minutes to explain that you really want to have an uncluttered house, and that you could use their help, you can go a long way to getting to that point. Try to be persuasive and encouraging rather than nagging and negative.

15. Celebrate all your hard work by doing something you love. Invite friends around for a dinner party on your new uncluttered dining table, take a long leisurely bath in your uncluttered bathroom, or simply buy a bunch of fresh flowers to display on an uncluttered surface. Enjoy!


20

Edgar (Lok Tin) Yung, has been using Feng Shui and Chinese Astrology including Four Pillars of Destiny or Bazi and Zi Wei Duo Shu to assist the Chinese community in Melbourne, Australia, since 2000. Edgar has been regularly contributing Feng Shui and Chinese Astrology articles to two local Chinese weekly magazines since 2003. www.loktinfengshui.com

Feng Shui Case Study Birth Qi By Edgar Lok Tin Yung

I talked about this case at the AFSC conference in August 2011. I felt that the talk was not in great details. I should go a little bit more in depth here.

Dated back to early 2009, I was recommended to a Taiwanese couple Mr and Mrs Cheng. They were going to renovate their unit.

The property has 2 units, one at the back and the other is at the front. They were living at the back unit at the time. They wanted to renovate the front unit before moving in. So they could lease the back unit out.

I asked them what they wanted to get from the consultation. They said children. They married over 14 years but no children. She had a couple of miscarriages before.

I then looked at the surroundings.

The property is located near an intersection. The intersection can be seen as a water month or some experts called water gate.

The water month is very important in the Triple harmony (San He ) Feng Shui in relation to calculating the Qi coming into the house.

The 12 Earthly Branches form four triple harmony combines or groups. They are the fire combination

(Tiger, Horse, Dog); the water combination (Monkey, Rat, Dragon); the wood combination (Pig, Rabbit,

Goat) and the metal combination (Snake, Rooster, Ox).

Most people misunderstand that triple harmony combinations are the San He Feng Shui.

Well, not quite, the 12 Earthly Branches Triple Harmony combinations have some relation to the San He

Feng Shui School. The combinations are for calculating the auspicious and the inauspicious areas.

However the actual meaning of the Triple Harmony Feng Shui is that: The Mountain Dragon, the Facing

and the Water Dragon, these three most important elements must be in harmony. The Triple Harmony are

the Mountain, Facing and Water. It is not the Earthly Branches Triple Harmony combinations.

In Tian Yu Jin,() it says:

The Mountain Dragon must harmonize with the Facing and the Facing must harmonize with the water.

Water harmonizes with the three auspicious areas.

This is the real meaning of San He Feng Shui School.


21

As mentioned above the property is located near a water gate. Both units are facing east. The water gate is located at the North East in relation to the unit.

The Qi is coming from the Water gate where the red A in the photo. The water gate is also called the Tomb or Storage. The tomb Qi is very inauspicious.

The San He Feng Shui is all about the external Qi and its flowing direction. I have changed the Qi flowing direction in mirror image to the Northern hemisphere. (You may know that the direction of cyclones they spin depends on which hemisphere they are in. In the Southern hemisphere they spin in a clockwise direction and Northern hemisphere they spin in an anti-clockwise direction.)

According the San He Feng Shui Calculation, the house they live is Water combination.

After I have mirrored image the Qi flow. Here is the drawing showing what Qi they were receiving in the old house.

To mirror the QI into the South Hemisphere, just imagine there is a mirror place at the Equator.

From this drawing, the path to the house is catching the Extinct Qi. What happen by catching this Extinct Qi is that the female of the house is not easily pregnant or has high chance of miscarriage. This was exactly happening to them.

The front unit was similar to the back unit. They both face east. However, it was occupied by a single man (Mrs Chengs brother). So there was no issue about producing children.

With the children, offspring in mind, I have to change and manipulate the doorway be able to catch the birth Qi. Birth Qi is one of the important factors for offspring.

I told Cheng to totally seal up the existing doorway / entrance. And open another entrance at the North West sector. It is not simply just changed the locating of the entrance. They had to


22

change the drive way too. They need permit from the council too. Yes, it was costly. But he followed my advice.

He then spent much more money to relocate the main entrance.

Here is the drawing after the entrance is changed.

The entrance is now located at the Birth Qi sector.

After a few months renovation work, they moved in August or September 2009. In October Cheng rang me and told me that his wife was pregnant. (I thought you are working hard) He added that the Doctor said dont tell anyone yet since Mr Cheng was over 40 years old. But he said he cant wait to tell me.

I was so happy for him.

Due to her age, there were a few tested to be done. Other than that the pregnancy was quite smooth.


23

Mrs Cheng gave birth to a healthy baby girl in July 2010. She is a Tiger girl. Cheng and our family, become friend. We go out for meal once every 2 to 3 months.

The picture was taken when the baby was three months old.

Celebrate one year old birthday in China Town Melbourne.


24

Classifieds

ContentofAFSCClassifiedsispaidadvertisinganddonotnecessarilyreflecttheopinionsoftheAFSC.

Feng Shui Gold Fish are a symbol of wealth and prosperity The Chinese word for fish (yu) has the same pronunciation as abundance, affluence.

Traditionally eight Feng Shui gold fish and one black gold fish are placed in an aquarium to attract money. The number 8 represents prosperity in Feng Shui. If a black fish dies for no obvious reason it is believed that the dead fish has absorbed some bad luck that was coming your way. Another good number to use is 9, or a multiple (e.g 180 The number 9 is a very powerful number. It represents culmination and completion.

Besides gold fish, Fish World offers Australian Arowana which is legal. Scleropages Jardini is available for purchase. This is a famous fish that brings wealth and prosperity and usually kept as a solitary fish in an aquarium. When the Arowana is healthy, it will emit a pink or golden glow. This is said to bring good fortune. The Arowana is best kept in a the corner (water element), the Wealth corner wood element) and the Family corner (wood element).

The double fish symbol is also said to possess strong protective energies and it is a good enhancer of Sheng Chi.

Fish World looks forward to working with AFSC Feng Shui Consultants and offers a successful referral program.

Fish World Feng Shui

AFSC Members Earn 15% commission on each print Contact Robert Fretwell to discuss your requirements or send him an email, I've just done a consultation for *** at *** and recommended your beautiful Feng Shui prints. If they order, you'll know it was me who referred them."

www.fengshuiphotoart.com

+61 2 9818 3632

Fish World Feng Shui Aquariums Fish World Australia is an online aquarium store specialising in Feng Shui Aquariums, water features and Zen Aquarium products.

We provide Feng Shui Aquariums to corporate organisations and residential homes.

These beautiful and tranquil Aquariums that resonate the sounds of flowing water will bring a serene and tranquil ambiance along with the wealth and prosperity of good Feng Shui.

A maintenance and installation service is also offered as well as an option to lease or rent the aquarium. Businesses are able to claim the Aquarium lease as a legitimate tax deduction, provided it is used in a business premise.

Fish World works closely with expert Feng Shui Consultants and Architects to bring you the ultimate Feng Shui Aquarium that brings prosperity and good luck.

Website: www.fishworld.com.au

Email: [email protected]

Phone: (03) 9625 1234


25

ThisisalistofthecurrentAFSCProfessionalMembers.Shouldyouwishtomakecontactpleaserefertotheirwebsiteortowww.afsc.org.auforcontactdetailsandbio.

AFSCProfessionalMembers

ElizabethWiggins www.fengshuiliving.com.au

JudyMoar www.whitelightimpressions.com.au

AnjelaWong www.anjelawong.com.au

JodiBrunner www.fengshuimaster.com.au

DerelleBall www.centaineconsultants.com.au

CoralDiBella www.fengshuiastralforces.com.au

BrigitteSeum www.soulspace.info

JulieHicks www.juliehicks.com.au

VicKetis www.australianacademyoffengshui.com.au

KatinaBenis

NicoleBijlsma www.buildingbiology.com.au

JaneDempsterSmith www.fenghuangconsulting.com

LuiseLeggatt www.fengshuibetterlifestyle.com.au

LucindaCurran www.brighterpaths.com.au

SharonBrown www.completefengshui.com

JaneneLaird www.shenchi.com.au

Edgar(LokTin)Yung www.loktinfengshui.com

AlmaLuzGonzalez www.afengshuiwellbeing.com.au

LizetteAkouri www.creativefengshui.com.au

JulieMurdock www.fsld.com.au

TeresaFairlie www.fengshuiwa.com.au

MichelleFrencham www.empoweringspace.com.au

RobBrown www.enhancefengshui.com.au

KonyKang www.fengshuihousing.com.au

YoshieAsahara www.ahappiermedium.com.au

CherylCockrem www.fengshuiforlife.com.au

NadiaSaretta


26

IanCole www.coleizzo.com.au

TraceyJackson www.alivingroom.com.au

JaneLangof www.fengshuiconcepts.com.au

ZdenkaUnderwood

CarolPartridge www.sacredfengshuidesign.com.au

RebeccaSharkie www.focusfengshui.com.au

PaulineLombardi

LindaBrinckman www.fengshuibaby.com.au

GayleAtherton www.fengshui.com.au

TylerJRowe www.chinadragon.com.au

RosemaryCraven www.coloursynergyandbalance.com.au

FenIngersole www.fengshuifensway.com.au

LetinaRussell www.letsfengshui.com.au

DiRyman

PerrieBurton www.fengshuigoldcoast.com

GinaClanfield

SueCaldwell www.fengshuiconsciousenvironment.com.au

CarolynMcCallum www.fengshuiharmony.com.au

AnthonyAshworth www.schoolofsacredplace.com

CelesteSykes www.apathway2fengshui.com.au

SuzannePhoenix www.theredbird.com.au

VarinaOng

LuciaDapos www.northcoteintegratedhealth.com.au

FilomenaLino www.encompassedenergy.com.au

DennisAndrighetto www.harmonyandplacement.com.au

AmandaO'Reilly

FranGleeson www.frangleesonfengshui.com

TheresaGraham

AmandaWoods

CatherineSearles

LibbyScott


27

MichelleCastle www.energizelife.com.au

DrAnaBrandao www.livingharmony.com.au

RobynCollins www.fengshuielements.com.au

DonnaChristie

RozIreland www.fengshui4u.com.au

KerrieJennings www.eagletreefs.com.au

KerriRodley www.domesticdownsizing.com.au

JeannineStephens www.fengshuipower.com.au

DianneSutherland

HowardChoy www.fengshuicollege.org

SaraAllard www.fortunafengshui.com

AnnaZarasyan www.zarainteriors.com.au

JulieDevlin www.trueintent.com.au

JerryKing www.whitedragonhome.com

MinaRZheng www.fengshuiaustralia.com

MarlenaAdamski

SallyKelemete

JenniferScutt www.9starenergy.com.au

Ifyouwouldliketocontributeanarticle,advertisementorcommentstotheAFSCnewsletterpleasecontactusonenquiries@afsc.org.au.

afsc october 2011 newsletter

Documents

feng shui theories

feng shui experts

afsc conference

afsc newsletter

afsc event

president dear members

principles of healthy

healthy development